Psyllid ID: psy1727
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 240 | 2.2.26 [Sep-21-2011] | |||||||
| Q9VN93 | 614 | Putative cysteine protein | yes | N/A | 0.604 | 0.236 | 0.533 | 4e-41 | |
| Q26534 | 319 | Cathepsin L OS=Schistosom | N/A | N/A | 0.65 | 0.489 | 0.464 | 1e-34 | |
| Q10716 | 371 | Cysteine proteinase 1 OS= | N/A | N/A | 0.587 | 0.380 | 0.468 | 1e-32 | |
| P25804 | 363 | Cysteine proteinase 15A O | N/A | N/A | 0.595 | 0.393 | 0.465 | 1e-31 | |
| P43296 | 368 | Cysteine proteinase RD19a | yes | N/A | 0.579 | 0.377 | 0.478 | 2e-31 | |
| Q9UBX1 | 484 | Cathepsin F OS=Homo sapie | yes | N/A | 0.566 | 0.280 | 0.479 | 3e-31 | |
| P43295 | 361 | Probable cysteine protein | no | N/A | 0.587 | 0.390 | 0.471 | 5e-31 | |
| Q9R013 | 462 | Cathepsin F OS=Mus muscul | yes | N/A | 0.566 | 0.294 | 0.465 | 9e-30 | |
| P14658 | 450 | Cysteine proteinase OS=Tr | N/A | N/A | 0.562 | 0.3 | 0.426 | 2e-27 | |
| P04988 | 343 | Cysteine proteinase 1 OS= | no | N/A | 0.583 | 0.408 | 0.427 | 3e-27 |
| >sp|Q9VN93|CPR1_DROME Putative cysteine proteinase CG12163 OS=Drosophila melanogaster GN=CG12163 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 168 bits (425), Expect = 4e-41, Method: Compositional matrix adjust.
Identities = 80/150 (53%), Positives = 102/150 (68%), Gaps = 5/150 (3%)
Query: 62 KLVDCDKVDAGCGGGLMSNAFETIISKLGGGLEGEKDYPYKGSNRACHLNKEEIRVKIQS 121
+L+DCD D+ C GGLM NA++ I K GGLE E +YPYK CH N+ V++
Sbjct: 445 ELLDCDTTDSACNGGLMDNAYKAI--KDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAG 502
Query: 122 YVNV-SSDETEMAKYLVKNGPMAVAINANAMQFYFGGVSHPLKFLCKGGMDNLDHGVLIV 180
+V++ +ET M ++L+ NGP+++ INANAMQFY GGVSHP K LC NLDHGVL+V
Sbjct: 503 FVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALC--SKKNLDHGVLVV 560
Query: 181 GYGVHKTKFTHKIQPYWIIKNSWGPHWGEK 210
GYGV HK PYWI+KNSWGP WGE+
Sbjct: 561 GYGVSDYPNFHKTLPYWIVKNSWGPRWGEQ 590
|
May have a role in autophagic cell death. Drosophila melanogaster (taxid: 7227) EC: 3EC: .EC: 4EC: .EC: 2EC: 2EC: .EC: - |
| >sp|Q26534|CATL_SCHMA Cathepsin L OS=Schistosoma mansoni GN=CL1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q10716|CYSP1_MAIZE Cysteine proteinase 1 OS=Zea mays GN=CCP1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P25804|CYSP_PEA Cysteine proteinase 15A OS=Pisum sativum PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P43296|RD19A_ARATH Cysteine proteinase RD19a OS=Arabidopsis thaliana GN=RD19A PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9UBX1|CATF_HUMAN Cathepsin F OS=Homo sapiens GN=CTSF PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P43295|A494_ARATH Probable cysteine proteinase A494 OS=Arabidopsis thaliana GN=At2g21430 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9R013|CATF_MOUSE Cathepsin F OS=Mus musculus GN=Ctsf PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P14658|CYSP_TRYBB Cysteine proteinase OS=Trypanosoma brucei brucei PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P04988|CYSP1_DICDI Cysteine proteinase 1 OS=Dictyostelium discoideum GN=cprA PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 240 | ||||||
| 244790097 | 586 | cathepsin F isoform 2 precursor [Acyrtho | 0.604 | 0.247 | 0.602 | 6e-48 | |
| 156546466 | 1036 | PREDICTED: hypothetical protein LOC10012 | 0.604 | 0.139 | 0.586 | 7e-48 | |
| 161408101 | 803 | cathepsin F-like cysteine protease [Plau | 0.604 | 0.180 | 0.610 | 8e-48 | |
| 350421176 | 884 | PREDICTED: hypothetical protein LOC10074 | 0.604 | 0.164 | 0.604 | 5e-47 | |
| 383863617 | 884 | PREDICTED: uncharacterized protein LOC10 | 0.604 | 0.164 | 0.604 | 4e-46 | |
| 307200028 | 1032 | Putative cysteine proteinase CG12163 [Ha | 0.604 | 0.140 | 0.583 | 1e-45 | |
| 189239337 | 1726 | PREDICTED: similar to cathepsin F-like c | 0.604 | 0.084 | 0.590 | 2e-45 | |
| 270011071 | 1761 | cystatin [Tribolium castaneum] | 0.604 | 0.082 | 0.590 | 2e-45 | |
| 260234113 | 2676 | cysteine proteinase inhibitor precursor | 0.604 | 0.054 | 0.590 | 4e-45 | |
| 307175778 | 887 | Putative cysteine proteinase CG12163 [Ca | 0.604 | 0.163 | 0.590 | 7e-45 |
| >gi|244790097|ref|NP_001156454.1| cathepsin F isoform 2 precursor [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 196 bits (499), Expect = 6e-48, Method: Compositional matrix adjust.
Identities = 91/151 (60%), Positives = 115/151 (76%), Gaps = 6/151 (3%)
Query: 62 KLVDCDKVDAGCGGGLMSNAFETIISKLGGGLEGEKDYPYKG--SNRACHLNKEEIRVKI 119
+L+DCD +D GCGGGLM+ AFE + + GGLE E DYPY+G + C L K +++V I
Sbjct: 416 ELIDCDNLDNGCGGGLMTQAFEAVENL--GGLETESDYPYEGHADRKGCQLKKSDVKVSI 473
Query: 120 QSYVNVSSDETEMAKYLVKNGPMAVAINANAMQFYFGGVSHPLKFLCKGGMDNLDHGVLI 179
VNVS+DE ++AK+LVK+GP++V +NANAMQFY GGVSHP+ LC +LDHGV I
Sbjct: 474 SKAVNVSTDEEDIAKFLVKHGPLSVGVNANAMQFYMGGVSHPIHALCSP--KSLDHGVAI 531
Query: 180 VGYGVHKTKFTHKIQPYWIIKNSWGPHWGEK 210
VGYGVH+TK+THK PYW+IKNSWGP WGEK
Sbjct: 532 VGYGVHRTKYTHKNLPYWLIKNSWGPGWGEK 562
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156546466|ref|XP_001607324.1| PREDICTED: hypothetical protein LOC100123649 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|161408101|dbj|BAF94154.1| cathepsin F-like cysteine protease [Plautia stali] | Back alignment and taxonomy information |
|---|
| >gi|350421176|ref|XP_003492760.1| PREDICTED: hypothetical protein LOC100745708 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383863617|ref|XP_003707276.1| PREDICTED: uncharacterized protein LOC100880620 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307200028|gb|EFN80374.1| Putative cysteine proteinase CG12163 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|189239337|ref|XP_973607.2| PREDICTED: similar to cathepsin F-like cysteine protease [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270011071|gb|EFA07519.1| cystatin [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|260234113|dbj|BAI44279.1| cysteine proteinase inhibitor precursor [Manduca sexta] gi|261336196|dbj|BAH59606.2| cysteine proteinase inhibitor precursor [Manduca sexta] | Back alignment and taxonomy information |
|---|
| >gi|307175778|gb|EFN65613.1| Putative cysteine proteinase CG12163 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 240 | ||||||
| FB|FBgn0260462 | 614 | CG12163 [Drosophila melanogast | 0.604 | 0.236 | 0.533 | 9.8e-48 | |
| TAIR|locus:2082687 | 367 | AT3G54940 [Arabidopsis thalian | 0.591 | 0.386 | 0.449 | 1.3e-44 | |
| WB|WBGene00007055 | 477 | tag-196 [Caenorhabditis elegan | 0.575 | 0.289 | 0.527 | 3.2e-43 | |
| ZFIN|ZDB-GENE-030131-9831 | 473 | ctsf "cathepsin F" [Danio reri | 0.579 | 0.293 | 0.489 | 5.2e-41 | |
| UNIPROTKB|F1RU48 | 460 | CTSF "Uncharacterized protein" | 0.608 | 0.317 | 0.484 | 5.8e-40 | |
| UNIPROTKB|E2RR02 | 460 | CTSF "Uncharacterized protein" | 0.608 | 0.317 | 0.477 | 5.1e-39 | |
| UNIPROTKB|Q9UBX1 | 484 | CTSF "Cathepsin F" [Homo sapie | 0.608 | 0.301 | 0.471 | 9.3e-38 | |
| RGD|1308181 | 462 | Ctsf "cathepsin F" [Rattus nor | 0.604 | 0.313 | 0.474 | 1.9e-37 | |
| UNIPROTKB|Q0VCU3 | 460 | CTSF "Uncharacterized protein" | 0.604 | 0.315 | 0.468 | 2.4e-37 | |
| TAIR|locus:2120222 | 368 | RD19 "RESPONSIVE TO DEHYDRATIO | 0.575 | 0.375 | 0.489 | 6.4e-37 |
| FB|FBgn0260462 CG12163 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 429 (156.1 bits), Expect = 9.8e-48, Sum P(2) = 9.8e-48
Identities = 80/150 (53%), Positives = 102/150 (68%)
Query: 62 KLVDCDKVDAGCGGGLMSNAFETIISKLGGGLEGEKDYPYKGSNRACHLNKEEIRVKIQS 121
+L+DCD D+ C GGLM NA++ I K GGLE E +YPYK CH N+ V++
Sbjct: 445 ELLDCDTTDSACNGGLMDNAYKAI--KDIGGLEYEAEYPYKAKKNQCHFNRTLSHVQVAG 502
Query: 122 YVNV-SSDETEMAKYLVKNGPMAVAINANAMQFYFGGVSHPLKFLCKGGMDNLDHGVLIV 180
+V++ +ET M ++L+ NGP+++ INANAMQFY GGVSHP K LC NLDHGVL+V
Sbjct: 503 FVDLPKGNETAMQEWLLANGPISIGINANAMQFYRGGVSHPWKALCS--KKNLDHGVLVV 560
Query: 181 GYGVHKTKFTHKIQPYWIIKNSWGPHWGEK 210
GYGV HK PYWI+KNSWGP WGE+
Sbjct: 561 GYGVSDYPNFHKTLPYWIVKNSWGPRWGEQ 590
|
|
| TAIR|locus:2082687 AT3G54940 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007055 tag-196 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-9831 ctsf "cathepsin F" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RU48 CTSF "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RR02 CTSF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UBX1 CTSF "Cathepsin F" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1308181 Ctsf "cathepsin F" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q0VCU3 CTSF "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2120222 RD19 "RESPONSIVE TO DEHYDRATION 19" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q9VN93 | CPR1_DROME | 3, ., 4, ., 2, 2, ., - | 0.5333 | 0.6041 | 0.2361 | yes | N/A |
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 240 | |||
| pfam00112 | 213 | pfam00112, Peptidase_C1, Papain family cysteine pr | 2e-54 | |
| cd02248 | 210 | cd02248, Peptidase_C1A, Peptidase C1A subfamily (M | 2e-51 | |
| smart00645 | 175 | smart00645, Pept_C1, Papain family cysteine protea | 2e-33 | |
| PTZ00203 | 348 | PTZ00203, PTZ00203, cathepsin L protease; Provisio | 6e-33 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 8e-23 | |
| cd02621 | 243 | cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; al | 2e-22 | |
| PTZ00200 | 448 | PTZ00200, PTZ00200, cysteine proteinase; Provision | 5e-21 | |
| cd02619 | 223 | cd02619, Peptidase_C1, C1 Peptidase family (MEROPS | 1e-17 | |
| cd02620 | 236 | cd02620, Peptidase_C1A_CathepsinB, Cathepsin B gro | 1e-12 | |
| cd02698 | 239 | cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; th | 7e-11 | |
| smart00848 | 57 | smart00848, Inhibitor_I29, Cathepsin propeptide in | 2e-08 | |
| pfam08246 | 58 | pfam08246, Inhibitor_I29, Cathepsin propeptide inh | 4e-08 | |
| PTZ00462 | 1004 | PTZ00462, PTZ00462, Serine-repeat antigen protein; | 1e-07 | |
| PTZ00049 | 693 | PTZ00049, PTZ00049, cathepsin C-like protein; Prov | 3e-07 | |
| COG4870 | 372 | COG4870, COG4870, Cysteine protease [Posttranslati | 4e-06 | |
| PTZ00364 | 548 | PTZ00364, PTZ00364, dipeptidyl-peptidase I precurs | 2e-05 | |
| PTZ00021 | 489 | PTZ00021, PTZ00021, falcipain-2; Provisional | 4e-04 |
| >gnl|CDD|215726 pfam00112, Peptidase_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
Score = 173 bits (441), Expect = 2e-54
Identities = 67/152 (44%), Positives = 78/152 (51%), Gaps = 17/152 (11%)
Query: 63 LVDCDKVDAGCGGGLMSNAFETIISKLGGGLEGEKDYPYKGSNRACHLNKE-EIRVKIQS 121
LVDCD + GC GGL NAFE I GG+ E DYPY + C K KI+
Sbjct: 53 LVDCDTGNNGCNGGLPDNAFEYIKKN--GGIVTESDYPYTAHDGTCKFKKSNSKYAKIKG 110
Query: 122 YVNVSS-DETEMAKYLVKNGPMAVAINANAM--QFYFGGVSHPLKFLCKGGMDNLDHGVL 178
Y +V DE + L KNGP++VAI+A Q Y GV + C G LDH VL
Sbjct: 111 YGDVPYNDEEALQAALAKNGPVSVAIDAYEDDFQLYKSGVYKHTE--CSG---ELDHAVL 165
Query: 179 IVGYGVHKTKFTHKIQPYWIIKNSWGPHWGEK 210
IVGYG PYWI+KNSWG WGE
Sbjct: 166 IVGYGTENGV------PYWIVKNSWGTDWGEN 191
|
Length = 213 |
| >gnl|CDD|239068 cd02248, Peptidase_C1A, Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >gnl|CDD|214761 smart00645, Pept_C1, Papain family cysteine protease | Back alignment and domain information |
|---|
| >gnl|CDD|185513 PTZ00203, PTZ00203, cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239112 cd02621, Peptidase_C1A_CathepsinC, Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >gnl|CDD|240310 PTZ00200, PTZ00200, cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239110 cd02619, Peptidase_C1, C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >gnl|CDD|239111 cd02620, Peptidase_C1A_CathepsinB, Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >gnl|CDD|239149 cd02698, Peptidase_C1A_CathepsinX, Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >gnl|CDD|214853 smart00848, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|219764 pfam08246, Inhibitor_I29, Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >gnl|CDD|185641 PTZ00462, PTZ00462, Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240244 PTZ00049, PTZ00049, cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227207 COG4870, COG4870, Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|240381 PTZ00364, PTZ00364, dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|240232 PTZ00021, PTZ00021, falcipain-2; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 240 | |||
| KOG1542|consensus | 372 | 100.0 | ||
| PTZ00203 | 348 | cathepsin L protease; Provisional | 100.0 | |
| PTZ00021 | 489 | falcipain-2; Provisional | 100.0 | |
| PTZ00200 | 448 | cysteine proteinase; Provisional | 100.0 | |
| KOG1543|consensus | 325 | 100.0 | ||
| cd02621 | 243 | Peptidase_C1A_CathepsinC Cathepsin C; also known a | 100.0 | |
| cd02698 | 239 | Peptidase_C1A_CathepsinX Cathepsin X; the only pap | 100.0 | |
| cd02620 | 236 | Peptidase_C1A_CathepsinB Cathepsin B group; compos | 100.0 | |
| cd02248 | 210 | Peptidase_C1A Peptidase C1A subfamily (MEROPS data | 100.0 | |
| PTZ00049 | 693 | cathepsin C-like protein; Provisional | 100.0 | |
| PTZ00364 | 548 | dipeptidyl-peptidase I precursor; Provisional | 100.0 | |
| PF00112 | 219 | Peptidase_C1: Papain family cysteine protease This | 100.0 | |
| PTZ00462 | 1004 | Serine-repeat antigen protein; Provisional | 100.0 | |
| smart00645 | 174 | Pept_C1 Papain family cysteine protease. | 99.97 | |
| cd02619 | 223 | Peptidase_C1 C1 Peptidase family (MEROPS database | 99.97 | |
| KOG1544|consensus | 470 | 99.96 | ||
| cd00585 | 437 | Peptidase_C1B Peptidase C1B subfamily (MEROPS data | 99.72 | |
| COG4870 | 372 | Cysteine protease [Posttranslational modification, | 99.58 | |
| PF03051 | 438 | Peptidase_C1_2: Peptidase C1-like family This fami | 99.03 | |
| PF08246 | 58 | Inhibitor_I29: Cathepsin propeptide inhibitor doma | 98.82 | |
| smart00848 | 57 | Inhibitor_I29 Cathepsin propeptide inhibitor domai | 98.52 | |
| COG3579 | 444 | PepC Aminopeptidase C [Amino acid transport and me | 97.57 | |
| PF13529 | 144 | Peptidase_C39_2: Peptidase_C39 like family; PDB: 3 | 92.05 | |
| PF14399 | 317 | Transpep_BrtH: NlpC/p60-like transpeptidase | 88.92 | |
| PF09778 | 212 | Guanylate_cyc_2: Guanylylate cyclase; InterPro: IP | 88.2 | |
| PF05543 | 175 | Peptidase_C47: Staphopain peptidase C47; InterPro: | 82.19 | |
| KOG4128|consensus | 457 | 81.72 |
| >KOG1542|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-57 Score=383.62 Aligned_cols=210 Identities=46% Similarity=0.812 Sum_probs=186.5
Q ss_pred CChhhHHHHHHHHHHHhCcccCCHHHHHHHHHHHHHHHHHHHhc---CCc------------------------------
Q psy1727 10 HDKLEHVAMFNHFLEKHNKSYATKEEYHKRLRIFRANLKKIQIR---GEG------------------------------ 56 (240)
Q Consensus 10 ~~~~~~~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~n~~~i~~~---n~g------------------------------ 56 (240)
+..+..+++|..|+.+|+|+|.+.+|..+|+.||++|+..++++ ++|
T Consensus 62 ~~~l~~~~~F~~F~~kf~r~Y~s~eE~~~Rl~iF~~N~~~a~~~q~~d~gsA~yGvtqFSDlT~eEFkk~~l~~~~~~~~ 141 (372)
T KOG1542|consen 62 PRGLGLEDSFKLFTIKFGRSYASREEHAHRLSIFKHNLLRAERLQENDPGSAEYGVTQFSDLTEEEFKKIYLGVKRRGSK 141 (372)
T ss_pred CcccchHHHHHHHHHhcCcccCcHHHHHHHHHHHHHHHHHHHHhhhcCccccccCccchhhcCHHHHHHHhhcccccccc
Confidence 33455589999999999999999999999999999999999543 232
Q ss_pred --------------------------------------------ceece-----------------eEecCCCCCCCCCC
Q psy1727 57 --------------------------------------------THLAL-----------------KLVDCDKVDAGCGG 75 (240)
Q Consensus 57 --------------------------------------------~~g~l-----------------qlvDCs~~~~gC~G 75 (240)
+||+| |||||+.++.||+|
T Consensus 142 ~~~~~~~~~~~~~~~lP~~fDWR~kgaVTpVKnQG~CGSCWAFS~tG~vEga~~i~~g~LvsLSEQeLvDCD~~d~gC~G 221 (372)
T KOG1542|consen 142 LPGDAAEAPIEPGESLPESFDWRDKGAVTPVKNQGMCGSCWAFSTTGAVEGAWAIATGKLVSLSEQELVDCDSCDNGCNG 221 (372)
T ss_pred CccccccCcCCCCCCCCcccchhccCCccccccCCcCcchhhhhhhhhhhhHHHhhcCcccccchhhhhcccCcCCcCCC
Confidence 24443 99999999999999
Q ss_pred CccchHHHHHHHhcCCCccCCcccccccCCC-cccCCcccceeEEeEeeeechhHHHHHHHHHhCCCeEEEEeccccccc
Q psy1727 76 GLMSNAFETIISKLGGGLEGEKDYPYKGSNR-ACHLNKEEIRVKIQSYVNVSSDETEMAKYLVKNGPMAVAINANAMQFY 154 (240)
Q Consensus 76 G~~~~A~~yi~~~~~~Gi~~e~~yPY~~~~~-~C~~~~~~~~~~i~~~~~v~~~~~~i~~~l~~~GPv~v~~~~~~f~~Y 154 (240)
|.+..||+|++ +. +||..|.+|||++..+ .|..++....+.|.+|..++.||++|.++|.++|||+|+|++..+|+|
T Consensus 222 Gl~~nA~~~~~-~~-gGL~~E~dYPY~g~~~~~C~~~~~~~~v~I~~f~~l~~nE~~ia~wLv~~GPi~vgiNa~~mQ~Y 299 (372)
T KOG1542|consen 222 GLMDNAFKYIK-KA-GGLEKEKDYPYTGKKGNQCHFDKSKIVVSIKDFSMLSNNEDQIAAWLVTFGPLSVGINAKPMQFY 299 (372)
T ss_pred CChhHHHHHHH-Hh-CCccccccCCccccCCCccccchhhceEEEeccEecCCCHHHHHHHHHhcCCeEEEEchHHHHHh
Confidence 99999999977 66 7999999999999997 999999999999999999999999999999999999999998889999
Q ss_pred cCCcccCCCcccCCCCCCCCccEEEEEEeecccccccCCcCEEEEecccCCCcCCCCcceEEEECCCCCccccceeE
Q psy1727 155 FGGVSHPLKFLCKGGMDNLDHGVLIVGYGVHKTKFTHKIQPYWIIKNSWGPHWGEKTMPFWIIKNSWGPRWGEQVTK 231 (240)
Q Consensus 155 ~~Gv~~~~~~~c~~~~~~~~Hav~iVGyg~~~~~~~~~g~~yWivkNSWG~~WG~~G~~y~~i~~~~~~~~g~~~~~ 231 (240)
.+||+.+....|+. ..++|+|||||||... -.++|||||||||+.|||+| ||||.||. +.||++..+
T Consensus 300 rgGV~~P~~~~Cs~--~~~~HaVLlvGyG~~g-----~~~PYWIVKNSWG~~WGE~G--Y~~l~RG~-N~CGi~~mv 366 (372)
T KOG1542|consen 300 RGGVSCPSKYICSP--KLLNHAVLLVGYGSSG-----YEKPYWIVKNSWGTSWGEKG--YYKLCRGS-NACGIADMV 366 (372)
T ss_pred cccccCCCcccCCc--cccCceEEEEeecCCC-----CCCceEEEECCccccccccc--eEEEeccc-cccccccch
Confidence 99999995558996 5599999999999882 27899999999999999999 99999996 567777443
|
|
| >PTZ00203 cathepsin L protease; Provisional | Back alignment and domain information |
|---|
| >PTZ00021 falcipain-2; Provisional | Back alignment and domain information |
|---|
| >PTZ00200 cysteine proteinase; Provisional | Back alignment and domain information |
|---|
| >KOG1543|consensus | Back alignment and domain information |
|---|
| >cd02621 Peptidase_C1A_CathepsinC Cathepsin C; also known as Dipeptidyl Peptidase I (DPPI), an atypical papain-like cysteine peptidase with chloride dependency and dipeptidyl aminopeptidase activity, resulting from its tetrameric structure which limits substrate access | Back alignment and domain information |
|---|
| >cd02698 Peptidase_C1A_CathepsinX Cathepsin X; the only papain-like lysosomal cysteine peptidase exhibiting carboxymonopeptidase activity | Back alignment and domain information |
|---|
| >cd02620 Peptidase_C1A_CathepsinB Cathepsin B group; composed of cathepsin B and similar proteins, including tubulointerstitial nephritis antigen (TIN-Ag) | Back alignment and domain information |
|---|
| >cd02248 Peptidase_C1A Peptidase C1A subfamily (MEROPS database nomenclature); composed of cysteine peptidases (CPs) similar to papain, including the mammalian CPs (cathepsins B, C, F, H, L, K, O, S, V, X and W) | Back alignment and domain information |
|---|
| >PTZ00049 cathepsin C-like protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00364 dipeptidyl-peptidase I precursor; Provisional | Back alignment and domain information |
|---|
| >PF00112 Peptidase_C1: Papain family cysteine protease This is family C1 in the peptidase classification | Back alignment and domain information |
|---|
| >PTZ00462 Serine-repeat antigen protein; Provisional | Back alignment and domain information |
|---|
| >smart00645 Pept_C1 Papain family cysteine protease | Back alignment and domain information |
|---|
| >cd02619 Peptidase_C1 C1 Peptidase family (MEROPS database nomenclature), also referred to as the papain family; composed of two subfamilies of cysteine peptidases (CPs), C1A (papain) and C1B (bleomycin hydrolase) | Back alignment and domain information |
|---|
| >KOG1544|consensus | Back alignment and domain information |
|---|
| >cd00585 Peptidase_C1B Peptidase C1B subfamily (MEROPS database nomenclature); composed of eukaryotic bleomycin hydrolases (BH) and bacterial aminopeptidases C (pepC) | Back alignment and domain information |
|---|
| >COG4870 Cysteine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF03051 Peptidase_C1_2: Peptidase C1-like family This family is a subfamily of the Prosite entry; InterPro: IPR004134 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF08246 Inhibitor_I29: Cathepsin propeptide inhibitor domain (I29); InterPro: IPR013201 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >smart00848 Inhibitor_I29 Cathepsin propeptide inhibitor domain (I29) | Back alignment and domain information |
|---|
| >COG3579 PepC Aminopeptidase C [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF13529 Peptidase_C39_2: Peptidase_C39 like family; PDB: 3ERV_A | Back alignment and domain information |
|---|
| >PF14399 Transpep_BrtH: NlpC/p60-like transpeptidase | Back alignment and domain information |
|---|
| >PF09778 Guanylate_cyc_2: Guanylylate cyclase; InterPro: IPR018616 Members of this family of proteins catalyse the conversion of guanosine triphosphate (GTP) to 3',5'-cyclic guanosine monophosphate (cGMP) and pyrophosphate | Back alignment and domain information |
|---|
| >PF05543 Peptidase_C47: Staphopain peptidase C47; InterPro: IPR008750 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG4128|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 240 | ||||
| 1m6d_A | 214 | Crystal Structure Of Human Cathepsin F Length = 214 | 2e-32 | ||
| 2p7u_A | 215 | The Crystal Structure Of Rhodesain, The Major Cyste | 2e-28 | ||
| 1ewp_A | 215 | Cruzain Bound To Mor-Leu-Hpq Length = 215 | 1e-26 | ||
| 3iut_A | 221 | The Crystal Structure Of Cruzain In Complex With A | 2e-26 | ||
| 3hd3_A | 215 | High Resolution Crystal Structure Of Cruzain Bound | 2e-26 | ||
| 1aim_A | 215 | Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluor | 2e-26 | ||
| 2fo5_A | 262 | Crystal Structure Of Recombinant Barley Cysteine En | 1e-21 | ||
| 1s4v_A | 229 | The 2.0 A Crystal Structure Of The Kdel-Tailed Cyst | 3e-21 | ||
| 7pck_A | 314 | Crystal Structure Of Wild Type Human Procathepsin K | 8e-21 | ||
| 2f7d_A | 215 | A Mutant Rabbit Cathepsin K With A Nitrile Inhibito | 1e-20 | ||
| 1cs8_A | 316 | Crystal Structure Of Procathepsin L Length = 316 | 1e-20 | ||
| 3hwn_A | 258 | Cathepsin L With Az13010160 Length = 258 | 1e-20 | ||
| 1mem_A | 215 | Crystal Structure Of Cathepsin K Complexed With A P | 2e-20 | ||
| 1u9v_A | 217 | Crystal Structure Of The Cysteine Protease Human Ca | 2e-20 | ||
| 3ovz_A | 213 | Cathepsin K In Complex With A Covalent Inhibitor Wi | 2e-20 | ||
| 1snk_A | 214 | Cathepsin K Complexed With Carbamate Derivatized No | 2e-20 | ||
| 3bc3_A | 220 | Exploring Inhibitor Binding At The S Subsites Of Ca | 2e-20 | ||
| 3iv2_A | 220 | Crystal Structure Of Mature Apo-Cathepsin L C25a Mu | 2e-20 | ||
| 3qt4_A | 329 | Structure Of Digestive Procathepsin L 3 Of Tenebrio | 2e-20 | ||
| 2nqd_B | 221 | Crystal Structure Of Cysteine Protease Inhibitor, C | 2e-20 | ||
| 3of8_A | 221 | Structural Basis For Reversible And Irreversible In | 2e-20 | ||
| 3h89_A | 220 | A Combined Crystallographic And Molecular Dynamics | 2e-20 | ||
| 3hha_A | 220 | Crystal Structure Of Cathepsin L In Complex With Az | 2e-20 | ||
| 1cjl_A | 312 | Crystal Structure Of A Cysteine Protease Proform Le | 2e-20 | ||
| 3kse_A | 220 | Unreduced Cathepsin L In Complex With Stefin A Leng | 2e-20 | ||
| 3h7d_A | 215 | The Crystal Structure Of The Cathepsin K Variant M5 | 3e-19 | ||
| 3h6s_A | 221 | Strucure Of Clitocypin - Cathepsin V Complex Length | 4e-19 | ||
| 1fh0_A | 221 | Crystal Structure Of Human Cathepsin V Complexed Wi | 4e-19 | ||
| 3qj3_A | 331 | Structure Of Digestive Procathepsin L2 Proteinase F | 8e-19 | ||
| 1vsn_A | 215 | Crystal Structure Of A Potent Small Molecule Inhibi | 9e-19 | ||
| 2vhs_A | 217 | Cathsilicatein, A Chimera Length = 217 | 1e-18 | ||
| 3bcn_A | 209 | Crystal Structure Of A Papain-Like Cysteine Proteas | 4e-18 | ||
| 3f75_A | 224 | Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In | 5e-18 | ||
| 1cqd_A | 221 | The 2.1 Angstrom Structure Of A Cysteine Protease W | 9e-18 | ||
| 1iwd_A | 215 | Proposed Amino Acid Sequence And The 1.63 Angstrom | 1e-17 | ||
| 3u8e_A | 222 | Crystal Structure Of Cysteine Protease From Bulbs O | 2e-17 | ||
| 2o6x_A | 310 | Crystal Structure Of Procathepsin L1 From Fasciola | 6e-17 | ||
| 2pns_A | 208 | 1.9 Angstrom Resolution Crystal Structure Of A Plan | 1e-16 | ||
| 2g6d_A | 217 | Human Cathepsin S Mutant With Vinyl Sulfone Inhibit | 5e-16 | ||
| 3p5u_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 6e-16 | ||
| 3bpm_A | 243 | Crystal Structure Of Falcipain-3 With Its Inhibitor | 6e-16 | ||
| 3p5w_A | 220 | Actinidin From Actinidia Arguta Planch (Sarusashi) | 7e-16 | ||
| 2fye_A | 217 | Mutant Human Cathepsin S With Irreversible Inhibito | 8e-16 | ||
| 2c0y_A | 315 | The Crystal Structure Of A Cys25ala Mutant Of Human | 9e-16 | ||
| 1o0e_A | 208 | 1.9 Angstrom Crystal Structure Of A Plant Cysteine | 1e-15 | ||
| 3iej_A | 222 | Pyrazole-Based Cathepsin S Inhibitors With Arylalky | 1e-15 | ||
| 1ms6_A | 222 | Dipeptide Nitrile Inhibitor Bound To Cathepsin S. L | 1e-15 | ||
| 3kwn_A | 219 | Cathepsin S In Complex With Thioether Acetamide P3 | 2e-15 | ||
| 1npz_A | 217 | Crystal Structures Of Cathepsin S Inhibitor Complex | 2e-15 | ||
| 3mpe_A | 220 | Crystal Structure Of Human Cathepsin-S C25s Mutant | 2e-15 | ||
| 3ovx_A | 218 | Cathepsin S In Complex With A Covalent Inhibitor Wi | 2e-15 | ||
| 2f1g_A | 220 | Cathepsin S In Complex With Non-Covalent 2-(Benzoxa | 2e-15 | ||
| 2fq9_A | 225 | Cathepsin S With Nitrile Inhibitor Length = 225 | 2e-15 | ||
| 3n3g_A | 217 | 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitri | 2e-15 | ||
| 1glo_A | 217 | Crystal Structure Of Cys25ser Mutant Of Human Cathe | 4e-15 | ||
| 8pch_A | 220 | Crystal Structure Of Porcine Cathepsin H Determined | 5e-15 | ||
| 3pnr_A | 240 | Structure Of Pbicp-C In Complex With Falcipain-2 Le | 6e-15 | ||
| 1yvb_A | 241 | The Plasmodium Falciparum Cysteine Protease Falcipa | 7e-15 | ||
| 1mhw_A | 175 | Design Of Non-covalent Inhibitors Of Human Cathepsi | 2e-14 | ||
| 1icf_A | 175 | Crystal Structure Of Mhc Class Ii Associated P41 Ii | 2e-14 | ||
| 1aec_A | 218 | Crystal Structure Of Actinidin-E-64 Complex+ Length | 3e-14 | ||
| 1yal_A | 218 | Carica Papaya Chymopapain At 1.7 Angstroms Resoluti | 4e-14 | ||
| 2act_A | 220 | Crystallographic Refinement Of The Structure Of Act | 6e-14 | ||
| 2bdz_A | 214 | Mexicain From Jacaratia Mexicana Length = 214 | 3e-13 | ||
| 2b1m_A | 246 | Crystal Structure Of A Papain-Fold Protein Without | 4e-13 | ||
| 1stf_E | 212 | The Refined 2.4 Angstroms X-Ray Crystal Structure O | 6e-10 | ||
| 1ppp_A | 212 | Crystal Structure Of Papain-E64-C Complex. Binding | 7e-10 | ||
| 1pip_A | 212 | Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Al | 7e-10 | ||
| 2cio_A | 212 | The High Resolution X-Ray Structure Of Papain Compl | 8e-10 | ||
| 3ima_A | 212 | Complex Strcuture Of Tarocystatin And Papain Length | 9e-10 | ||
| 1khp_A | 212 | Monoclinic Form Of Papain/zlfg-dam Covalent Complex | 1e-09 | ||
| 3tnx_A | 363 | Structure Of The Precursor Of A Thermostable Varian | 1e-09 | ||
| 1jqp_A | 438 | Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric | 2e-09 | ||
| 3pdf_A | 441 | Discovery Of Novel Cyanamide-Based Inhibitors Of Ca | 8e-09 | ||
| 3ioq_A | 213 | Crystal Structure Of The Carica Candamarcensis Cyst | 6e-08 | ||
| 2wbf_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 6e-07 | ||
| 3ch2_X | 265 | Crystal Structure Analysis Of Sera5e From Plasmodiu | 1e-06 | ||
| 1gec_E | 216 | Glycyl Endopeptidase-complex With Benzyloxycarbonyl | 2e-05 | ||
| 1deu_A | 277 | Crystal Structure Of Human Procathepsin X: A Cystei | 5e-05 | ||
| 1ef7_A | 242 | Crystal Structure Of Human Cathepsin X Length = 242 | 5e-05 | ||
| 3d6s_A | 223 | Crystal Structure Of Mite Allergen Der F 1 Length = | 1e-04 | ||
| 1ppo_A | 216 | Determination Of The Structure Of Papaya Protease O | 2e-04 | ||
| 1sp4_B | 205 | Crystal Structure Of Ns-134 In Complex With Bovine | 2e-04 | ||
| 1qdq_A | 253 | X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 | 3e-04 | ||
| 3qsd_A | 254 | Structure Of Cathepsin B1 From Schistosoma Mansoni | 4e-04 | ||
| 1ito_A | 256 | Crystal Structure Analysis Of Bovine Spleen Catheps | 5e-04 | ||
| 1meg_A | 216 | Crystal Structure Of A Caricain D158e Mutant In Com | 6e-04 | ||
| 1pci_A | 322 | Procaricain Length = 322 | 8e-04 |
| >pdb|1M6D|A Chain A, Crystal Structure Of Human Cathepsin F Length = 214 | Back alignment and structure |
|
| >pdb|2P7U|A Chain A, The Crystal Structure Of Rhodesain, The Major Cysteine Protease Of T. Brucei Rhodesiense, Bound To Inhibitor K777 Length = 215 | Back alignment and structure |
| >pdb|1EWP|A Chain A, Cruzain Bound To Mor-Leu-Hpq Length = 215 | Back alignment and structure |
| >pdb|3IUT|A Chain A, The Crystal Structure Of Cruzain In Complex With A Tetrafluorophenoxymethyl Ketone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3HD3|A Chain A, High Resolution Crystal Structure Of Cruzain Bound To The Vinyl Sulfone Inhibitor Smdc-256047 Length = 215 | Back alignment and structure |
| >pdb|1AIM|A Chain A, Cruzain Inhibited By Benzoyl-Tyrosine-Alanine-Fluoromethylketone Length = 215 | Back alignment and structure |
| >pdb|2FO5|A Chain A, Crystal Structure Of Recombinant Barley Cysteine Endoprotease B Isoform 2 (Ep-B2) In Complex With Leupeptin Length = 262 | Back alignment and structure |
| >pdb|1S4V|A Chain A, The 2.0 A Crystal Structure Of The Kdel-Tailed Cysteine Endopeptidase Functioning In Programmed Cell Death Of Ricinus Communis Endosperm Length = 229 | Back alignment and structure |
| >pdb|7PCK|A Chain A, Crystal Structure Of Wild Type Human Procathepsin K Length = 314 | Back alignment and structure |
| >pdb|2F7D|A Chain A, A Mutant Rabbit Cathepsin K With A Nitrile Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1CS8|A Chain A, Crystal Structure Of Procathepsin L Length = 316 | Back alignment and structure |
| >pdb|3HWN|A Chain A, Cathepsin L With Az13010160 Length = 258 | Back alignment and structure |
| >pdb|1MEM|A Chain A, Crystal Structure Of Cathepsin K Complexed With A Potent Vinyl Sulfone Inhibitor Length = 215 | Back alignment and structure |
| >pdb|1U9V|A Chain A, Crystal Structure Of The Cysteine Protease Human Cathepsin K In Complex With The Covalent Inhibitor Nvp-Abe854 Length = 217 | Back alignment and structure |
| >pdb|3OVZ|A Chain A, Cathepsin K In Complex With A Covalent Inhibitor With A Ketoamide Warhead Length = 213 | Back alignment and structure |
| >pdb|1SNK|A Chain A, Cathepsin K Complexed With Carbamate Derivatized Norleucine Aldehyde Length = 214 | Back alignment and structure |
| >pdb|3BC3|A Chain A, Exploring Inhibitor Binding At The S Subsites Of Cathepsin L Length = 220 | Back alignment and structure |
| >pdb|3IV2|A Chain A, Crystal Structure Of Mature Apo-Cathepsin L C25a Mutant Length = 220 | Back alignment and structure |
| >pdb|3QT4|A Chain A, Structure Of Digestive Procathepsin L 3 Of Tenebrio Molitor Larval Midgut Length = 329 | Back alignment and structure |
| >pdb|2NQD|B Chain B, Crystal Structure Of Cysteine Protease Inhibitor, Chagasin, In Complex With Human Cathepsin L Length = 221 | Back alignment and structure |
| >pdb|3OF8|A Chain A, Structural Basis For Reversible And Irreversible Inhibition Of Human Cathepsin L By Their Respective Dipeptidyl Glyoxal And Diazomethylketone Inhibitors Length = 221 | Back alignment and structure |
| >pdb|3H89|A Chain A, A Combined Crystallographic And Molecular Dynamics Study Of Cathepsin-L Retro-Binding Inhibitors(Compound 4) Length = 220 | Back alignment and structure |
| >pdb|3HHA|A Chain A, Crystal Structure Of Cathepsin L In Complex With Az12878478 Length = 220 | Back alignment and structure |
| >pdb|1CJL|A Chain A, Crystal Structure Of A Cysteine Protease Proform Length = 312 | Back alignment and structure |
| >pdb|3KSE|A Chain A, Unreduced Cathepsin L In Complex With Stefin A Length = 220 | Back alignment and structure |
| >pdb|3H7D|A Chain A, The Crystal Structure Of The Cathepsin K Variant M5 In Compl Chondroitin-4-Sulfate Length = 215 | Back alignment and structure |
| >pdb|3H6S|A Chain A, Strucure Of Clitocypin - Cathepsin V Complex Length = 221 | Back alignment and structure |
| >pdb|1FH0|A Chain A, Crystal Structure Of Human Cathepsin V Complexed With An Irreversible Vinyl Sulfone Inhibitor Length = 221 | Back alignment and structure |
| >pdb|3QJ3|A Chain A, Structure Of Digestive Procathepsin L2 Proteinase From Tenebrio Molitor Larval Midgut Length = 331 | Back alignment and structure |
| >pdb|1VSN|A Chain A, Crystal Structure Of A Potent Small Molecule Inhibitor Bound To Cathepsin K Length = 215 | Back alignment and structure |
| >pdb|2VHS|A Chain A, Cathsilicatein, A Chimera Length = 217 | Back alignment and structure |
| >pdb|3BCN|A Chain A, Crystal Structure Of A Papain-Like Cysteine Protease Ervatamin-A Complexed With Irreversible Inhibitor E-64 Length = 209 | Back alignment and structure |
| >pdb|3F75|A Chain A, Activated Toxoplasma Gondii Cathepsin L (Tgcpl) In Complex With Its Propeptide Length = 224 | Back alignment and structure |
| >pdb|1CQD|A Chain A, The 2.1 Angstrom Structure Of A Cysteine Protease With Proline Specificity From Ginger Rhizome, Zingiber Officinale Length = 221 | Back alignment and structure |
| >pdb|1IWD|A Chain A, Proposed Amino Acid Sequence And The 1.63 Angstrom X-ray Crystal Structure Of A Plant Cysteine Protease Ervatamin B: Insight Into The Structural Basis Of Its Stability And Substrate Specificity Length = 215 | Back alignment and structure |
| >pdb|3U8E|A Chain A, Crystal Structure Of Cysteine Protease From Bulbs Of Crocus Sativus At 1.3 A Resolution Length = 222 | Back alignment and structure |
| >pdb|2O6X|A Chain A, Crystal Structure Of Procathepsin L1 From Fasciola Hepatica Length = 310 | Back alignment and structure |
| >pdb|2PNS|A Chain A, 1.9 Angstrom Resolution Crystal Structure Of A Plant Cysteine Protease Ervatamin-C Refinement With Cdna Derived Amino Acid Sequence Length = 208 | Back alignment and structure |
| >pdb|2G6D|A Chain A, Human Cathepsin S Mutant With Vinyl Sulfone Inhibitor Cra- 14009 Length = 217 | Back alignment and structure |
| >pdb|3P5U|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|3BPM|A Chain A, Crystal Structure Of Falcipain-3 With Its Inhibitor, Leupeptin Length = 243 | Back alignment and structure |
| >pdb|3P5W|A Chain A, Actinidin From Actinidia Arguta Planch (Sarusashi) Length = 220 | Back alignment and structure |
| >pdb|2FYE|A Chain A, Mutant Human Cathepsin S With Irreversible Inhibitor Cra- 14013 Length = 217 | Back alignment and structure |
| >pdb|2C0Y|A Chain A, The Crystal Structure Of A Cys25ala Mutant Of Human Procathepsin S Length = 315 | Back alignment and structure |
| >pdb|1O0E|A Chain A, 1.9 Angstrom Crystal Structure Of A Plant Cysteine Protease Ervatamin C Length = 208 | Back alignment and structure |
| >pdb|3IEJ|A Chain A, Pyrazole-Based Cathepsin S Inhibitors With Arylalkynes As P1 Binding Elements Length = 222 | Back alignment and structure |
| >pdb|1MS6|A Chain A, Dipeptide Nitrile Inhibitor Bound To Cathepsin S. Length = 222 | Back alignment and structure |
| >pdb|3KWN|A Chain A, Cathepsin S In Complex With Thioether Acetamide P3 Inhibitor Length = 219 | Back alignment and structure |
| >pdb|1NPZ|A Chain A, Crystal Structures Of Cathepsin S Inhibitor Complexes Length = 217 | Back alignment and structure |
| >pdb|3MPE|A Chain A, Crystal Structure Of Human Cathepsin-S C25s Mutant With Bound Drug Length = 220 | Back alignment and structure |
| >pdb|3OVX|A Chain A, Cathepsin S In Complex With A Covalent Inhibitor With An Aldehyde Warhead Length = 218 | Back alignment and structure |
| >pdb|2F1G|A Chain A, Cathepsin S In Complex With Non-Covalent 2-(Benzoxazol-2-Ylamino)- Acetamide Length = 220 | Back alignment and structure |
| >pdb|2FQ9|A Chain A, Cathepsin S With Nitrile Inhibitor Length = 225 | Back alignment and structure |
| >pdb|3N3G|A Chain A, 4-(3-Trifluoromethylphenyl)-Pyrimidine-2-Carbonitrile As Cathepsin S Inhibitors: N3, Not N1 Is Critically Important Length = 217 | Back alignment and structure |
| >pdb|1GLO|A Chain A, Crystal Structure Of Cys25ser Mutant Of Human Cathepsin S Length = 217 | Back alignment and structure |
| >pdb|8PCH|A Chain A, Crystal Structure Of Porcine Cathepsin H Determined At 2.1 Angstrom Resolution: Location Of The Mini-Chain C-Terminal Carboxyl Group Defines Cathepsin H Aminopeptidase Function Length = 220 | Back alignment and structure |
| >pdb|3PNR|A Chain A, Structure Of Pbicp-C In Complex With Falcipain-2 Length = 240 | Back alignment and structure |
| >pdb|1YVB|A Chain A, The Plasmodium Falciparum Cysteine Protease Falcipain-2 Length = 241 | Back alignment and structure |
| >pdb|1MHW|A Chain A, Design Of Non-covalent Inhibitors Of Human Cathepsin L. From The 96- Residue Proregion To Optimized Tripeptides Length = 175 | Back alignment and structure |
| >pdb|1ICF|A Chain A, Crystal Structure Of Mhc Class Ii Associated P41 Ii Fragment In Complex With Cathepsin L Length = 175 | Back alignment and structure |
| >pdb|1AEC|A Chain A, Crystal Structure Of Actinidin-E-64 Complex+ Length = 218 | Back alignment and structure |
| >pdb|1YAL|A Chain A, Carica Papaya Chymopapain At 1.7 Angstroms Resolution Length = 218 | Back alignment and structure |
| >pdb|2ACT|A Chain A, Crystallographic Refinement Of The Structure Of Actinidin At 1.7 Angstroms Resolution By Fast Fourier Least-Squares Methods Length = 220 | Back alignment and structure |
| >pdb|2BDZ|A Chain A, Mexicain From Jacaratia Mexicana Length = 214 | Back alignment and structure |
| >pdb|2B1M|A Chain A, Crystal Structure Of A Papain-Fold Protein Without The Catalytic Cysteine From Seeds Of Pachyrhizus Erosus Length = 246 | Back alignment and structure |
| >pdb|1STF|E Chain E, The Refined 2.4 Angstroms X-Ray Crystal Structure Of Recombinant Human Stefin B In Complex With The Cysteine Proteinase Papain: A Novel Type Of Proteinase Inhibitor Interaction Length = 212 | Back alignment and structure |
| >pdb|1PPP|A Chain A, Crystal Structure Of Papain-E64-C Complex. Binding Diversity Of E64-C To Papain S2 And S3 Subsites Length = 212 | Back alignment and structure |
| >pdb|1PIP|A Chain A, Crystal Structure Of Papain-Succinyl-Gln-Val-Val-Ala-Ala-P- Nitroanilide Complex At 1.7 Angstroms Resolution: Noncovalent Binding Mode Of A Common Sequence Of Endogenous Thiol Protease Inhibitors Length = 212 | Back alignment and structure |
| >pdb|2CIO|A Chain A, The High Resolution X-Ray Structure Of Papain Complexed With Fragments Of The Trypanosoma Brucei Cysteine Protease Inhibitor Icp Length = 212 | Back alignment and structure |
| >pdb|3IMA|A Chain A, Complex Strcuture Of Tarocystatin And Papain Length = 212 | Back alignment and structure |
| >pdb|1KHP|A Chain A, Monoclinic Form Of Papain/zlfg-dam Covalent Complex Length = 212 | Back alignment and structure |
| >pdb|3TNX|A Chain A, Structure Of The Precursor Of A Thermostable Variant Of Papain At 2.6 Angstroem Resolution Length = 363 | Back alignment and structure |
| >pdb|1JQP|A Chain A, Dipeptidyl Peptidase I (Cathepsin C), A Tetrameric Cysteine Protease Of The Papain Family Length = 438 | Back alignment and structure |
| >pdb|3PDF|A Chain A, Discovery Of Novel Cyanamide-Based Inhibitors Of Cathepsin C Length = 441 | Back alignment and structure |
| >pdb|3IOQ|A Chain A, Crystal Structure Of The Carica Candamarcensis Cysteine Protease Cms1ms2 In Complex With E-64 Length = 213 | Back alignment and structure |
| >pdb|2WBF|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum With Loop 690-700 Ordered Length = 265 | Back alignment and structure |
| >pdb|3CH2|X Chain X, Crystal Structure Analysis Of Sera5e From Plasmodium Falciparum Length = 265 | Back alignment and structure |
| >pdb|1GEC|E Chain E, Glycyl Endopeptidase-complex With Benzyloxycarbonyl-leucine-valine- Glycine-methylene Covalently Bound To Cysteine 25 Length = 216 | Back alignment and structure |
| >pdb|1DEU|A Chain A, Crystal Structure Of Human Procathepsin X: A Cysteine Protease With The Proregion Covalently Linked To The Active Site Cysteine Length = 277 | Back alignment and structure |
| >pdb|1EF7|A Chain A, Crystal Structure Of Human Cathepsin X Length = 242 | Back alignment and structure |
| >pdb|3D6S|A Chain A, Crystal Structure Of Mite Allergen Der F 1 Length = 223 | Back alignment and structure |
| >pdb|1PPO|A Chain A, Determination Of The Structure Of Papaya Protease Omega Length = 216 | Back alignment and structure |
| >pdb|1SP4|B Chain B, Crystal Structure Of Ns-134 In Complex With Bovine Cathepsin B: A Two Headed Epoxysuccinyl Inhibitor Extends Along The Whole Active Site Cleft Length = 205 | Back alignment and structure |
| >pdb|1QDQ|A Chain A, X-Ray Crystal Structure Of Bovine Cathepsin B-Ca074 Complex Length = 253 | Back alignment and structure |
| >pdb|3QSD|A Chain A, Structure Of Cathepsin B1 From Schistosoma Mansoni In Complex With Ca074 Inhibitor Length = 254 | Back alignment and structure |
| >pdb|1ITO|A Chain A, Crystal Structure Analysis Of Bovine Spleen Cathepsin B- E64c Complex Length = 256 | Back alignment and structure |
| >pdb|1MEG|A Chain A, Crystal Structure Of A Caricain D158e Mutant In Complex With E-64 Length = 216 | Back alignment and structure |
| >pdb|1PCI|A Chain A, Procaricain Length = 322 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 Length = 214 | Back alignment and structure |
|---|
Score = 217 bits (555), Expect = 8e-72
Identities = 71/148 (47%), Positives = 93/148 (62%), Gaps = 10/148 (6%)
Query: 63 LVDCDKVDAGCGGGLMSNAFETIISKLGGGLEGEKDYPYKGSNRACHLNKEEIRVKIQSY 122
L+DCDK+D C GGL SNA+ I + GGLE E DY Y+G ++C + E+ +V IQ
Sbjct: 53 LLDCDKMDKACMGGLPSNAYSAIKNL--GGLETEDDYSYQGHMQSCQFSAEKAKVYIQDS 110
Query: 123 VNVSSDETEMAKYLVKNGPMAVAINANAMQFYFGGVSHPLKFLCKGGMDNLDHGVLIVGY 182
V +S +E ++A +L K GP++VAINA MQFY G+S PL+ LC +DH VL+VGY
Sbjct: 111 VELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLC--SPWLIDHAVLLVGY 168
Query: 183 GVHKTKFTHKIQPYWIIKNSWGPHWGEK 210
G P+W IKNSWG WGEK
Sbjct: 169 GQRSDV------PFWAIKNSWGTDWGEK 190
|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... Length = 215 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* Length = 220 | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* Length = 246 | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* Length = 243 | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A Length = 241 | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... Length = 220 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} Length = 331 | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... Length = 215 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* Length = 316 | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 Length = 221 | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... Length = 212 | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} Length = 213 | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* Length = 216 | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 224 | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} Length = 214 | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* Length = 222 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 Length = 229 | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 Length = 215 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... Length = 218 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 Length = 312 | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} Length = 262 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A Length = 314 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* Length = 441 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} Length = 310 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* Length = 218 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} Length = 329 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A Length = 220 | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X Length = 265 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} Length = 315 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 Length = 322 | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* Length = 208 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A Length = 277 | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} Length = 291 | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} Length = 222 | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} PDB: 3s3q_A* 3s3r_A* Length = 254 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} PDB: 3mor_A* Length = 325 | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... Length = 266 | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A Length = 317 | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} Length = 106 | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} Length = 80 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 240 | |||
| 3qj3_A | 331 | Cathepsin L-like protein; hydrolase, proteinase, l | 100.0 | |
| 3qt4_A | 329 | Cathepsin-L-like midgut cysteine proteinase; hydro | 100.0 | |
| 1by8_A | 314 | Protein (procathepsin K); hydrolase(sulfhydryl pro | 100.0 | |
| 2c0y_A | 315 | Procathepsin S; proenzyme, proteinase, hydrolase, | 100.0 | |
| 1cs8_A | 316 | Human procathepsin L; prosegment, propeptide, inhi | 100.0 | |
| 1pci_A | 322 | Procaricain; zymogen, hydrolase, thiol protease; 3 | 100.0 | |
| 3tnx_A | 363 | Papain; hydrolase, cytoplasm for recombinant expre | 100.0 | |
| 2o6x_A | 310 | Procathepsin L1, secreted cathepsin L 1; hydrolase | 100.0 | |
| 1xkg_A | 312 | DER P I, major mite fecal allergen DER P 1; major | 100.0 | |
| 3pdf_A | 441 | Cathepsin C, dipeptidyl peptidase 1; two domains, | 100.0 | |
| 3kwz_A | 215 | Cathepsin K; enzyme inhibitor, covalent reversible | 100.0 | |
| 2xu3_A | 220 | Cathepsin L1; hydrolase, drug design, thiol protea | 100.0 | |
| 1m6d_A | 214 | Cathepsin F, catsf; papain family cysteine proteas | 100.0 | |
| 8pch_A | 220 | Cathepsin H; hydrolase, protease, cysteine protein | 100.0 | |
| 3u8e_A | 222 | Papain-like cysteine protease; papain-like cystein | 100.0 | |
| 3ovx_A | 218 | Cathepsin S; hydrolase, covalent inhibitor, aldehy | 100.0 | |
| 3i06_A | 215 | Cruzipain; autocatalytic cleavage, glycoprotein, p | 100.0 | |
| 2b1m_A | 246 | SPE31; papain-like, sugar binding protein; HET: NA | 100.0 | |
| 1ppo_A | 216 | Protease omega; hydrolase(thiol protease); 1.80A { | 100.0 | |
| 1cqd_A | 221 | Protein (protease II); cysteine protease, glycopro | 100.0 | |
| 1yal_A | 218 | Chymopapain; hydrolase, thiol protease; 1.70A {Car | 100.0 | |
| 1iwd_A | 215 | Ervatamin B; cysteine protease, alpha-beta protein | 100.0 | |
| 3p5u_A | 220 | Actinidin; SAD, cysteine proteinases, hydrolase; 1 | 100.0 | |
| 2oul_A | 241 | Falcipain 2; cysteine protease, inhibitor, macromo | 100.0 | |
| 3f5v_A | 222 | DER P 1 allergen; allergy, asthma, DUST mites, gly | 100.0 | |
| 3bwk_A | 243 | Cysteine protease falcipain-3; malaria, hydrolase; | 100.0 | |
| 2fo5_A | 262 | Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cyst | 100.0 | |
| 3ioq_A | 213 | CMS1MS2; caricaceae, cysteine protease, papain fam | 100.0 | |
| 1s4v_A | 229 | Cysteine endopeptidase; KDEL ER retention signal, | 100.0 | |
| 3hhi_A | 325 | Cathepsin B-like cysteine protease; occluding loop | 100.0 | |
| 2cio_A | 212 | Papain; hydrolase/inhibitor, complex hydrolase/inh | 100.0 | |
| 1o0e_A | 208 | Ervatamin C; plant cysteine protease, two domain, | 100.0 | |
| 2bdz_A | 214 | Mexicain; cysteine protease, peptidase_C1, papain- | 100.0 | |
| 3f75_A | 224 | Toxopain-2, cathepsin L protease; medical structur | 100.0 | |
| 1deu_A | 277 | Procathepsin X; cysteine protease, proregion, pros | 100.0 | |
| 3cbj_A | 266 | Cathepsin B; cathepsin B, occluding loop, chagas d | 100.0 | |
| 3pbh_A | 317 | Procathepsin B; thiol protease, cysteine protease, | 100.0 | |
| 3qsd_A | 254 | Cathepsin B-like peptidase (C01 family); cysteine | 100.0 | |
| 2wbf_X | 265 | Serine-repeat antigen protein; SERA, malaria, vacu | 100.0 | |
| 3ois_A | 291 | Cysteine protease; alpha and beta, hydrolase; HET: | 100.0 | |
| 2cb5_A | 453 | Protein (bleomycin hydrolase); aminopeptidase, cys | 99.95 | |
| 2e01_A | 457 | Cysteine proteinase 1; bleomycin hydrolase, thiol | 99.94 | |
| 3pw3_A | 383 | Aminopeptidase C; bleomycin, cysteine proteinase f | 99.8 | |
| 2l95_A | 80 | Crammer, LP06209P; cysteine proteinase inhibitor, | 98.94 | |
| 3f75_P | 106 | Toxopain-2, cathepsin L propeptide; medical struct | 98.91 | |
| 1pxv_A | 183 | Cysteine protease; hydrolase; 1.80A {Staphylococcu | 92.35 | |
| 1cv8_A | 174 | Staphopain; cysteine protease, thiol protease, pap | 85.83 | |
| 1x9y_A | 367 | Cysteine proteinase; half-barrel, barrel-sandwich- | 83.92 |
| >3qj3_A Cathepsin L-like protein; hydrolase, proteinase, larVal midgut; 1.85A {Tenebrio molitor} SCOP: d.3.1.0 | Back alignment and structure |
|---|
Probab=100.00 E-value=5e-55 Score=382.88 Aligned_cols=208 Identities=32% Similarity=0.620 Sum_probs=183.4
Q ss_pred hhHHHHHHHHHHHhCcccCCHHHHHHHHHHHHHHHHHHHhcCC----c--------------------------------
Q psy1727 13 LEHVAMFNHFLEKHNKSYATKEEYHKRLRIFRANLKKIQIRGE----G-------------------------------- 56 (240)
Q Consensus 13 ~~~~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~n~~~i~~~n~----g-------------------------------- 56 (240)
..++.+|++||++|+|.|.+.+|+.+||+||++|+++|+++|. |
T Consensus 16 ~~l~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~N~~~I~~hN~~~~~g~~sy~lg~N~FaDlt~eEf~~~~~~~~~~~~~ 95 (331)
T 3qj3_A 16 TFVAEKWENFKTTYARSYVNAKEETFRKQIFQKKLETFEEHNEKYRQGLVSYTLGVNLFTDMTPEEMKAYTHGLIMPADL 95 (331)
T ss_dssp HHHHHHHHHHHHHTTCCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCSEEECCSTTTTCCHHHHHHHHSCCCCCSST
T ss_pred HHHHHHHHHHHHHhCCcCCCHHHHHHHHHHHHHHHHHHHHHHhhhccCCCceeecccccccCCHHHHHHHhccccccccc
Confidence 3357899999999999999999999999999999999975542 1
Q ss_pred -------------------------------------------------c-----------eec--e------eEecCCC
Q psy1727 57 -------------------------------------------------T-----------HLA--L------KLVDCDK 68 (240)
Q Consensus 57 -------------------------------------------------~-----------~g~--l------qlvDCs~ 68 (240)
+ +|. + |||||+.
T Consensus 96 ~~~~~~~~~~~~~~~~~~~~lP~s~DwR~~g~vtpVkdQg~CGSCWAFaa~~alE~~~~i~~g~~~~~~LSeQ~LvdC~~ 175 (331)
T 3qj3_A 96 HKNGIPIKTREDLGLNASVRYPASFDWRDQGMVSPVKNQGSCGSSWAFSSTGAIESQMKIANGAGYDSSVSEQQLVDCVP 175 (331)
T ss_dssp TTTCEEECSGGGGTCCSSCCCCSSEEGGGGTCSCCCCBCCSSCCHHHHHHHHHHHHHHHHHHCTTSCCCBCHHHHHHHCT
T ss_pred cccCcccccccccccccccCCCcceecccCCccCCCccCcccchhhHHHHHHHHHHHHHHHhCCCcccCcCHHHHhhhcc
Confidence 0 111 1 8999998
Q ss_pred CCCCCCCCccchHHHHHHHhcCCCccCCcccccccCCCcccCCcccceeEEeEeeeech-hHHHHHHHHHhCCCeEEEEe
Q psy1727 69 VDAGCGGGLMSNAFETIISKLGGGLEGEKDYPYKGSNRACHLNKEEIRVKIQSYVNVSS-DETEMAKYLVKNGPMAVAIN 147 (240)
Q Consensus 69 ~~~gC~GG~~~~A~~yi~~~~~~Gi~~e~~yPY~~~~~~C~~~~~~~~~~i~~~~~v~~-~~~~i~~~l~~~GPv~v~~~ 147 (240)
.+.||+||++..||+|++ ++ +||++|++|||.+..+.|...+....+++.+|..++. ++++|+++|+++|||+|+|+
T Consensus 176 ~~~GC~GG~~~~a~~yi~-~~-~Gi~~e~~yPY~~~~~~C~~~~~~~~~~i~~~~~v~~~~e~~lk~al~~~GPV~v~i~ 253 (331)
T 3qj3_A 176 NALGCSGGWMNDAFTYVA-QN-GGIDSEGAYPYEMADGNCHYDPNQVAARLSGYVYLSGPDENMLADMVATKGPVAVAFD 253 (331)
T ss_dssp TSCGGGCCCHHHHHHHHH-HH-TCEEBTTTSCCCSSCCCCCCCTTSEEECCSEEEEESSCCHHHHHHHHHHHCCEEEEEC
T ss_pred CCCCCCCCCHHHHHHHHH-Hc-CCcCcccccCccCCCCCCCCCcccceeEeeEEEEeCCCCHHHHHHHHHhCCCEEEEEE
Confidence 889999999999999998 76 7999999999999999999887777889999999986 79999999999999999999
Q ss_pred ccc-cccccCCcccCCCcccCCCCCCCCccEEEEEEeecccccccCCcCEEEEecccCCCcCCCCcceEEEECCCCCccc
Q psy1727 148 ANA-MQFYFGGVSHPLKFLCKGGMDNLDHGVLIVGYGVHKTKFTHKIQPYWIIKNSWGPHWGEKTMPFWIIKNSWGPRWG 226 (240)
Q Consensus 148 ~~~-f~~Y~~Gv~~~~~~~c~~~~~~~~Hav~iVGyg~~~~~~~~~g~~yWivkNSWG~~WG~~G~~y~~i~~~~~~~~g 226 (240)
+.. |++|++|||..+ .|.. ..++|||+|||||++ +|++|||||||||+.||++| ||||+|+.++.||
T Consensus 254 a~~~f~~Y~~Gvy~~~--~c~~--~~~~HaV~iVGyg~~------~g~~yWivkNSWG~~WGe~G--Y~~i~r~~~n~Cg 321 (331)
T 3qj3_A 254 ADDPFGSYSGGVYYNP--TCET--NKFTHAVLIVGYGNE------NGQDYWLVKNSWGDGWGLDG--YFKIARNANNHCG 321 (331)
T ss_dssp CCTTGGGEEEEEECCT--TCCS--SCCCEEEEEEEEEEE------TTEEEEEEECSBCTTSTBTT--EEEEECSSSSGGG
T ss_pred cccccccccCceEeCC--CCCC--CcCCEEEEEEEEecc------CCceEEEEEcCCCCCcCCCC--EEEEEcCCCCccC
Confidence 976 999999999987 7875 568999999999988 78999999999999999999 9999999878999
Q ss_pred cceeEEecC
Q psy1727 227 EQVTKSIYS 235 (240)
Q Consensus 227 ~~~~~~~~~ 235 (240)
+... +.||
T Consensus 322 I~~~-~~~p 329 (331)
T 3qj3_A 322 IAGV-ASVP 329 (331)
T ss_dssp TTTS-CEEE
T ss_pred cCCc-eeee
Confidence 9843 4444
|
| >3qt4_A Cathepsin-L-like midgut cysteine proteinase; hydrolase, zymogen, intramolecular DISS bonds, insect larVal midgut; HET: PG4 PG6; 2.11A {Tenebrio molitor} | Back alignment and structure |
|---|
| >1by8_A Protein (procathepsin K); hydrolase(sulfhydryl proteinase), papain; 2.60A {Homo sapiens} SCOP: d.3.1.1 PDB: 7pck_A | Back alignment and structure |
|---|
| >2c0y_A Procathepsin S; proenzyme, proteinase, hydrolase, thiol protease, prosegment binding loop, glycoprotein, lysosome, protease, zymogen; 2.1A {Homo sapiens} | Back alignment and structure |
|---|
| >1cs8_A Human procathepsin L; prosegment, propeptide, inhibition, hydrolase; HET: OCS; 1.80A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cjl_A 3hwn_A* | Back alignment and structure |
|---|
| >1pci_A Procaricain; zymogen, hydrolase, thiol protease; 3.20A {Carica papaya} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3tnx_A Papain; hydrolase, cytoplasm for recombinant expression; 2.62A {Carica papaya} | Back alignment and structure |
|---|
| >2o6x_A Procathepsin L1, secreted cathepsin L 1; hydrolase, thiol protease, cysteine protease, zymogen, hydro; 1.40A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1xkg_A DER P I, major mite fecal allergen DER P 1; major allergen, cysteine protease, house DUST mite, dermatop pteronyssinus; 1.61A {Dermatophagoides pteronyssinus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3pdf_A Cathepsin C, dipeptidyl peptidase 1; two domains, cystein protease, hydrolase-hydrolase inhibitor; HET: LXV NAG; 1.85A {Homo sapiens} PDB: 1jqp_A* 2djf_B* 1k3b_B* 2djg_B* 2djf_A* 1k3b_A* 2djg_A* 2djf_C* 1k3b_C* 2djg_C* | Back alignment and structure |
|---|
| >3kwz_A Cathepsin K; enzyme inhibitor, covalent reversible inhibitor, disease mutation, disulfide bond, glycoprotein, hydrolase, lysosome, protease; HET: KWZ; 1.49A {Homo sapiens} PDB: 1au0_A* 1au2_A* 1au3_A* 1au4_A* 1ayu_A* 1ayv_A* 1ayw_A* 1bgo_A* 1atk_A* 1nl6_A* 1nlj_A* 1q6k_A* 1mem_A* 1yk7_A* 1yk8_A* 1yt7_A* 2ato_A* 2aux_A* 2auz_A* 2bdl_A* ... | Back alignment and structure |
|---|
| >2xu3_A Cathepsin L1; hydrolase, drug design, thiol protease; HET: XU3 BTB; 0.90A {Homo sapiens} PDB: 2xu4_A* 2xu5_A* 2yj2_A* 2yj8_A* 2yj9_A* 2yjb_A* 2yjc_A* 3bc3_A* 3h89_A* 3h8b_A* 3h8c_A* 3of9_A* 3of8_A* 3hha_A* 2xu1_A* 3iv2_A* 3k24_A* 2nqd_B* 3kse_A* 2vhs_A ... | Back alignment and structure |
|---|
| >1m6d_A Cathepsin F, catsf; papain family cysteine protease, hydrolase; HET: MYP; 1.70A {Homo sapiens} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >8pch_A Cathepsin H; hydrolase, protease, cysteine proteinase, aminopeptidase; HET: NAG BMA; 2.10A {Sus scrofa} SCOP: d.3.1.1 PDB: 1nb3_A* 1nb5_A* | Back alignment and structure |
|---|
| >3u8e_A Papain-like cysteine protease; papain-like cysteine peptidase, peptidase_C1A, hydrolase, in form; 1.31A {Crocus sativus} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >3ovx_A Cathepsin S; hydrolase, covalent inhibitor, aldehyde warhead is covalently bound to Cys25, lysosomeal protein; HET: O64; 1.49A {Homo sapiens} SCOP: d.3.1.1 PDB: 2h7j_A* 2f1g_A* 2hh5_B* 2hhn_A* 2hxz_A* 2op3_A* 2frq_A* 2fra_A* 2fq9_A* 2ft2_A* 2fud_A* 2g7y_A* 1ms6_A* 2r9m_A* 2r9n_A* 2r9o_A* 3n3g_A* 3n4c_A* 3mpe_A* 1nqc_A* ... | Back alignment and structure |
|---|
| >3i06_A Cruzipain; autocatalytic cleavage, glycoprotein, protease, thiol protease, zymogen; HET: QL2; 1.10A {Trypanosoma cruzi} SCOP: d.3.1.1 PDB: 1ewm_A* 1ewo_A* 1ewl_A* 1f29_A* 1ewp_A* 1f2b_A* 1f2c_A* 1f2a_A* 1me4_A* 1u9q_X* 2aim_A* 2efm_A* 2oz2_A* 1me3_A* 3kku_A* 3lxs_A* 1aim_A* 3iut_A* 3hd3_A* 2p86_A* ... | Back alignment and structure |
|---|
| >2b1m_A SPE31; papain-like, sugar binding protein; HET: NAG FUC PG4; 2.00A {Pachyrhizus erosus} PDB: 2b1n_A* | Back alignment and structure |
|---|
| >1ppo_A Protease omega; hydrolase(thiol protease); 1.80A {Carica papaya} SCOP: d.3.1.1 PDB: 1meg_A* | Back alignment and structure |
|---|
| >1cqd_A Protein (protease II); cysteine protease, glycoprotein, proline specificity, carboh papain family, hydrolase; HET: NAG FUL FUC; 2.10A {Zingiber officinale} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1yal_A Chymopapain; hydrolase, thiol protease; 1.70A {Carica papaya} SCOP: d.3.1.1 PDB: 1gec_E* | Back alignment and structure |
|---|
| >1iwd_A Ervatamin B; cysteine protease, alpha-beta protein, catalytic DYAD, L-DOM domain., hydrolase; 1.63A {Tabernaemontana divaricata} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3p5u_A Actinidin; SAD, cysteine proteinases, hydrolase; 1.50A {Actinidia arguta} SCOP: d.3.1.1 PDB: 3p5v_A 3p5w_A 3p5x_A 1aec_A* 2act_A | Back alignment and structure |
|---|
| >2oul_A Falcipain 2; cysteine protease, inhibitor, macromolecular interaction, HY hydrolase inhibitor complex; 2.20A {Plasmodium falciparum} SCOP: d.3.1.1 PDB: 2ghu_A 1yvb_A 3bpf_A* 3pnr_A | Back alignment and structure |
|---|
| >3f5v_A DER P 1 allergen; allergy, asthma, DUST mites, glycoprotein, hydrola protease, secreted, thiol protease; HET: P6G; 1.36A {Dermatophagoides pteronyssinus} PDB: 2as8_A 3rvw_A* 3rvx_A 3rvv_A* 3d6s_A* | Back alignment and structure |
|---|
| >3bwk_A Cysteine protease falcipain-3; malaria, hydrolase; HET: C1P; 2.42A {Plasmodium falciparum} PDB: 3bpm_A* | Back alignment and structure |
|---|
| >2fo5_A Cysteine proteinase EP-B 2; EP-B2, EPB2, EPB, cysteine endoprotease, endopeptidase, LEUP hydrolase; HET: AR7; 2.20A {Hordeum vulgare} | Back alignment and structure |
|---|
| >3ioq_A CMS1MS2; caricaceae, cysteine protease, papain family, hydrolase; HET: E64 SO4; 1.87A {Carica candamarcensis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1s4v_A Cysteine endopeptidase; KDEL ER retention signal, endosperm, ricinosomes, SEED germi senescence, hydrolase-hydrolase inhibitor complex; 2.00A {Ricinus communis} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >3hhi_A Cathepsin B-like cysteine protease; occluding loop, hydrolase, THIO protease; HET: 074; 1.60A {Trypanosoma brucei} SCOP: d.3.1.0 PDB: 4hwy_A* 3mor_A* | Back alignment and structure |
|---|
| >2cio_A Papain; hydrolase/inhibitor, complex hydrolase/inhibitor, ICP, cysteine protease, allergen, protease, thiol protease; 1.5A {Carica papaya} PDB: 1khq_A 1khp_A 1ppn_A 3e1z_B 3ima_A 3lfy_A 9pap_A 1bqi_A* 1bp4_A* 1pad_A 1pe6_A* 1pip_A* 1pop_A* 1ppd_A 1ppp_A* 1stf_E* 2pad_A 4pad_A* 5pad_A* 6pad_A* ... | Back alignment and structure |
|---|
| >1o0e_A Ervatamin C; plant cysteine protease, two domain, stable at PH 2-12, HYDR; 1.90A {Tabernaemontana divaricata} SCOP: d.3.1.1 PDB: 2pns_A* 2pre_A* 3bcn_A* | Back alignment and structure |
|---|
| >2bdz_A Mexicain; cysteine protease, peptidase_C1, papain-like, HYDR; HET: E64; 2.10A {Jacaratia mexicana} | Back alignment and structure |
|---|
| >3f75_A Toxopain-2, cathepsin L protease; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} SCOP: d.3.1.0 | Back alignment and structure |
|---|
| >1deu_A Procathepsin X; cysteine protease, proregion, prosegment, HY; 1.70A {Homo sapiens} SCOP: d.3.1.1 PDB: 1ef7_A | Back alignment and structure |
|---|
| >3cbj_A Cathepsin B; cathepsin B, occluding loop, chagas disease, glyco hydrolase, lysosome, protease, thiol protease, zymogen, CYT vesicle; 1.80A {Homo sapiens} PDB: 3cbk_A 1gmy_A* 3ai8_B* 3k9m_A 1the_A* 1cpj_A* 1cte_A 2dcc_A* 2dc6_A* 1ito_A* 2dc8_A* 2dc9_A* 2dca_A* 2dcb_A* 2dc7_A* 2dcd_A* 1qdq_A* 1csb_B* 1huc_B 2ipp_B ... | Back alignment and structure |
|---|
| >3pbh_A Procathepsin B; thiol protease, cysteine protease, proenzyme, papain; 2.50A {Homo sapiens} SCOP: d.3.1.1 PDB: 2pbh_A 1pbh_A 1mir_A | Back alignment and structure |
|---|
| >3qsd_A Cathepsin B-like peptidase (C01 family); cysteine peptidase, digestive tract, hydrolase-hydrolase INH complex; HET: 074; 1.30A {Schistosoma mansoni} SCOP: d.3.1.0 PDB: 3s3q_A* 3s3r_A* | Back alignment and structure |
|---|
| >2wbf_X Serine-repeat antigen protein; SERA, malaria, vacuole, protease, cathepsin, hydrolase, glycoprotein, thiol protease; HET: DMS; 1.60A {Plasmodium falciparum} PDB: 3ch3_X 3ch2_X | Back alignment and structure |
|---|
| >3ois_A Cysteine protease; alpha and beta, hydrolase; HET: UDP; 1.65A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2cb5_A Protein (bleomycin hydrolase); aminopeptidase, cysteine protease, SELF- compartmentalizing, cylinase; 1.85A {Homo sapiens} SCOP: d.3.1.1 PDB: 1cb5_A | Back alignment and structure |
|---|
| >2e01_A Cysteine proteinase 1; bleomycin hydrolase, thiol protease, C1 protease, hydrolase; 1.73A {Saccharomyces cerevisiae} PDB: 2e02_A 2e03_A 2dzy_A 1a6r_A 2e00_A 2dzz_A 3gcb_A 1gcb_A | Back alignment and structure |
|---|
| >3pw3_A Aminopeptidase C; bleomycin, cysteine proteinase fold, structural genomics, JO center for structural genomics, JCSG; HET: MSE; 2.23A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2l95_A Crammer, LP06209P; cysteine proteinase inhibitor, intrinsic disorder P like protein, hydrolase; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3f75_P Toxopain-2, cathepsin L propeptide; medical structural genomics of pathogenic protozoa, MSGPP, C protease, parasite, protozoa, hydrolase; 1.99A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >1pxv_A Cysteine protease; hydrolase; 1.80A {Staphylococcus aureus} SCOP: d.3.1.1 PDB: 1y4h_A | Back alignment and structure |
|---|
| >1cv8_A Staphopain; cysteine protease, thiol protease, papain family; HET: E64; 1.75A {Staphylococcus aureus} SCOP: d.3.1.1 | Back alignment and structure |
|---|
| >1x9y_A Cysteine proteinase; half-barrel, barrel-sandwich-hybrid, hydrolase; 2.50A {Staphylococcus aureus} SCOP: d.3.1.1 d.17.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 240 | ||||
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 8e-24 | |
| d1cs8a_ | 316 | d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens | 3e-05 | |
| d1m6da_ | 214 | d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [Ta | 2e-22 | |
| d1cqda_ | 216 | d.3.1.1 (A:) Proline-specific cysteine protease {G | 2e-19 | |
| d2h7ja1 | 217 | d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sa | 6e-19 | |
| g8pch.1 | 228 | d.3.1.1 (P:,A:) Cathepsin H {Pig (Sus scrofa) [Tax | 1e-17 | |
| d2r6na1 | 215 | d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sa | 3e-17 | |
| d1yala_ | 218 | d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [ | 3e-17 | |
| d1o0ea_ | 208 | d.3.1.1 (A:) Ervatamin C {East indian rosebay (Erv | 5e-17 | |
| d1fh0a_ | 221 | d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens | 2e-16 | |
| d1gmya_ | 254 | d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens | 2e-16 | |
| d1iwda_ | 215 | d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia | 4e-16 | |
| d1s4va_ | 224 | d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor | 7e-16 | |
| d1me4a_ | 215 | d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 56 | 1e-15 | |
| d1deua_ | 275 | d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens | 7e-15 | |
| d1aeca_ | 218 | d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwi | 4e-14 | |
| g1k3b.1 | 233 | d.3.1.1 (B:,C:) Cathepsin C (dipeptidyl peptidase | 4e-14 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 4e-14 | |
| d1xkga1 | 302 | d.3.1.1 (A:4-305) Major mite fecal allergen der p | 4e-07 | |
| d2oula1 | 241 | d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falcip | 6e-14 | |
| d1khqa_ | 212 | d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId | 1e-12 | |
| d1ppoa_ | 216 | d.3.1.1 (A:) Caricain (protease omega) {Papaya (Ca | 7e-12 | |
| d3gcba_ | 458 | d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (S | 7e-08 | |
| d2cb5a_ | 453 | d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapi | 2e-04 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Score = 95.1 bits (235), Expect = 8e-24
Identities = 53/165 (32%), Positives = 81/165 (49%), Gaps = 9/165 (5%)
Query: 60 ALKLVDCDK--VDAGCGGGLMSNAFETIISKLGGGLEGEKDYPYKGSNRACHLNKEEIRV 117
LVDC + GC GGLM AF+ + GGL+ E+ YPY+ + +C N +
Sbjct: 146 EQNLVDCSGPQGNEGCNGGLMDYAFQYVQDN--GGLDSEESYPYEATEESCKYNPKYSVA 203
Query: 118 KIQSYVNVSSDETEMAKYLVKNGPMAVAINANAMQFYFGGVSHPLKFLCKGGMDNLDHGV 177
+V++ E + K + GP++VAI+A F F + C +++DHGV
Sbjct: 204 NDAGFVDIPKQEKALMKAVATVGPISVAIDAGHESFLFYKEGIYFEPDC--SSEDMDHGV 261
Query: 178 LIVGYGVHKTKFTHKIQPYWIIKNSWGPHWGEKTMPFWIIKNSWG 222
L+VGYG T+ + YW++KNSWG WG + K+
Sbjct: 262 LVVGYGFESTESDNN--KYWLVKNSWGEEWGMGGY-VKMAKDRRN 303
|
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} Length = 316 | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} Length = 214 | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} Length = 216 | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} Length = 217 | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} Length = 215 | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} Length = 218 | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} Length = 208 | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} Length = 254 | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} Length = 215 | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} Length = 224 | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} Length = 215 | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} Length = 275 | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} Length = 218 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} Length = 302 | Back information, alignment and structure |
|---|
| >d2oula1 d.3.1.1 (A:-16-224) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} Length = 241 | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} Length = 212 | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} Length = 216 | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} Length = 458 | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 453 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 240 | |||
| d1cs8a_ | 316 | (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1xkga1 | 302 | Major mite fecal allergen der p 1 {House-dust mite | 100.0 | |
| d1yala_ | 218 | Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | 100.0 | |
| g8pch.1 | 228 | Cathepsin H {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| g1k3b.1 | 233 | Cathepsin C (dipeptidyl peptidase I), catalytic do | 100.0 | |
| d2r6na1 | 215 | (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1cqda_ | 216 | Proline-specific cysteine protease {Ginger rhizome | 100.0 | |
| d1m6da_ | 214 | Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d2oula1 | 241 | Falcipain 2 {Plasmodium falciparum [TaxId: 5833]} | 100.0 | |
| d2h7ja1 | 217 | (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1deua_ | 275 | (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1ppoa_ | 216 | Caricain (protease omega) {Papaya (Carica papaya) | 100.0 | |
| d1fh0a_ | 221 | (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1me4a_ | 215 | Cruzain {Trypanosoma cruzi [TaxId: 5693]} | 100.0 | |
| d1gmya_ | 254 | (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 960 | 100.0 | |
| d1khqa_ | 212 | Papain {Papaya (Carica papaya) [TaxId: 3649]} | 99.98 | |
| d1iwda_ | 215 | Ervatamin B {Adam's apple (Ervatamia coronaria) [T | 99.98 | |
| d1aeca_ | 218 | Actinidin {Chinese gooseberry or kiwifruit (Actini | 99.98 | |
| d1o0ea_ | 208 | Ervatamin C {East indian rosebay (Ervatamia corona | 99.97 | |
| d1s4va_ | 224 | Vignain (bean endopeptidase) {Castor bean (Ricinus | 99.97 | |
| d3gcba_ | 458 | Bleomycin hydrolase {Baker's yeast (Saccharomyces | 99.22 | |
| d2cb5a_ | 453 | Bleomycin hydrolase {Human (Homo sapiens) [TaxId: | 98.95 |
| >d1cs8a_ d.3.1.1 (A:) (Pro)cathepsin L {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Papain-like domain: (Pro)cathepsin L species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=9.1e-51 Score=352.72 Aligned_cols=214 Identities=32% Similarity=0.652 Sum_probs=177.7
Q ss_pred CCChhhHHHHHHHHHHHhCcccCCHHHHHHHHHHHHHHHHHHHhcCC----c----------------------------
Q psy1727 9 HHDKLEHVAMFNHFLEKHNKSYATKEEYHKRLRIFRANLKKIQIRGE----G---------------------------- 56 (240)
Q Consensus 9 ~~~~~~~~~~f~~~~~~~~k~Y~~~~E~~~R~~iF~~n~~~i~~~n~----g---------------------------- 56 (240)
.++.| +.+|++||++|+|.|.+ +|+.+||+||.+|+++|+++|. |
T Consensus 4 ~~~~l--~~~F~~f~~~~~K~Y~~-~ee~~R~~iF~~N~~~I~~~N~~~~~~~~~~~~g~N~fsDlt~eEf~~~~~~~~~ 80 (316)
T d1cs8a_ 4 FDHSL--EAQWTKWKAMHNRLYGM-NEEGWRRAVWEKNMKMIELHNQEYREGKHSFTMAMNAFGDMTSEEFRQVMNGFQN 80 (316)
T ss_dssp CCGGG--HHHHHHHHHHTTCCCCT-THHHHHHHHHHHHHHHHHHHHHHHHTTCCSEEECCCTTTTCCHHHHHHHHCCBCC
T ss_pred ccHHH--HHHHHHHHHHhCCcCCC-HHHHHHHHHHHHHHHHHHHHHhHhhcCCCceEEeceeccccCcHHHHhhhccccc
Confidence 44444 68999999999999977 5778999999999999976653 1
Q ss_pred ---------------------------------------------ceece-----------------eEecCCC--CCCC
Q psy1727 57 ---------------------------------------------THLAL-----------------KLVDCDK--VDAG 72 (240)
Q Consensus 57 ---------------------------------------------~~g~l-----------------qlvDCs~--~~~g 72 (240)
++++| |||||+. .+.+
T Consensus 81 ~~~~~~~~~~~~~~~~lP~s~Dwr~~g~vtpVkdQG~CGsCwAfa~~~~~E~~~~i~~~~~~~lS~Q~lvdC~~~~~~~~ 160 (316)
T d1cs8a_ 81 RKPRKGKVFQEPLFYEAPRSVDWREKGYVTPVKNQGQCGSCWAFSATGALEGQMFRKTGRLISLSEQNLVDCSGPQGNEG 160 (316)
T ss_dssp CCCSCCEECCCCTTCCCCSCEEGGGGTCCCCCCBCCSSSCHHHHHHHHHHHHHHHHHHSCCCCBCHHHHHHHCGGGTCCG
T ss_pred cccccCccccCcccccCCCceECCcCCcccccccCCCCceeeehhhhHHHHHHHHhhcCCcccchhhhhhhccccccCCC
Confidence 11111 9999986 5789
Q ss_pred CCCCccchHHHHHHHhcCCCccCCcccccccCCCcccCCcccceeEEeEeeeechhHHHHHHHHHhCCCeEEEEeccc--
Q psy1727 73 CGGGLMSNAFETIISKLGGGLEGEKDYPYKGSNRACHLNKEEIRVKIQSYVNVSSDETEMAKYLVKNGPMAVAINANA-- 150 (240)
Q Consensus 73 C~GG~~~~A~~yi~~~~~~Gi~~e~~yPY~~~~~~C~~~~~~~~~~i~~~~~v~~~~~~i~~~l~~~GPv~v~~~~~~-- 150 (240)
|.||++..||+|++ .+ +++++|..|||.+....|...+......+..+.....+++.|+++|+.+|||+|++++..
T Consensus 161 c~gg~~~~a~~y~~-~~-g~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~l~~~gpv~v~i~~~~~~ 238 (316)
T d1cs8a_ 161 CNGGLMDYAFQYVQ-DN-GGLDSEESYPYEATEESCKYNPKYSVANDAGFVDIPKQEKALMKAVATVGPISVAIDAGHES 238 (316)
T ss_dssp GGCBCHHHHHHHHH-HH-TCEEBTTTSCCCSSCCCCCCCGGGEEECCCCEEECCSCHHHHHHHHHHHCCEEEEECCCSHH
T ss_pred CCCCchHHHHHHHH-hc-CcccccccccccccccccccccccccccccccccccCcHHHHHHHHHHhCCeEEEEEeccch
Confidence 99999999999999 87 568899999999998888876666666677777777789999999999999999999864
Q ss_pred cccccCCcccCCCcccCCCCCCCCccEEEEEEeecccccccCCcCEEEEecccCCCcCCCCcceEEEECCCCCcccccee
Q psy1727 151 MQFYFGGVSHPLKFLCKGGMDNLDHGVLIVGYGVHKTKFTHKIQPYWIIKNSWGPHWGEKTMPFWIIKNSWGPRWGEQVT 230 (240)
Q Consensus 151 f~~Y~~Gv~~~~~~~c~~~~~~~~Hav~iVGyg~~~~~~~~~g~~yWivkNSWG~~WG~~G~~y~~i~~~~~~~~g~~~~ 230 (240)
|++|++|||... .|+. ..++|||+|||||.+.. ..++++|||||||||++|||+| ||||+|+..+.||+. .
T Consensus 239 f~~y~~Gi~~~~--~c~~--~~~nHaV~iVGyG~d~~--~~~g~~YWIikNSWG~~WGe~G--Y~ri~r~~~n~CGI~-~ 309 (316)
T d1cs8a_ 239 FLFYKEGIYFEP--DCSS--EDMDHGVLVVGYGFEST--ESDNNKYWLVKNSWGEEWGMGG--YVKMAKDRRNHCGIA-S 309 (316)
T ss_dssp HHTEEEEEECCT--TCCS--SCCCEEEEEEEEEEECC--SSCCEEEEEEECSBCTTSTBTT--EEEEECSSSSGGGTT-T
T ss_pred hccccCCcccCC--CCCC--CcCCEEEEEEEEccccc--CCCCCeEEEEEeCCCCCcccCC--EEEEeeCCCCcCccC-C
Confidence 999999999877 7875 56899999999997621 1257899999999999999999 999999987899998 4
Q ss_pred EEecCC
Q psy1727 231 KSIYSS 236 (240)
Q Consensus 231 ~~~~~~ 236 (240)
.+.||.
T Consensus 310 ~~~yP~ 315 (316)
T d1cs8a_ 310 AASYPT 315 (316)
T ss_dssp SCEEEC
T ss_pred eeeeee
Confidence 456653
|
| >d1xkga1 d.3.1.1 (A:4-305) Major mite fecal allergen der p 1 {House-dust mite (Dermatophagoides pteronyssinus) [TaxId: 6956]} | Back information, alignment and structure |
|---|
| >d1yala_ d.3.1.1 (A:) Chymopapain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d2r6na1 d.3.1.1 (A:1-215) (Pro)cathepsin K {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cqda_ d.3.1.1 (A:) Proline-specific cysteine protease {Ginger rhizome (Zingiber officinale) [TaxId: 94328]} | Back information, alignment and structure |
|---|
| >d1m6da_ d.3.1.1 (A:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7ja1 d.3.1.1 (A:1-217) (Pro)cathepsin S {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1deua_ d.3.1.1 (A:) (Pro)cathepsin X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ppoa_ d.3.1.1 (A:) Caricain (protease omega) {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1fh0a_ d.3.1.1 (A:) (Pro)cathepsin V {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1me4a_ d.3.1.1 (A:) Cruzain {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d1gmya_ d.3.1.1 (A:) (Pro)cathepsin B {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khqa_ d.3.1.1 (A:) Papain {Papaya (Carica papaya) [TaxId: 3649]} | Back information, alignment and structure |
|---|
| >d1iwda_ d.3.1.1 (A:) Ervatamin B {Adam's apple (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1aeca_ d.3.1.1 (A:) Actinidin {Chinese gooseberry or kiwifruit (Actinidia chinensis) [TaxId: 3625]} | Back information, alignment and structure |
|---|
| >d1o0ea_ d.3.1.1 (A:) Ervatamin C {East indian rosebay (Ervatamia coronaria) [TaxId: 52861]} | Back information, alignment and structure |
|---|
| >d1s4va_ d.3.1.1 (A:) Vignain (bean endopeptidase) {Castor bean (Ricinus communis) [TaxId: 3988]} | Back information, alignment and structure |
|---|
| >d3gcba_ d.3.1.1 (A:) Bleomycin hydrolase {Baker's yeast (Saccharomyces cerevisiae), Gal6 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cb5a_ d.3.1.1 (A:) Bleomycin hydrolase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|