Psyllid ID: psy17339


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MFFNPTFVFLCSSILLNNEIEGMSLNSITHDRVKRNGFPKFSTGFELHDLFTHRRAMTCGSRVVNHEPQRAANVKIVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQMLQET
cccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccccccccccccccHHHHcccccccccccEEEEEccccccccccccEEEEEEEEEEEccccccEEEEEEEEcccEEEEccccccccccccEEEEEcccccccccccEEEEEEEEEEEcccccccccccccEEEEEEccccccccccccccccccccccccccEEEEEcccccccccccccccccEEEEccccHHHHcccccccccccccccccEEEccccccccccccccccEEEEEEccEEEEEEEEEccccccccccccEEEEccccHHHHHHHHHccccc
ccccccEEEEHHHHHHcccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccccEEccccccccccccccccEEEEEcccccEEEEEEEEEccEEEEcHHHHccccccccEEEEccccccccccccccEEEEEEEEEEcccccEEEEEEEEEccEEEEcHHHHcccccccEEEEEEEEEcccccccEEEEEEEEEEEcccccccccccccEEEEEEccccEccccEcEEEcccccccccccEEEEEEccccccccccccccccEEEEEEEEccHHHHHHHccccccccccccEEEEcccccccEccccccccEEEEEEccEEEEEEEEEEEcccccccccEEEEEHHHcHHHHHHHHHHcccc
MFFNPTFVFLCSSILLnneiegmslnsithdrvkrngfpkfstgfelhdlfthrramtcgsrvvnhepqraanvkivggtstpygaypwQVEIQVRSstgqgehqcggaiiSDTVILTAAHCLQGISKSKLRIIVGkhnlngvdkfEKTFKVEIQVRsstgqgehqcggaiiSDTVILTAAHCLQGISKSKLRIIVGkhnlngvdkFEKTFKVEKAVLHHrfrkegthsndiAVVKIRGniefnqyvqpicipdrdnaaasdwcvvtgwgaqnaesiDDISNTLRAATVKvidqntcrssavygnsnqNILDSMLCAGylnggidacggdsggplackiggrFVLSGVVswgdgcakknkpgvytRVSYYTKWINDRIQMLQET
MFFNPTFVFLCSSILLNNEIEGMSLNSITHDRVKRNGFPKFSTGFELHDLFTHRRAMTCGsrvvnhepqraanVKIVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHnlngvdkfeKTFKVEIQVRSstgqgehqcgGAIISDTVILTAAHCLQGISKSKLRIIVGKHnlngvdkfekTFKVEKAVLhhrfrkegthsndiaVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWgdgcakknkpgvytrvsyYTKWINDRIQMLQET
MFFNPTFVFLCSSILLNNEIEGMSLNSITHDRVKRNGFPKFSTGFELHDLFTHRRAMTCGSRVVNHEPQRAANVKIVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNggidacggdsggPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQMLQET
**FNPTFVFLCSSILLNNEIEGMSLNSITHDRVKRNGFPKFSTGFELHDLFTHRRAMTCGSRVVNHEPQRAANVKIVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQ*****
*F*NPTFVFLC****************************************************************IVGGTSTPYGAYPWQVEIQV*****Q***QCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLN*******TFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWIN**IQ*****
MFFNPTFVFLCSSILLNNEIEGMSLNSITHDRVKRNGFPKFSTGFELHDLFTHRRAMTCGSRVVNHEPQRAANVKIVGGTSTPYGAYPWQVEIQV*********QCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQV*********QCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQMLQET
MFFNPTFVFLCSSILLNNEIEGMSLNSITHDRVKRNGFPKFSTGFELHDLFTHRRAMTCGSRVVNHEPQRAANVKIVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQML***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFFNPTFVFLCSSILLNNEIEGMSLNSITHDRVKRNGFPKFSTGFELHDLFTHRRAMTCGSRVVNHEPQRAANVKIVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQMLQET
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query384 2.2.26 [Sep-21-2011]
P14272638 Plasma kallikrein OS=Ratt yes N/A 0.632 0.380 0.369 5e-41
P15120434 Urokinase-type plasminoge no N/A 0.554 0.490 0.408 5e-40
Q6QNF4654 Hepatocyte growth factor yes N/A 0.611 0.359 0.345 9e-40
P26262638 Plasma kallikrein OS=Mus yes N/A 0.580 0.349 0.372 1e-39
Q9ES87342 Prostasin OS=Rattus norve no N/A 0.580 0.652 0.369 1e-39
P03952638 Plasma kallikrein OS=Homo yes N/A 0.622 0.374 0.347 2e-39
Q9DBI0811 Transmembrane protease se no N/A 0.619 0.293 0.373 4e-39
Q9R098653 Hepatocyte growth factor no N/A 0.614 0.361 0.343 5e-39
Q9ESD1342 Prostasin OS=Mus musculus no N/A 0.580 0.652 0.360 5e-39
Q04756655 Hepatocyte growth factor no N/A 0.614 0.360 0.339 7e-39
>sp|P14272|KLKB1_RAT Plasma kallikrein OS=Rattus norvegicus GN=Klkb1 PE=1 SV=1 Back     alignment and function desciption
 Score =  168 bits (426), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 96/260 (36%), Positives = 148/260 (56%), Gaps = 17/260 (6%)

Query: 127 SKSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQG 186
           +K   RI+ G ++  G    E  ++V +QV+  +    H CGG+II    ILTAAHC  G
Sbjct: 385 TKINARIVGGTNSSLG----EWPWQVSLQVKLVSQN--HMCGGSIIGRQWILTAAHCFDG 438

Query: 187 ISKSKL-RIIVGKHNLNGVDKFEKTFKVEKAVLHHRFR-KEGTHSNDIAVVKIRGNIEFN 244
           I    + RI  G  NL+ +        +++ ++H +++  EG++  DIA++K++  + + 
Sbjct: 439 IPYPDVWRIYGGILNLSEITNKTPFSSIKELIIHQKYKMSEGSY--DIALIKLQTPLNYT 496

Query: 245 QYVQPICIPDR-DNAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVY 303
           ++ +PIC+P + D       C VTGWG        +  N L+ AT+ ++    C+     
Sbjct: 497 EFQKPICLPSKADTNTIYTNCWVTGWGYTKERG--ETQNILQKATIPLVPNEECQKKY-- 552

Query: 304 GNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGV 363
              +  I   M+CAGY  GGIDAC GDSGGPL CK  GR+ L G+ SWG+GCA+K +PGV
Sbjct: 553 --RDYVITKQMICAGYKEGGIDACKGDSGGPLVCKHSGRWQLVGITSWGEGCARKEQPGV 610

Query: 364 YTRVSYYTKWINDRIQMLQE 383
           YT+V+ Y  WI ++IQ  +E
Sbjct: 611 YTKVAEYIDWILEKIQSSKE 630




The enzyme cleaves Lys-Arg and Arg-Ser bonds. It activates, in a reciprocal reaction, factor XII after its binding to a negatively charged surface. It also releases bradykinin from HMW kininogen and may also play a role in the renin-angiotensin system by converting prorenin into renin.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 4EC: .EC: 2EC: 1EC: .EC: 3EC: 4
>sp|P15120|UROK_CHICK Urokinase-type plasminogen activator OS=Gallus gallus GN=PLAU PE=2 SV=1 Back     alignment and function description
>sp|Q6QNF4|HGFA_CANFA Hepatocyte growth factor activator OS=Canis familiaris GN=HGFAC PE=2 SV=1 Back     alignment and function description
>sp|P26262|KLKB1_MOUSE Plasma kallikrein OS=Mus musculus GN=Klkb1 PE=1 SV=2 Back     alignment and function description
>sp|Q9ES87|PRSS8_RAT Prostasin OS=Rattus norvegicus GN=Prss8 PE=2 SV=3 Back     alignment and function description
>sp|P03952|KLKB1_HUMAN Plasma kallikrein OS=Homo sapiens GN=KLKB1 PE=1 SV=1 Back     alignment and function description
>sp|Q9DBI0|TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus GN=Tmprss6 PE=1 SV=4 Back     alignment and function description
>sp|Q9R098|HGFA_MOUSE Hepatocyte growth factor activator OS=Mus musculus GN=Hgfac PE=1 SV=1 Back     alignment and function description
>sp|Q9ESD1|PRSS8_MOUSE Prostasin OS=Mus musculus GN=Prss8 PE=2 SV=2 Back     alignment and function description
>sp|Q04756|HGFA_HUMAN Hepatocyte growth factor activator OS=Homo sapiens GN=HGFAC PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query384
357617467232 putative adhesive serine protease [Danau 0.544 0.900 0.525 2e-58
91088739288 PREDICTED: similar to adhesive serine pr 0.583 0.777 0.493 6e-58
242013745292 tripsin I-P1 precursor, putative [Pedicu 0.507 0.667 0.484 5e-57
321471655276 hypothetical protein DAPPUDRAFT_48614 [D 0.627 0.873 0.444 1e-51
7024219 1322 serine protease 22D [Anopheles gambiae] 0.606 0.176 0.408 2e-46
118786761 1322 AGAP005625-PA [Anopheles gambiae str. PE 0.606 0.176 0.408 2e-46
260830856361 hypothetical protein BRAFLDRAFT_277744 [ 0.611 0.650 0.397 2e-46
118786763 1209 AGAP005625-PB [Anopheles gambiae str. PE 0.606 0.192 0.408 2e-46
7320599 1322 adhesive serine protease [Anopheles gamb 0.544 0.158 0.451 4e-46
260802282 597 hypothetical protein BRAFLDRAFT_84098 [B 0.630 0.405 0.389 2e-45
>gi|357617467|gb|EHJ70809.1| putative adhesive serine protease [Danaus plexippus] Back     alignment and taxonomy information
 Score =  232 bits (592), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 113/215 (52%), Positives = 149/215 (69%), Gaps = 6/215 (2%)

Query: 164 EHQCGGAIISDTVILTAAHCL--QGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHR 221
           EH CGGA+I++ ++++AAHC   Q +    +RI+VG+H L   DK E  F  EK V H  
Sbjct: 10  EHHCGGAVIAERLVVSAAHCFDKQPLHLDHIRILVGEHRLKMQDKHENRFLAEKVVPHPE 69

Query: 222 FRKEGTHSNDIAVVKI-RGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQNAESIDDI 280
           FRK G HSNDIAVV + +  ++FN +V+PIC+PD+  A    WC V+GWG Q+ ES ++ 
Sbjct: 70  FRKNGPHSNDIAVVLVSKSGVQFNSHVRPICLPDKVEANGR-WCAVSGWGYQD-ESTENF 127

Query: 281 SNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIG 340
           S  LRAA V V+D  TCR   V G+  Q ILDSM+CAG L+GG+DAC GDSGGPLAC +G
Sbjct: 128 SPVLRAAAVPVLDLATCRRDKVLGSCKQTILDSMICAGALSGGVDACKGDSGGPLAC-LG 186

Query: 341 GRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWIN 375
            R+ L+GVVSWG GC ++ +PGVYTRV+ Y  W+ 
Sbjct: 187 HRWQLTGVVSWGAGCGRRARPGVYTRVASYVDWLR 221




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91088739|ref|XP_975289.1| PREDICTED: similar to adhesive serine protease [Tribolium castaneum] gi|270012788|gb|EFA09236.1| serine protease P74 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242013745|ref|XP_002427561.1| tripsin I-P1 precursor, putative [Pediculus humanus corporis] gi|212511976|gb|EEB14823.1| tripsin I-P1 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|321471655|gb|EFX82627.1| hypothetical protein DAPPUDRAFT_48614 [Daphnia pulex] Back     alignment and taxonomy information
>gi|7024219|gb|AAD38337.3|AF117751_1 serine protease 22D [Anopheles gambiae] Back     alignment and taxonomy information
>gi|118786761|ref|XP_315638.3| AGAP005625-PA [Anopheles gambiae str. PEST] gi|116126476|gb|EAA11708.4| AGAP005625-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|260830856|ref|XP_002610376.1| hypothetical protein BRAFLDRAFT_277744 [Branchiostoma floridae] gi|229295741|gb|EEN66386.1| hypothetical protein BRAFLDRAFT_277744 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|118786763|ref|XP_315637.3| AGAP005625-PB [Anopheles gambiae str. PEST] gi|116126477|gb|EAA44054.3| AGAP005625-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|7320599|emb|CAB81934.1| adhesive serine protease [Anopheles gambiae] Back     alignment and taxonomy information
>gi|260802282|ref|XP_002596021.1| hypothetical protein BRAFLDRAFT_84098 [Branchiostoma floridae] gi|229281275|gb|EEN52033.1| hypothetical protein BRAFLDRAFT_84098 [Branchiostoma floridae] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query384
UNIPROTKB|P57727454 TMPRSS3 "Transmembrane proteas 0.549 0.464 0.372 1.8e-42
UNIPROTKB|B7WPR2451 TMPRSS3 "Transmembrane proteas 0.546 0.465 0.377 2.2e-42
UNIPROTKB|F1N5F0 1053 F1N5F0 "Uncharacterized protei 0.554 0.202 0.348 2.4e-42
UNIPROTKB|Q5USC7538 TMPRSS3 "Transmembrane proteas 0.549 0.392 0.372 4.9e-42
UNIPROTKB|G3MX30774 G3MX30 "Uncharacterized protei 0.541 0.268 0.350 7.7e-42
UNIPROTKB|F1SGB1781 OVCH1 "Uncharacterized protein 0.541 0.266 0.356 1.6e-41
UNIPROTKB|F1NLT4458 TMPRSS3 "Uncharacterized prote 0.546 0.458 0.363 2e-41
UNIPROTKB|F1MYZ1539 TMPRSS3 "Uncharacterized prote 0.552 0.393 0.359 2.1e-41
UNIPROTKB|F1PP37543 TMPRSS3 "Uncharacterized prote 0.552 0.390 0.354 2.2e-41
UNIPROTKB|F1NZZ9805 OVCH2 "Uncharacterized protein 0.635 0.303 0.287 2.2e-41
UNIPROTKB|P57727 TMPRSS3 "Transmembrane protease serine 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 355 (130.0 bits), Expect = 1.8e-42, Sum P(2) = 1.8e-42
 Identities = 82/220 (37%), Positives = 119/220 (54%)

Query:   162 QGEHQCGGAIISDTVILTAAHCLQGISKSKLRII-VGKHNLNGVDKFEKTFKVEKAVLHH 220
             QG H CGG++I+   I+TAAHC+  +   K   I VG  +L  +D    +  VEK V H 
Sbjct:   237 QGYHLCGGSVITPLWIITAAHCVYDLYLPKSWTIQVGLVSL--LDNPAPSHLVEKIVYHS 294

Query:   221 RFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPD-RDNAAASDWCVVTGWGAQNAESIDD 279
             +++ +    NDIA++K+ G + FN+ +QP+C+P+  +N      C  +GWGA   +   D
Sbjct:   295 KYKPKRL-GNDIALMKLAGPLTFNEMIQPVCLPNSEENFPDGKVCWTSGWGATE-DGAGD 352

Query:   280 ISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNXXXXXXXXXXXXPLACKI 339
              S  L  A V +I    C    VYG     I  SMLCAGYL             PL C+ 
Sbjct:   353 ASPVLNHAAVPLISNKICNHRDVYGGI---ISPSMLCAGYLTGGVDSCQGDSGGPLVCQE 409

Query:   340 GGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQ 379
                + L G  S+G GCA+ NKPGVYTRV+ +  WI+++++
Sbjct:   410 RRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWIHEQME 449


GO:0005044 "scavenger receptor activity" evidence=IEA
GO:0007605 "sensory perception of sound" evidence=IEA
GO:0043025 "neuronal cell body" evidence=IEA
GO:0004252 "serine-type endopeptidase activity" evidence=NAS
GO:0006508 "proteolysis" evidence=NAS
GO:0016021 "integral to membrane" evidence=NAS
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005789 "endoplasmic reticulum membrane" evidence=IDA
GO:0006883 "cellular sodium ion homeostasis" evidence=IDA
GO:0017080 "sodium channel regulator activity" evidence=IDA
UNIPROTKB|B7WPR2 TMPRSS3 "Transmembrane protease serine 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N5F0 F1N5F0 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q5USC7 TMPRSS3 "Transmembrane protease serine 3 isoform 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3MX30 G3MX30 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGB1 OVCH1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLT4 TMPRSS3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYZ1 TMPRSS3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP37 TMPRSS3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZZ9 OVCH2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.210.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 9e-88
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 7e-84
pfam00089218 pfam00089, Trypsin, Trypsin 5e-58
COG5640 413 COG5640, COG5640, Secreted trypsin-like serine pro 1e-21
cd00190232 cd00190, Tryp_SPc, Trypsin-like serine protease; M 8e-21
smart00020229 smart00020, Tryp_SPc, Trypsin-like serine protease 1e-18
pfam00089218 pfam00089, Trypsin, Trypsin 5e-14
COG5640413 COG5640, COG5640, Secreted trypsin-like serine pro 2e-04
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
 Score =  264 bits (677), Expect = 9e-88
 Identities = 91/223 (40%), Positives = 127/223 (56%), Gaps = 7/223 (3%)

Query: 155 QVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVE 214
           QV      G H CGG++IS   +LTAAHC+   + S   + +G H+L+  +   +  KV+
Sbjct: 15  QVSLQYTGGRHFCGGSLISPRWVLTAAHCVYSSAPSNYTVRLGSHDLSSNEGGGQVIKVK 74

Query: 215 KAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRD-NAAASDWCVVTGWGAQN 273
           K ++H  +    T+ NDIA++K++  +  +  V+PIC+P    N  A   C V+GWG  +
Sbjct: 75  KVIVHPNYNP-STYDNDIALLKLKRPVTLSDNVRPICLPSSGYNLPAGTTCTVSGWGRTS 133

Query: 274 AESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGG 333
                 + + L+   V ++    C+ +  YG     I D+MLCAG L GG DAC GDSGG
Sbjct: 134 EGGP--LPDVLQEVNVPIVSNAECKRAYSYGG---TITDNMLCAGGLEGGKDACQGDSGG 188

Query: 334 PLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWIND 376
           PL C   GR VL G+VSWG GCA+ N PGVYTRVS Y  WI  
Sbjct: 189 PLVCNDNGRGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQK 231


Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues. Length = 232

>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238113 cd00190, Tryp_SPc, Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>gnl|CDD|214473 smart00020, Tryp_SPc, Trypsin-like serine protease Back     alignment and domain information
>gnl|CDD|215708 pfam00089, Trypsin, Trypsin Back     alignment and domain information
>gnl|CDD|227927 COG5640, COG5640, Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 384
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 100.0
KOG3627|consensus256 100.0
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 100.0
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 100.0
COG5640 413 Secreted trypsin-like serine protease [Posttransla 100.0
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 99.85
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 99.53
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 99.25
TIGR02037 428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 98.53
cd00190232 Tryp_SPc Trypsin-like serine protease; Many of the 98.48
smart00020229 Tryp_SPc Trypsin-like serine protease. Many of the 98.34
TIGR02038 351 protease_degS periplasmic serine pepetdase DegS. T 98.25
PF00089220 Trypsin: Trypsin; InterPro: IPR001254 In the MEROP 98.24
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 98.24
PRK10139 455 serine endoprotease; Provisional 98.21
PRK10898 353 serine endoprotease; Provisional 98.19
PRK10942 473 serine endoprotease; Provisional 98.1
KOG3627|consensus256 97.56
COG5640 413 Secreted trypsin-like serine protease [Posttransla 97.47
PF02395 769 Peptidase_S6: Immunoglobulin A1 protease Serine pr 96.86
COG3591251 V8-like Glu-specific endopeptidase [Amino acid tra 96.61
PF03761282 DUF316: Domain of unknown function (DUF316) ; Inte 96.46
PF00548172 Peptidase_C3: 3C cysteine protease (picornain 3C); 95.02
PF09342267 DUF1986: Domain of unknown function (DUF1986); Int 93.99
PF13365120 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8 93.41
PF00863235 Peptidase_C4: Peptidase family C4 This family belo 90.41
COG0265 347 DegQ Trypsin-like serine proteases, typically peri 86.09
PF05416535 Peptidase_C37: Southampton virus-type processing p 84.61
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
Probab=100.00  E-value=5.9e-45  Score=327.88  Aligned_cols=231  Identities=42%  Similarity=0.859  Sum_probs=194.7

Q ss_pred             EecCccCCCCCCceEEEEeeeccCCCCceeeeeeeecchhhhhcccccccccccceEEEecccccCCCcccccceeEEEE
Q psy17339         76 IVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEIQ  155 (384)
Q Consensus        76 I~gG~~a~~~~~Pw~v~l~~~~~~~~~~~~CgGtLIs~~~VLTAAhC~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~v~  155 (384)
                      |+||+++.+++|||+|+|+...    ..+.|+||||+++||||||||+...                             
T Consensus         1 i~~G~~~~~~~~Pw~v~i~~~~----~~~~C~GtlIs~~~VLTaAhC~~~~-----------------------------   47 (232)
T cd00190           1 IVGGSEAKIGSFPWQVSLQYTG----GRHFCGGSLISPRWVLTAAHCVYSS-----------------------------   47 (232)
T ss_pred             CcCCeECCCCCCCCEEEEEccC----CcEEEEEEEeeCCEEEECHHhcCCC-----------------------------
Confidence            6899999999999999998753    4567888888888888888887653                             


Q ss_pred             EeecCCCCceeeEEEEecCCEEEecccccCCCCCceEEEEEeeeccCCCCcceEEEEEEEEEEcCCCCCCCCCCCceEEE
Q psy17339        156 VRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVV  235 (384)
Q Consensus       156 ~~~~~~~~~~~C~GtLIs~~~VLTAAhC~~~~~~~~~~v~~g~~~~~~~~~~~~~~~v~~i~~hp~y~~~~~~~~DIALl  235 (384)
                                                      ....+.|++|.......+...+.+.|.++++||.|+.. ...+|||||
T Consensus        48 --------------------------------~~~~~~v~~g~~~~~~~~~~~~~~~v~~~~~hp~y~~~-~~~~DiAll   94 (232)
T cd00190          48 --------------------------------APSNYTVRLGSHDLSSNEGGGQVIKVKKVIVHPNYNPS-TYDNDIALL   94 (232)
T ss_pred             --------------------------------CCccEEEEeCcccccCCCCceEEEEEEEEEECCCCCCC-CCcCCEEEE
Confidence                                            24567888888776654445678899999999999887 788999999


Q ss_pred             EEcCCcCCCCceeeeccCCCC-CCCCCCeEEEEEeccCCCCCCCcccccceEEEEEEecccccccccccCCCCCCccCCe
Q psy17339        236 KIRGNIEFNQYVQPICIPDRD-NAAASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSM  314 (384)
Q Consensus       236 ~L~~pv~~~~~v~picLp~~~-~~~~~~~~~v~GwG~~~~~~~~~~~~~l~~~~~~i~~~~~C~~~~~~~~~~~~~~~~~  314 (384)
                      ||++|+.++++++|+|||... ....+..+.++|||.....  ...+..+++..+.+++...|...  +.. ...+.+++
T Consensus        95 ~L~~~~~~~~~v~picl~~~~~~~~~~~~~~~~G~g~~~~~--~~~~~~~~~~~~~~~~~~~C~~~--~~~-~~~~~~~~  169 (232)
T cd00190          95 KLKRPVTLSDNVRPICLPSSGYNLPAGTTCTVSGWGRTSEG--GPLPDVLQEVNVPIVSNAECKRA--YSY-GGTITDNM  169 (232)
T ss_pred             EECCcccCCCcccceECCCccccCCCCCEEEEEeCCcCCCC--CCCCceeeEEEeeeECHHHhhhh--ccC-cccCCCce
Confidence            999999999999999999885 5777899999999987654  23467899999999999999984  321 24677899


Q ss_pred             EEeeecCCCcCCCCCCccCeeEEEeCCeEEEEEEEEecCCCCCCCCCeEEEechhhHHHHHHH
Q psy17339        315 LCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDR  377 (384)
Q Consensus       315 ~Ca~~~~~~~~~C~GDsGgPl~~~~~~~~~lvGI~S~g~~c~~~~~p~vyt~V~~~~~WI~~~  377 (384)
                      +|++......+.|.|||||||++..+++++|+||+|++..|.....|++|++|..|++||+++
T Consensus       170 ~C~~~~~~~~~~c~gdsGgpl~~~~~~~~~lvGI~s~g~~c~~~~~~~~~t~v~~~~~WI~~~  232 (232)
T cd00190         170 LCAGGLEGGKDACQGDSGGPLVCNDNGRGVLVGIVSWGSGCARPNYPGVYTRVSSYLDWIQKT  232 (232)
T ss_pred             EeeCCCCCCCccccCCCCCcEEEEeCCEEEEEEEEehhhccCCCCCCCEEEEcHHhhHHhhcC
Confidence            999876556789999999999999999999999999999998767899999999999999863



Alignment contains also inactive enzymes that have substitutions of the catalytic triad residues.

>KOG3627|consensus Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>cd00190 Tryp_SPc Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms Back     alignment and domain information
>smart00020 Tryp_SPc Trypsin-like serine protease Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PF00089 Trypsin: Trypsin; InterPro: IPR001254 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3627|consensus Back     alignment and domain information
>COG5640 Secreted trypsin-like serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02395 Peptidase_S6: Immunoglobulin A1 protease Serine protease Prosite pattern; InterPro: IPR000710 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3591 V8-like Glu-specific endopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PF03761 DUF316: Domain of unknown function (DUF316) ; InterPro: IPR005514 This is a family of uncharacterised proteins from Caenorhabditis elegans Back     alignment and domain information
>PF00548 Peptidase_C3: 3C cysteine protease (picornain 3C); InterPro: IPR000199 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF09342 DUF1986: Domain of unknown function (DUF1986); InterPro: IPR015420 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13365 Trypsin_2: Trypsin-like peptidase domain; PDB: 1Y8T_A 2Z9I_A 3QO6_A 1L1J_A 1QY6_A 2O8L_A 3OTP_E 2ZLE_I 1KY9_A 3CS0_A Back     alignment and domain information
>PF00863 Peptidase_C4: Peptidase family C4 This family belongs to family C4 of the peptidase classification Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF05416 Peptidase_C37: Southampton virus-type processing peptidase; InterPro: IPR001665 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
1ybw_A283 Protease Domain Of Hgfa With No Inhibitor Length = 2e-34
2wub_A257 Crystal Structure Of Hgfa In Complex With The Allos 7e-34
2r0l_A248 Short Form Hgfa With Inhibitory Fab75 Length = 248 7e-34
2f83_A625 Crystal Structure At 2.9 Angstroms Resolution Of Hu 1e-31
1fxy_A228 Coagulation Factor Xa-Trypsin Chimera Inhibited Wit 2e-31
3dfj_A263 Crystal Structure Of Human Prostasin Length = 263 4e-31
2any_A241 Expression, Crystallization And The Three-Dimension 4e-31
3gyl_B261 Structure Of Prostasin At 1.3 Angstroms Resolution 5e-31
3e0p_B271 The X-Ray Structure Of Human Prostasin In Complex W 5e-31
2anw_A241 Expression, Crystallization And Three-Dimensional S 6e-31
1xx9_A238 Crystal Structure Of The Fxia Catalytic Domain In C 6e-31
2f91_A237 1.2a Resolution Structure Of A Crayfish Trypsin Com 7e-31
1xxd_A238 Crystal Structure Of The Fxia Catalytic Domain In C 2e-30
1zhm_A238 Crystal Structure Of The Catalytic Domain Of The Co 2e-30
1kig_H241 Bovine Factor Xa Length = 241 2e-30
1zhp_A238 Crystal Structure Of The Catalytic Domain Of Coagul 3e-30
2bok_A241 Factor Xa- Cation Length = 241 5e-30
2y5f_A234 Factor Xa - Cation Inhibitor Complex Length = 234 5e-30
3bg8_A238 Crystal Structure Of Factor Xia In Complex With Cla 7e-30
1ezq_A254 Crystal Structure Of Human Coagulation Factor Xa Co 7e-30
1fax_A254 Coagulation Factor Xa Inhibitor Complex Length = 25 7e-30
2bq6_B249 Crystal Structure Of Factor Xa In Complex With 21 L 7e-30
3sor_A238 Factor Xia In Complex With A Clorophenyl-tetrazole 8e-30
1c5m_D255 Structural Basis For Selectivity Of A Small Molecul 8e-30
1hcg_A241 Structure Of Human Des(1-45) Factor Xa At 2.2 Angst 8e-30
2gd4_H241 Crystal Structure Of The Antithrombin-S195a Factor 8e-30
1xka_C235 Factor Xa Complexed With A Synthetic Inhibitor Fx-2 9e-30
1fjs_A234 Crystal Structure Of The Inhibitor Zk-807834 (Ci-10 9e-30
3ens_B238 Crystal Structure Of Human Fxa In Complex With Meth 9e-30
1mq5_A233 Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-ch 1e-29
2vnt_A276 Urokinase-Type Plasminogen Activator Inhibitor Comp 1e-29
1zpz_A238 Factor Xi Catalytic Domain Complexed With N-((R)-1- 1e-29
3ig6_B253 Low Molecular Weigth Human Urokinase Type Plasminog 1e-29
1lmw_B253 Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-A 2e-29
1owd_A245 Substituted 2-naphthamidine Inhibitors Of Urokinase 2e-29
1zjd_A237 Crystal Structure Of The Catalytic Domain Of Coagul 3e-29
1zhr_A238 Crystal Structure Of The Catalytic Domain Of Coagul 3e-29
1zlr_A237 Factor Xi Catalytic Domain Complexed With 2-Guanidi 4e-29
1owe_A245 Substituted 2-Naphthamidine Inhibitors Of Urokinase 6e-29
1y59_T223 Dianhydrosugar-Based Benzamidine, Factor Xa Specifi 7e-29
1gi8_B245 A Novel Serine Protease Inhibition Motif Involving 1e-28
1gj7_B253 Engineering Inhibitors Highly Selective For The S1 1e-28
1o5a_B253 Dissecting And Designing Inhibitor Selectivity Dete 1e-28
1sc8_U262 Urokinase Plasminogen Activator B-Chain-J435 Comple 1e-28
3mwi_U246 The Complex Crystal Structure Of Urokianse And 5-Ni 1e-28
1ejn_A253 Urokinase Plasminogen Activator B-Chain Inhibitor C 1e-28
1w0z_U247 Urokinase Type Plasminogen Activator Length = 247 1e-28
1j15_A223 Benzamidine In Complex With Rat Trypsin Mutant X991 2e-28
2ra3_A224 Human Cationic Trypsin Complexed With Bovine Pancre 2e-28
1fv9_A245 Crystal Structure Of Human Microurokinase In Comple 2e-28
2nwn_A253 New Pharmacophore For Serine Protease Inhibition Re 3e-28
2o8u_A253 Crystal Structure And Binding Epitopes Of Urokinase 4e-28
4fu7_A246 Crystal Structure Of The Urokinase Length = 246 4e-28
1trn_A224 Crystal Structure Of Human Trypsin 1: Unexpected Ph 6e-28
1ql9_A223 Factor Xa Specific Inhibitor In Complex With Rat Tr 8e-28
2r9p_A224 Human Mesotrypsin Complexed With Bovine Pancreatic 8e-28
4dg4_A224 Human Mesotrypsin-S39y Complexed With Bovine Pancre 1e-27
1z8g_A372 Crystal Structure Of The Extracellular Region Of Th 1e-27
1o5e_H255 Dissecting And Designing Inhibitor Selectivity Dete 1e-27
1tab_E223 Structure Of The Trypsin-Binding Domain Of Bowman-B 1e-27
1taw_A223 Bovine Trypsin Complexed To Appi Length = 223 1e-27
3qk1_A229 Crystal Structure Of Enterokinase-Like Trypsin Vari 1e-27
3t2n_A372 Human Hepsin Protease In Complex With The Fab Fragm 1e-27
3otj_E223 A Crystal Structure Of Trypsin Complexed With Bpti 1e-27
1h4w_A224 Structure Of Human Trypsin Iv (Brain Trypsin) Lengt 1e-27
1oph_B243 Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh 1e-27
1f0t_A243 Bovine Trypsin Complexed With Rpr131247 Length = 24 1e-27
1zzz_A237 Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes 2e-27
5ptp_A223 Structure Of Hydrolase (Serine Proteinase) Length = 2e-27
1a0j_A223 Crystal Structure Of A Non-Psychrophilic Trypsin Fr 2e-27
3veq_B223 A Binary Complex Betwwen Bovine Pancreatic Trypsin 2e-27
1g3b_A228 Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Ba 2e-27
1tgs_Z229 Three-Dimensional Structure Of The Complex Between 2e-27
1mct_A223 The Refined 1.6 Angstroms Resolution Crystal Struct 3e-27
1tfx_A223 Complex Of The Second Kunitz Domain Of Tissue Facto 3e-27
2a31_A223 Trypsin In Complex With Borate Length = 223 4e-27
1co7_E245 R117h Mutant Rat Anionic Trypsin Complexed With Bov 4e-27
4an7_A231 Kunitz Type Trypsin Inhibitor Complex With Porcine 4e-27
1v2k_T223 Factor Xa Specific Inhibitor In Complex With Bovine 6e-27
4b2a_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 6e-27
1f5r_A231 Rat Trypsinogen Mutant Complexed With Bovine Pancre 7e-27
1ntp_A223 Use Of The Neutron Diffraction HD EXCHANGE TECHNIQU 7e-27
3pwb_A223 Bovine Trypsin Variant X(Tripleglu217ile227) In Com 8e-27
1amh_A223 Uncomplexed Rat Trypsin Mutant With Asp 189 Replace 8e-27
2fi4_E223 Crystal Structure Of A Bpti Variant (Cys14->ser) In 8e-27
3tgi_E223 Wild-Type Rat Anionic Trypsin Complexed With Bovine 9e-27
4b1t_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 1e-26
1k9o_E223 Crystal Structure Of Michaelis Serpin-Trypsin Compl 1e-26
3tgj_E233 S195a Trypsinogen Complexed With Bovine Pancreatic 1e-26
1fy8_E231 Crystal Structure Of The Deltaile16val17 Rat Anioni 1e-26
3tgk_E231 Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 1e-26
1v2n_T223 Potent Factor Xa Inhibitor In Complex With Bovine T 1e-26
1f7z_A233 Rat Trypsinogen K15a Complexed With Bovine Pancreat 1e-26
3myw_A223 The Bowman-Birk Type Inhibitor From Mung Bean In Te 1e-26
1dpo_A223 Structure Of Rat Trypsin Length = 223 1e-26
3pmj_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 1e-26
2d8w_A223 Structure Of Hyper-Vil-Trypsin Length = 223 2e-26
1slw_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 2e-26
4b2b_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 2e-26
1an1_E223 Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Len 2e-26
1and_A223 Anionic Trypsin Mutant With Arg 96 Replaced By His 2e-26
1eai_A240 Complex Of Ascaris Chymotrpsin/elastase Inhibitor W 2e-26
3plk_A223 Bovine Trypsin Variant X(Tripleile227) In Complex W 3e-26
1slx_B223 Rat Anionic N143h, E151h Trypsin Complexed To A86h 3e-26
1anb_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Glu 3e-26
3uqv_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 3e-26
3uns_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 3e-26
1anc_A223 Anionic Trypsin Mutant With Ser 214 Replaced By Lys 3e-26
1twx_B259 Crystal Structure Of The Thrombin Mutant D221aD222K 3e-26
4b2c_A223 Structure Of The Factor Xa-Like Trypsin Variant Tri 3e-26
1thp_B259 Structure Of Human Alpha-Thrombin Y225p Mutant Boun 4e-26
1trm_A223 The Three-Dimensional Structure Of Asn102 Mutant Of 4e-26
1ezs_C223 Crystal Structure Of Ecotin Mutant M84r, W67a, G68a 4e-26
1bda_A265 Catalytic Domain Of Human Single Chain Tissue Plasm 4e-26
1a5i_A265 Catalytic Domain Of Vampire Bat (Desmodus Rotundus) 4e-26
2bm2_A245 Human Beta-Ii Tryptase In Complex With 4-(3-Aminome 5e-26
1rtf_B252 Complex Of Benzamidine With The Catalytic Domain Of 5e-26
2zeb_A243 Potent, Nonpeptide Inhibitors Of Human Mast Cell Tr 5e-26
1a0l_A244 Human Beta-Tryptase: A Ring-Like Tetramer With Acti 5e-26
2f9n_A245 Crystal Structure Of The Recombinant Human Alpha I 6e-26
1eaw_A241 Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (A 6e-26
1v2u_T223 Benzamidine In Complex With Bovine Trypsin Varinat 6e-26
3uwi_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 6e-26
3unq_A223 Bovine Trypsin Variant X(Triplephe227) In Complex W 6e-26
2f9o_A245 Crystal Structure Of The Recombinant Human Alpha I 6e-26
1brb_E223 Crystal Structures Of Rat Anionic Trypsin Complexed 7e-26
3p8g_A241 Crystal Structure Of Mt-Sp1 In Complex With Benzami 8e-26
2est_E240 Crystallographic Study Of The Binding Of A Trifluor 8e-26
1v2s_T223 Benzamidine In Complex With Bovine Trypsin Variant 9e-26
2wph_S235 Factor Ixa Superactive Triple Mutant Length = 235 1e-25
1hax_B240 Snapshots Of Serine Protease Catalysis: (A) Acyl-En 1e-25
2ftm_A224 Crystal Structure Of A Bpti Variant (Cys38->ser) In 1e-25
1v2o_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 1e-25
1v2j_T223 Benzamidine In Complex With Bovine Trypsin Variant 1e-25
1lto_A245 Human Alpha1-Tryptase Length = 245 1e-25
1qrz_A246 Catalytic Domain Of Plasminogen Length = 246 1e-25
1ym0_A238 Crystal Structure Of Earthworm Fibrinolytic Enzyme 1e-25
2wpm_S235 Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Le 2e-25
1v2q_T223 Trypsin Inhibitor In Complex With Bovine Trypsin Va 2e-25
1h8i_H253 X-Ray Crystal Structure Of Human Alpha-Thrombin Wit 2e-25
3gic_B250 Structure Of Thrombin Mutant Delta(146-149e) In The 2e-25
1utj_A242 Trypsin Specificity As Elucidated By Lie Calculatio 3e-25
2wpi_S235 Factor Ixa Superactive Double Mutant Length = 235 3e-25
1bzx_E222 The Crystal Structure Of Anionic Salmon Trypsin In 3e-25
1l4z_A248 X-Ray Crystal Structure Of The Complex Of Microplas 3e-25
1hj8_A222 1.00 Aa Trypsin From Atlantic Salmon Length = 222 3e-25
1l4d_A249 Crystal Structure Of Microplasminogen-streptokinase 3e-25
3v0x_A223 Bovine Trypsin Variant X(Tripleglu217phe227) In Com 3e-25
1bit_A237 The Crystal Structure Of Anionic Salmon Trypsin In 3e-25
1ddj_A247 Crystal Structure Of Human Plasminogen Catalytic Do 3e-25
3uir_A247 Crystal Structure Of The Plasmin-Textilinin-1 Compl 3e-25
1bui_B250 Structure Of The Ternary Microplasmin-Staphylokinas 3e-25
3r3g_B259 Structure Of Human Thrombin With Residues 145-150 O 4e-25
3k65_B308 Crystal Structure Of Prethombin-2FRAGMENT-2 Complex 4e-25
1bml_A250 Complex Of The Catalytic Domain Of Human Plasmin An 4e-25
3jz1_B259 Crystal Structure Of Human Thrombin Mutant N143p In 4e-25
1ekb_B235 The Serine Protease Domain Of Enteropeptidase Bound 5e-25
3sqe_E290 Crystal Structure Of Prethrombin-2 Mutant S195a In 5e-25
1jou_B259 Crystal Structure Of Native S195a Thrombin With An 5e-25
1z8i_B259 Crystal Structure Of The Thrombin Mutant G193a Boun 5e-25
2od3_B259 Human Thrombin Chimera With Human Residues 184a, 18 5e-25
2bvr_H252 Human Thrombin Complexed With Fragment-based Small 5e-25
1dm4_B260 Ser195ala Mutant Of Human Thrombin Complexed With F 5e-25
1z8j_B259 Crystal Structure Of The Thrombin Mutant G193p Boun 6e-25
1jwt_A305 Crystal Structure Of Thrombin In Complex With A Nov 6e-25
1mbq_A220 Anionic Trypsin From Pacific Chum Salmon Length = 2 6e-25
1hag_E295 The Isomorphous Structures Of Prethrombin2, Hirugen 6e-25
1bth_H259 Structure Of Thrombin Complexed With Bovine Pancrea 6e-25
1abi_H259 Structure Of The Hirulog 3-Thrombin Complex And Nat 7e-25
1b7x_B259 Structure Of Human Alpha-Thrombin Y225i Mutant Boun 8e-25
1vzq_H250 Complex Of Thrombin With Designed Inhibitor 7165 Le 8e-25
1nu9_A291 Staphylocoagulase-prethrombin-2 Complex Length = 29 8e-25
2bdy_A289 Thrombin In Complex With Inhibitor Length = 289 8e-25
3bn9_B241 Crystal Structure Of Mt-Sp1 In Complex With Fab Inh 8e-25
1rjx_B247 Human Plasminogen Catalytic Domain, K698m Mutant Le 8e-25
2tbs_A222 Cold-Adaption Of Enzymes: Structural Comparison Bet 8e-25
3nxp_A424 Crystal Structure Of Human Prethrombin-1 Length = 4 9e-25
1pfx_C235 Porcine Factor Ixa Length = 235 9e-25
2zpq_A222 Crystal Structure Of Anionic Trypsin Isoform 1 From 9e-25
2thf_B259 Structure Of Human Alpha-thrombin Y225f Mutant Boun 9e-25
1rfn_A235 Human Coagulation Factor Ixa In Complex With P-Amin 1e-24
3kcg_H235 Crystal Structure Of The Antithrombin-Factor Ixa- P 1e-24
1aut_C250 Human Activated Protein C Length = 250 1e-24
1wbg_B259 Active Site Thrombin Inhibitors Length = 259 1e-24
1d9i_A288 Structure Of Thrombin Complexed With Selective Non- 1e-24
3f6u_H240 Crystal Structure Of Human Activated Protein C (Apc 1e-24
1rd3_B259 2.5a Structure Of Anticoagulant Thrombin Variant E2 1e-24
1sfq_B259 Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack 1e-24
1fiz_A263 Three Dimensional Structure Of Beta-Acrosin From Bo 2e-24
1d6w_A287 Structure Of Thrombin Complexed With Selective Non- 2e-24
1eoj_A289 Design Of P1' And P3' Residues Of Trivalent Thrombi 2e-24
1hj9_A223 Atomic Resolution Structures Of Trypsin Provide Ins 2e-24
1nm6_A287 Thrombin In Complex With Selective Macrocyclic Inhi 2e-24
2zps_A222 Crystal Structure Of Anionic Trypsin Isoform 3 From 2e-24
1gj5_H258 Selectivity At S1, H2o Displacement, Upa, Tpa, Ser1 2e-24
1qur_H257 Human Alpha-Thrombin In Complex With Bivalent, Benz 2e-24
1h8d_H260 X-Ray Structure Of The Human Alpha-Thrombin Complex 2e-24
1dx5_M259 Crystal Structure Of The Thrombin-Thrombomodulin Co 2e-24
1mza_A240 Crystal Structure Of Human Pro-Granzyme K Length = 2e-24
2eek_A220 Crystal Structure Of Atlantic Cod Trypsin Complexed 2e-24
4dur_A791 The X-Ray Crystal Structure Of Full-Length Type Ii 2e-24
2gp9_B259 Crystal Structure Of The Slow Form Of Thrombin In A 3e-24
1bru_P241 Structure Of Porcine Pancreatic Elastase Complexed 3e-24
1mh0_A287 Crystal Structure Of The Anticoagulant Slow Form Of 3e-24
4h4f_A249 Crystal Structure Of Human Chymotrypsin C (ctrc) Bo 3e-24
1mkw_K308 The Co-Crystal Structure Of Unliganded Bovine Alpha 4e-24
2a0q_B257 Structure Of Thrombin In 400 Mm Potassium Chloride 4e-24
2zpr_A222 Crystal Structure Of Anionic Trypsin Isoform 2 From 4e-24
1bbr_K259 The Structure Of Residues 7-16 Of The A Alpha Chain 5e-24
3gov_B251 Crystal Structure Of The Catalytic Region Of Human 5e-24
2pgb_B259 Inhibitor-Free Human Thrombin Mutant C191a-C220a Le 6e-24
4igd_A406 Crystal Structure Of The Zymogen Catalytic Region O 9e-24
1l2e_A223 Human Kallikrein 6 (Hk6) Active Form With Benzamidi 1e-23
1id5_H256 Crystal Structure Of Bovine Thrombin Complex With P 1e-23
1vr1_H261 Specifity For Plasminogen Activator Inhibitor-1 Len 1e-23
1elt_A236 Structure Of Native Pancreatic Elastase From North 2e-23
1dan_H254 Complex Of Active Site Inhibited Human Blood Coagul 2e-23
1npm_A225 Neuropsin, A Serine Protease Expressed In The Limbi 2e-23
1fiw_A290 Three-Dimensional Structure Of Beta-Acrosin From Ra 2e-23
1gvl_A223 Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M P 3e-23
4d8n_A223 Human Kallikrein 6 Inhibitors With A Para-Amidobenz 3e-23
2tld_E220 Crystal Structure Of An Engineered Subtilisin Inhib 4e-23
3ela_H254 Crystal Structure Of Active Site Inhibited Coagulat 4e-23
1pyt_D251 Ternary Complex Of Procarboxypeptidase A, Proprotei 5e-23
2oq5_A232 Crystal Structure Of Desc1, A New Member Of The Typ 6e-23
4dgj_A235 Structure Of A Human Enteropeptidase Light Chain Va 8e-23
3ee0_B259 Crystal Structure Of The W215aE217A MUTANT OF HUMAN 9e-23
2pux_B258 Crystal Structure Of Murine Thrombin In Complex Wit 1e-22
2ocv_B259 Structural Basis Of Na+ Activation Mimicry In Murin 1e-22
2cga_A245 Bovine Chymotrypsinogen A. X-Ray Crystal Structure 1e-22
1dlk_B230 Crystal Structure Analysis Of Delta-Chymotrypsin Bo 2e-22
1tq0_B257 Crystal Structure Of The Potent Anticoagulant Throm 2e-22
1h9h_E231 Complex Of Eeti-Ii With Porcine Trypsin Length = 23 2e-22
3bsq_A227 Crystal Structure Of Human Kallikrein 7 Produced As 7e-22
2qxg_A224 Crystal Structure Of Human Kallikrein 7 In Complex 7e-22
2zgc_A240 Crystal Structure Of Active Human Granzyme M Length 1e-21
1dst_A228 Mutant Of Factor D With Enhanced Catalytic Activity 1e-21
2zgj_A240 Crystal Structure Of D86n-gzmm Complexed With Its O 4e-21
3edx_B258 Crystal Structure Of The W215aE217A MUTANT OF MURIN 2e-20
2psx_A227 Crystal Structure Of Human Kallikrein 5 In Complex 2e-20
1sgf_G237 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 9e-20
4d9q_A228 Inhibiting Alternative Pathway Complement Activatio 1e-19
2xwa_A228 Crystal Structure Of Complement Factor D Mutant R20 3e-19
1fdp_A235 Proenzyme Of Human Complement Factor D, Recombinant 4e-19
2xw9_A228 Crystal Structure Of Complement Factor D Mutant S18 6e-19
1dsu_A228 Human Factor D, Complement Activating Enzyme Length 6e-19
1sgf_A240 Crystal Structure Of 7s Ngf: A Complex Of Nerve Gro 7e-19
2zch_P237 Crystal Structure Of Human Prostate Specific Antige 7e-19
1fi8_A228 Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Ie 8e-19
1m9u_A241 Crystal Structure Of Earthworm Fibrinolytic Enzyme 1e-18
1eq9_A222 Crystal Structure Of Fire Ant Chymotrypsin Complexe 1e-18
2b9l_A394 Crystal Structure Of Prophenoloxidase Activating Fa 2e-18
1spj_A238 Structure Of Mature Human Tissue Kallikrein (Human 1e-17
2olg_A278 Crystal Structure Of The Serine Protease Domain Of 1e-17
3rp2_A224 The Structure Of Rat Mast Cell Protease Ii At 1.9-A 2e-17
3fzz_A227 Structure Of Grc Length = 227 7e-17
3g01_A227 Structure Of Grc Mutant E192rE193G Length = 227 1e-16
2xxl_A408 Crystal Structure Of Drosophila Grass Clip Serine P 4e-16
2xrc_A565 Human Complement Factor I Length = 565 6e-16
4gaw_A226 Crystal Structure Of Active Human Granzyme H Length 1e-15
2aip_A231 Crystal Structure Of Native Protein C Activator Fro 1e-15
1ton_A235 Rat Submaxillary Gland Serine Protease, Tonin. Stru 4e-15
3tju_A226 Crystal Structure Of Human Granzyme H With An Inhib 4e-15
1bhx_B147 X-Ray Structure Of The Complex Of Human Alpha Throm 5e-15
1klt_A226 Crystal Structure Of Pmsf-Treated Human Chymase At 5e-15
1pjp_A226 The 2.2 A Crystal Structure Of Human Chymase In Com 6e-15
4afq_A226 Human Chymase - Fynomer Complex Length = 226 6e-15
1nn6_A228 Human Pro-Chymase Length = 228 6e-15
1si5_H240 Protease-Like Domain From 2-Chain Hepatocyte Growth 8e-15
1shy_A234 The Crystal Structure Of Hgf Beta-Chain In Complex 8e-15
3n7o_A226 X-Ray Structure Of Human Chymase In Complex With Sm 9e-15
1xvm_A224 Trypsin From Fusarium Oxysporum- Room Temperature T 1e-14
1gdu_A224 Fusarium Oxysporum Trypsin At Atomic Resolution Len 2e-14
1ppz_A224 Trypsin Complexes At Atomic And Ultra-High Resoluti 2e-14
1orf_A234 The Oligomeric Structure Of Human Granzyme A Reveal 2e-14
1op8_A234 Crystal Structure Of Human Granzyme A Length = 234 2e-14
3i78_A229 3599170186220-Loops Of Fxa In Sgt Length = 229 2e-14
1euf_A227 Bovine Duodenase(New Serine Protease), Crystal Stru 2e-14
1fuj_A221 Pr3 (Myeloblastin) Length = 221 3e-14
1md8_A329 Monomeric Structure Of The Active Catalytic Domain 3e-14
2qy0_B242 Active Dimeric Structure Of The Catalytic Domain Of 3e-14
1md7_A328 Monomeric Structure Of The Zymogen Of Complement Pr 3e-14
1gpz_A399 The Crystal Structure Of The Zymogen Catalytic Doma 4e-14
3beu_A224 Na+-Dependent Allostery Mediates Coagulation Factor 5e-14
1hyl_A230 The 1.8 A Structure Of Collagenase From Hypoderma L 8e-14
1bbr_H150 The Structure Of Residues 7-16 Of The A Alpha Chain 9e-14
1ao5_A237 Mouse Glandular Kallikrein-13 (Prorenin Converting 9e-14
1pyt_C253 Ternary Complex Of Procarboxypeptidase A, Proprotei 2e-13
1bqy_A234 Plasminogen Activator (tsv-pa) From Snake Venom Len 3e-13
3i77_A230 3599170-Loops Of Fxa In Sgt Length = 230 9e-13
4gso_A232 Structure Of Jararacussin-I Length = 232 1e-12
3s9a_A234 Russell's Viper Venom Serine Proteinase, Rvv-V (Clo 2e-12
1fq3_A227 Crystal Structure Of Human Granzyme B Length = 227 3e-12
1iau_A227 Human Granzyme B In Complex With Ac-Iepd-Cho Length 3e-12
1fon_A240 Crystal Structure Of Bovine Procarboxypeptidase A-S 4e-12
1aks_A125 Crystal Structure Of The First Active Autolysate Fo 5e-12
1kyn_B235 Cathepsin-G Length = 235 5e-12
1au8_A224 Human Cathepsin G Length = 224 6e-12
2fmj_A222 220-Loop Mutant Of Streptomyces Griseus Trypsin Len 9e-12
2asu_B234 Crystal Structure Of The Beta-Chain Of HgflMSP Leng 1e-11
1elv_A333 Crystal Structure Of The Catalytic Domain Of Human 1e-11
1azz_A226 Fiddler Crab Collagenase Complexed To Ecotin Length 1e-11
3tvj_B242 Catalytic Fragment Of Masp-2 In Complex With Its Sp 2e-11
4fxg_H242 Complement C4 In Complex With Masp-2 Length = 242 2e-11
1q3x_A328 Crystal Structure Of The Catalytic Region Of Human 2e-11
1zjk_A403 Crystal Structure Of The Zymogen Catalytic Region O 2e-11
2rdl_A226 Hamster Chymase 2 Length = 226 4e-11
1gvz_A237 Prostate Specific Antigen (Psa) From Stallion Semin 9e-11
4e7n_A238 Crystal Structure Of Ahv_tl-I, A Glycosylated Snake 1e-10
1mtn_B131 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 1e-10
1fy1_A225 [r23s,F25e]hbp, A Mutant Of Human Heparin Binding P 2e-10
1oss_A223 T190p Streptomyces Griseus Trypsin In Complex With 2e-10
1os8_A223 Recombinant Streptomyces Griseus Trypsin Length = 2 2e-10
1sgt_A223 Refined Crystal Structure Of Streptomyces Griseus T 3e-10
2kai_B152 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 5e-10
1fy3_A225 [g175q]hbp, A Mutant Of Human Heparin Binding Prote 6e-10
1a7s_A225 Atomic Resolution Structure Of Hbp Length = 225 7e-10
3h7o_A228 Crystal Structure Of Scabies Mite Inactivated Prote 1e-09
1ept_C98 Refined 1.8 Angstroms Resolution Crystal Structure 1e-09
1uhb_B98 Crystal Structure Of Porcine Alpha Trypsin Bound Wi 1e-09
1op0_A234 Crystal Structure Of Aav-sp-i, A Glycosylated Snake 5e-09
1op2_A234 Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snak 5e-09
1hne_E218 Structure Of Human Neutrophil Elastase In Complex W 8e-09
1ppg_E218 The Refined 2.3 Angstroms Crystal Structure Of Huma 9e-09
3s69_A234 Crystal Structure Of Saxthrombin Length = 234 9e-09
2i6q_A517 Complement Component C2a Length = 517 1e-08
2rg3_A218 Covalent Complex Structure Of Elastase Length = 218 1e-08
2odp_A509 Complement Component C2a, The Catalytic Fragment Of 1e-08
2bdg_A223 Human Kallikrein 4 Complex With Nickel And P-aminob 1e-08
2jet_B128 Crystal Structure Of A Trypsin-Like Mutant (S189d, 1e-08
3h7t_A235 Crystal Structure Of Scabies Mite Inactivated Prote 2e-08
1kdq_A131 Crystal Structure Analysis Of The Mutant S189d Rat 3e-08
1b0f_A218 Crystal Structure Of Human Neutrophil Elastase With 4e-08
1ppf_E218 X-Ray Crystal Structure Of The Complex Of Human Leu 4e-08
2xwb_F732 Crystal Structure Of Complement C3b In Complex With 6e-08
1dle_A298 Factor B Serine Protease Domain Length = 298 7e-08
3hrz_D741 Cobra Venom Factor (Cvf) In Complex With Human Fact 7e-08
2ok5_A752 Human Complement Factor B Length = 752 8e-08
2win_I507 C3 Convertase (C3bbb) Stabilized By Scin Length = 5 1e-07
1rrk_A497 Crystal Structure Analysis Of The Bb Segment Of Fac 1e-07
2hnt_E81 Crystallographic Structure Of Human Gamma-Thrombin 5e-07
2jet_C99 Crystal Structure Of A Trypsin-Like Mutant (S189d, 6e-07
1kdq_B99 Crystal Structure Analysis Of The Mutant S189d Rat 3e-06
4f4o_C347 Structure Of The Haptoglobin-Haemoglobin Complex Le 5e-06
1mtn_C97 Bovine Alpha-Chymotrypsin:bpti Crystallization Leng 5e-06
1afq_C96 Crystal Structure Of Bovine Gamma-Chymotrypsin Comp 5e-06
1ept_B82 Refined 1.8 Angstroms Resolution Crystal Structure 2e-05
2hnt_F105 Crystallographic Structure Of Human Gamma-Thrombin 2e-05
2hnt_C70 Crystallographic Structure Of Human Gamma-Thrombin 2e-05
3h5c_B317 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 3e-05
3f1s_B283 Crystal Structure Of Protein Z Complexed With Prote 3e-05
2kai_A80 Refined 2.5 Angstroms X-Ray Crystal Structure Of Th 4e-05
1bbr_E109 The Structure Of Residues 7-16 Of The A Alpha Chain 4e-05
2pks_C102 Thrombin In Complex With Inhibitor Length = 102 4e-05
>pdb|1YBW|A Chain A, Protease Domain Of Hgfa With No Inhibitor Length = 283 Back     alignment and structure

Iteration: 1

Score = 143 bits (360), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 79/256 (30%), Positives = 133/256 (51%), Gaps = 20/256 (7%) Query: 130 KLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTVILTAAHCL-QGIS 188 + RII G +L G + + G+ C G+++ +++AAHC Sbjct: 33 RPRIIGGSSSLPGSHPWLAAIYI----------GDSFCAGSLVHTCWVVSAAHCFSHSPP 82 Query: 189 KSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVKIRGNIEF----N 244 + + +++G+H N +TF +EK + + + +D+ +++++ + + Sbjct: 83 RDSVSVVLGQHFFNRTTDVTQTFGIEKYIPYTLYSVFNPSDHDLVLIRLKKKGDRCATRS 142 Query: 245 QYVQPICIPDRDNA-AASDWCVVTGWGAQNAESIDDISNTLRAATVKVIDQNTCRSSAVY 303 Q+VQPIC+P+ + A C + GWG + E++ S++LR A V ++ + C S VY Sbjct: 143 QFVQPICLPEPGSTFPAGHKCQIAGWGHLD-ENVSGYSSSLREALVPLVADHKCSSPEVY 201 Query: 304 GNSNQNILDSMLCAGYLNXXXXXXXXXXXXPLACKIGGRFVLSGVVSWGDGCAKKNKPGV 363 G +I +MLCAGY + PLAC+ G L G++SWGDGC + +KPGV Sbjct: 202 G---ADISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISWGDGCGRLHKPGV 258 Query: 364 YTRVSYYTKWINDRIQ 379 YTRV+ Y WINDRI+ Sbjct: 259 YTRVANYVDWINDRIR 274
>pdb|2WUB|A Chain A, Crystal Structure Of Hgfa In Complex With The Allosteric Non-Inhibitory Antibody Fab40.Deltatrp Length = 257 Back     alignment and structure
>pdb|2R0L|A Chain A, Short Form Hgfa With Inhibitory Fab75 Length = 248 Back     alignment and structure
>pdb|2F83|A Chain A, Crystal Structure At 2.9 Angstroms Resolution Of Human Plasma Coagulation Factor Xi Zymogen Length = 625 Back     alignment and structure
>pdb|1FXY|A Chain A, Coagulation Factor Xa-Trypsin Chimera Inhibited With D-Phe-Pro-Arg- Chloromethylketone Length = 228 Back     alignment and structure
>pdb|3DFJ|A Chain A, Crystal Structure Of Human Prostasin Length = 263 Back     alignment and structure
>pdb|2ANY|A Chain A, Expression, Crystallization And The Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|3GYL|B Chain B, Structure Of Prostasin At 1.3 Angstroms Resolution In Complex With A Calcium Ion. Length = 261 Back     alignment and structure
>pdb|3E0P|B Chain B, The X-Ray Structure Of Human Prostasin In Complex With A Covalent Benzoxazole Inhibitor Length = 271 Back     alignment and structure
>pdb|2ANW|A Chain A, Expression, Crystallization And Three-Dimensional Structure Of The Catalytic Domain Of Human Plasma Kallikrein: Implications For Structure-Based Design Of Protease Inhibitors Length = 241 Back     alignment and structure
>pdb|1XX9|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Ecotinm84r Length = 238 Back     alignment and structure
>pdb|2F91|A Chain A, 1.2a Resolution Structure Of A Crayfish Trypsin Complexed With A Peptide Inhibitor, Sgti Length = 237 Back     alignment and structure
>pdb|1XXD|A Chain A, Crystal Structure Of The Fxia Catalytic Domain In Complex With Mutated Ecotin Length = 238 Back     alignment and structure
>pdb|1ZHM|A Chain A, Crystal Structure Of The Catalytic Domain Of The Coagulation Factor Xia In Complex With Benzamidine (s434a- T475a-k437 Mutant) Length = 238 Back     alignment and structure
>pdb|1KIG|H Chain H, Bovine Factor Xa Length = 241 Back     alignment and structure
>pdb|1ZHP|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-K505 Mutant) Length = 238 Back     alignment and structure
>pdb|2BOK|A Chain A, Factor Xa- Cation Length = 241 Back     alignment and structure
>pdb|2Y5F|A Chain A, Factor Xa - Cation Inhibitor Complex Length = 234 Back     alignment and structure
>pdb|3BG8|A Chain A, Crystal Structure Of Factor Xia In Complex With Clavatadine A Length = 238 Back     alignment and structure
>pdb|1EZQ|A Chain A, Crystal Structure Of Human Coagulation Factor Xa Complexed With Rpr128515 Length = 254 Back     alignment and structure
>pdb|1FAX|A Chain A, Coagulation Factor Xa Inhibitor Complex Length = 254 Back     alignment and structure
>pdb|2BQ6|B Chain B, Crystal Structure Of Factor Xa In Complex With 21 Length = 249 Back     alignment and structure
>pdb|3SOR|A Chain A, Factor Xia In Complex With A Clorophenyl-tetrazole Inhibitor Length = 238 Back     alignment and structure
>pdb|1C5M|D Chain D, Structural Basis For Selectivity Of A Small Molecule, S1- Binding, Sub-Micromolar Inhibitor Of Urokinase Type Plasminogen Activator Length = 255 Back     alignment and structure
>pdb|1HCG|A Chain A, Structure Of Human Des(1-45) Factor Xa At 2.2 Angstroms Resolution Length = 241 Back     alignment and structure
>pdb|2GD4|H Chain H, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 241 Back     alignment and structure
>pdb|1XKA|C Chain C, Factor Xa Complexed With A Synthetic Inhibitor Fx-2212a,(2s)-(3'- Amidino-3-Biphenylyl)-5-(4-Pyridylamino)pentanoic Acid Length = 235 Back     alignment and structure
>pdb|1FJS|A Chain A, Crystal Structure Of The Inhibitor Zk-807834 (Ci-1031) Complexed With Factor Xa Length = 234 Back     alignment and structure
>pdb|3ENS|B Chain B, Crystal Structure Of Human Fxa In Complex With Methyl (2z)-3-[(3- Chloro-1h-indol-7-yl)amino]-2-cyano-3-{[(3s)-2-oxo-1-(2- oxo-2- Pyrrolidin-1-ylethyl)azepan-3-yl]amino}acrylate Length = 238 Back     alignment and structure
>pdb|1MQ5|A Chain A, Crystal Structure Of 3-chloro-n-[4-chloro-2-[[(4-chlorophenyl) Amino]carbonyl]phenyl]-4-[(4-methyl-1- piperazinyl)methyl]-2- Thiophenecarboxamide Complexed With Human Factor Xa Length = 233 Back     alignment and structure
>pdb|2VNT|A Chain A, Urokinase-Type Plasminogen Activator Inhibitor Complex With A 1-(7-Sulphoamidoisoquinolinyl)guanidine Length = 276 Back     alignment and structure
>pdb|1ZPZ|A Chain A, Factor Xi Catalytic Domain Complexed With N-((R)-1-(4- Bromophenyl)ethyl)urea-Asn-Val-Arg-Alpha-Ketothiazole Length = 238 Back     alignment and structure
>pdb|3IG6|B Chain B, Low Molecular Weigth Human Urokinase Type Plasminogen Activator 2-[6- (3'-Aminomethyl-Biphenyl-3-Yloxy)-4-(3-Dimethylamino- Pyrrolidin-1- Yl)-3, 5-Difluoro-Pyridin-2-Yloxy]-4-Dimethylamino-Benzoic Acid Complex Length = 253 Back     alignment and structure
>pdb|1LMW|B Chain B, Lmw U-Pa Structure Complexed With Egrcmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 253 Back     alignment and structure
>pdb|1OWD|A Chain A, Substituted 2-naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1ZJD|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Kunitz Protease Inhibitor Domain Of Protease Nexin Ii Length = 237 Back     alignment and structure
>pdb|1ZHR|A Chain A, Crystal Structure Of The Catalytic Domain Of Coagulation Factor Xi In Complex With Benzamidine (S434a-T475a-C482s-K437a Mutant) Length = 238 Back     alignment and structure
>pdb|1ZLR|A Chain A, Factor Xi Catalytic Domain Complexed With 2-Guanidino-1-(4-(4,4,5,5- Tetramethyl-1,3,2-Dioxaborolan-2-Yl)phenyl)ethyl Nicotinate Length = 237 Back     alignment and structure
>pdb|1OWE|A Chain A, Substituted 2-Naphthamidine Inhibitors Of Urokinase Length = 245 Back     alignment and structure
>pdb|1Y59|T Chain T, Dianhydrosugar-Based Benzamidine, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Mutant Length = 223 Back     alignment and structure
>pdb|1GI8|B Chain B, A Novel Serine Protease Inhibition Motif Involving A Multi- Centered Short Hydrogen Bonding Network At The Active Site Length = 245 Back     alignment and structure
>pdb|1GJ7|B Chain B, Engineering Inhibitors Highly Selective For The S1 Sites Of Ser190 Trypsin-Like Serine Protease Drug Targets Length = 253 Back     alignment and structure
>pdb|1O5A|B Chain B, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (Ala190 Upa) Length = 253 Back     alignment and structure
>pdb|1SC8|U Chain U, Urokinase Plasminogen Activator B-Chain-J435 Complex Length = 262 Back     alignment and structure
>pdb|3MWI|U Chain U, The Complex Crystal Structure Of Urokianse And 5-Nitro-1h-Indole-2- Amidine Length = 246 Back     alignment and structure
>pdb|1EJN|A Chain A, Urokinase Plasminogen Activator B-Chain Inhibitor Complex Length = 253 Back     alignment and structure
>pdb|1W0Z|U Chain U, Urokinase Type Plasminogen Activator Length = 247 Back     alignment and structure
>pdb|1J15|A Chain A, Benzamidine In Complex With Rat Trypsin Mutant X99175190RT Length = 223 Back     alignment and structure
>pdb|2RA3|A Chain A, Human Cationic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (bpti) Length = 224 Back     alignment and structure
>pdb|1FV9|A Chain A, Crystal Structure Of Human Microurokinase In Complex With 2- Amino-5-Hydroxy-Benzimidazole Length = 245 Back     alignment and structure
>pdb|2NWN|A Chain A, New Pharmacophore For Serine Protease Inhibition Revealed By Crystal Structure Of Human Urokinase-Type Plasminogen Activator Complexed With A Cyclic Peptidyl Inhibitor, Upain-1 Length = 253 Back     alignment and structure
>pdb|2O8U|A Chain A, Crystal Structure And Binding Epitopes Of Urokinase-Type Plasminogen Activator (C122aN145QS195A) IN COMPLEX WITH Inhibitors Length = 253 Back     alignment and structure
>pdb|4FU7|A Chain A, Crystal Structure Of The Urokinase Length = 246 Back     alignment and structure
>pdb|1TRN|A Chain A, Crystal Structure Of Human Trypsin 1: Unexpected Phosphorylation Of Tyrosine 151 Length = 224 Back     alignment and structure
>pdb|1QL9|A Chain A, Factor Xa Specific Inhibitor In Complex With Rat Trypsin Mutant X99rt Length = 223 Back     alignment and structure
>pdb|2R9P|A Chain A, Human Mesotrypsin Complexed With Bovine Pancreatic Trypsin Inhibitor(Bpti) Length = 224 Back     alignment and structure
>pdb|4DG4|A Chain A, Human Mesotrypsin-S39y Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 224 Back     alignment and structure
>pdb|1Z8G|A Chain A, Crystal Structure Of The Extracellular Region Of The Transmembrane Serine Protease Hepsin With Covalently Bound Preferred Substrate Length = 372 Back     alignment and structure
>pdb|1O5E|H Chain H, Dissecting And Designing Inhibitor Selectivity Determinants At The S1 Site Using An Artificial Ala190 Protease (ala190 Upa) Length = 255 Back     alignment and structure
>pdb|1TAB|E Chain E, Structure Of The Trypsin-Binding Domain Of Bowman-Birk Type Protease Inhibitor And Its Interaction With Trypsin Length = 223 Back     alignment and structure
>pdb|1TAW|A Chain A, Bovine Trypsin Complexed To Appi Length = 223 Back     alignment and structure
>pdb|3QK1|A Chain A, Crystal Structure Of Enterokinase-Like Trypsin Variant Length = 229 Back     alignment and structure
>pdb|3T2N|A Chain A, Human Hepsin Protease In Complex With The Fab Fragment Of An Inhibitory Antibody Length = 372 Back     alignment and structure
>pdb|3OTJ|E Chain E, A Crystal Structure Of Trypsin Complexed With Bpti (Bovine Pancreatic Trypsin Inhibitor) By X-RayNEUTRON JOINT REFINEMENT Length = 223 Back     alignment and structure
>pdb|1H4W|A Chain A, Structure Of Human Trypsin Iv (Brain Trypsin) Length = 224 Back     alignment and structure
>pdb|1OPH|B Chain B, Non-Covalent Complex Between Alpha-1-Pi-Pittsburgh And S195a Trypsin Length = 243 Back     alignment and structure
>pdb|1F0T|A Chain A, Bovine Trypsin Complexed With Rpr131247 Length = 243 Back     alignment and structure
>pdb|1ZZZ|A Chain A, Trypsin Inhibitors With Rigid Tripeptidyl Aldehydes Length = 237 Back     alignment and structure
>pdb|5PTP|A Chain A, Structure Of Hydrolase (Serine Proteinase) Length = 223 Back     alignment and structure
>pdb|1A0J|A Chain A, Crystal Structure Of A Non-Psychrophilic Trypsin From A Cold-Adapted Fish Species. Length = 223 Back     alignment and structure
>pdb|3VEQ|B Chain B, A Binary Complex Betwwen Bovine Pancreatic Trypsin And A Engineered Mutant Trypsin Inhibitor Length = 223 Back     alignment and structure
>pdb|1G3B|A Chain A, Bovine Beta-Trypsin Bound To Meta-Amidino Schiff Base Magnesium(Ii) Chelate Length = 228 Back     alignment and structure
>pdb|1TGS|Z Chain Z, Three-Dimensional Structure Of The Complex Between Pancreatic Secretory Inhibitor (Kazal Type) And Trypsinogen At 1.8 Angstroms Resolution. Structure Solution, Crystallographic Refinement And Preliminary Structural Interpretation Length = 229 Back     alignment and structure
>pdb|1MCT|A Chain A, The Refined 1.6 Angstroms Resolution Crystal Structure Of The Complex Formed Between Porcine Beta-trypsin And Mcti-a, A Trypsin Inhibitor Of Squash Family Length = 223 Back     alignment and structure
>pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|2A31|A Chain A, Trypsin In Complex With Borate Length = 223 Back     alignment and structure
>pdb|1CO7|E Chain E, R117h Mutant Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 245 Back     alignment and structure
>pdb|4AN7|A Chain A, Kunitz Type Trypsin Inhibitor Complex With Porcine Trypsin Length = 231 Back     alignment and structure
>pdb|1V2K|T Chain T, Factor Xa Specific Inhibitor In Complex With Bovine Trypsin Variant X(Triple.Glu)bt.D2 Length = 223 Back     alignment and structure
>pdb|4B2A|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tga) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1F5R|A Chain A, Rat Trypsinogen Mutant Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 231 Back     alignment and structure
>pdb|1NTP|A Chain A, Use Of The Neutron Diffraction HD EXCHANGE TECHNIQUE TO Determine The Conformational Dynamics Of Trypsin Length = 223 Back     alignment and structure
>pdb|3PWB|A Chain A, Bovine Trypsin Variant X(Tripleglu217ile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1AMH|A Chain A, Uncomplexed Rat Trypsin Mutant With Asp 189 Replaced With Ser (D189s) Length = 223 Back     alignment and structure
>pdb|2FI4|E Chain E, Crystal Structure Of A Bpti Variant (Cys14->ser) In Complex With Trypsin Length = 223 Back     alignment and structure
>pdb|3TGI|E Chain E, Wild-Type Rat Anionic Trypsin Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 223 Back     alignment and structure
>pdb|4B1T|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala ( Ta) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1K9O|E Chain E, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 223 Back     alignment and structure
>pdb|3TGJ|E Chain E, S195a Trypsinogen Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 233 Back     alignment and structure
>pdb|1FY8|E Chain E, Crystal Structure Of The Deltaile16val17 Rat Anionic Trypsinogen-Bpti Complex Length = 231 Back     alignment and structure
>pdb|3TGK|E Chain E, Trypsinogen Mutant D194n And Deletion Of Ile 16-Val 17 Complexed With Bovine Pancreatic Trypsin Inhibitor (Bpti) Length = 231 Back     alignment and structure
>pdb|1V2N|T Chain T, Potent Factor Xa Inhibitor In Complex With Bovine Trypsin Variant X(99175190)BT Length = 223 Back     alignment and structure
>pdb|1F7Z|A Chain A, Rat Trypsinogen K15a Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 233 Back     alignment and structure
>pdb|3MYW|A Chain A, The Bowman-Birk Type Inhibitor From Mung Bean In Ternary Complex With Porcine Trypsin Length = 223 Back     alignment and structure
>pdb|1DPO|A Chain A, Structure Of Rat Trypsin Length = 223 Back     alignment and structure
>pdb|3PMJ|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2D8W|A Chain A, Structure Of Hyper-Vil-Trypsin Length = 223 Back     alignment and structure
>pdb|1SLW|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Nickel- Bound Length = 223 Back     alignment and structure
>pdb|4B2B|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tgpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1AN1|E Chain E, Leech-Derived Tryptase InhibitorTRYPSIN COMPLEX Length = 223 Back     alignment and structure
>pdb|1AND|A Chain A, Anionic Trypsin Mutant With Arg 96 Replaced By His Length = 223 Back     alignment and structure
>pdb|1EAI|A Chain A, Complex Of Ascaris Chymotrpsin/elastase Inhibitor With Porcine Elastase Length = 240 Back     alignment and structure
>pdb|3PLK|A Chain A, Bovine Trypsin Variant X(Tripleile227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1SLX|B Chain B, Rat Anionic N143h, E151h Trypsin Complexed To A86h Ecotin; Zinc-Bound Length = 223 Back     alignment and structure
>pdb|1ANB|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Glu Length = 223 Back     alignment and structure
>pdb|3UQV|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNS|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1ANC|A Chain A, Anionic Trypsin Mutant With Ser 214 Replaced By Lys Length = 223 Back     alignment and structure
>pdb|1TWX|B Chain B, Crystal Structure Of The Thrombin Mutant D221aD222K Length = 259 Back     alignment and structure
>pdb|4B2C|A Chain A, Structure Of The Factor Xa-Like Trypsin Variant Triple-Ala (Tpa) In Complex With Eglin C Length = 223 Back     alignment and structure
>pdb|1THP|B Chain B, Structure Of Human Alpha-Thrombin Y225p Mutant Bound To D-Phe-Pro-Arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1TRM|A Chain A, The Three-Dimensional Structure Of Asn102 Mutant Of Trypsin. Role Of Asp102 In Serine Protease Catalysis Length = 223 Back     alignment and structure
>pdb|1EZS|C Chain C, Crystal Structure Of Ecotin Mutant M84r, W67a, G68a, Y69a, D70a Bound To Rat Anionic Trypsin Ii Length = 223 Back     alignment and structure
>pdb|1BDA|A Chain A, Catalytic Domain Of Human Single Chain Tissue Plasminogen Activator In Complex With Dansyl-Egr-Cmk (Dansyl-Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|1A5I|A Chain A, Catalytic Domain Of Vampire Bat (Desmodus Rotundus) Saliva Plasminogen Activator In Complex With Egr-Cmk (Glu-Gly-Arg Chloromethyl Ketone) Length = 265 Back     alignment and structure
>pdb|2BM2|A Chain A, Human Beta-Ii Tryptase In Complex With 4-(3-Aminomethyl- Phenyl)-Piperidin-1-Yl-(5-Phenethyl- Pyridin-3-Yl)- Methanone Length = 245 Back     alignment and structure
>pdb|1RTF|B Chain B, Complex Of Benzamidine With The Catalytic Domain Of Human Two Chain Tissue Plasminogen Activator [(Tc)-T-Pa] Length = 252 Back     alignment and structure
>pdb|2ZEB|A Chain A, Potent, Nonpeptide Inhibitors Of Human Mast Cell Tryptase Length = 243 Back     alignment and structure
>pdb|1A0L|A Chain A, Human Beta-Tryptase: A Ring-Like Tetramer With Active Sites Facing A Central Pore Length = 244 Back     alignment and structure
>pdb|2F9N|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant K192qD216G IN COMPLEX WITH LEUPEPTIN Length = 245 Back     alignment and structure
>pdb|1EAW|A Chain A, Crystal Structure Of The Mtsp1 (Matriptase)-Bpti (Aprotinin) Complex Length = 241 Back     alignment and structure
>pdb|1V2U|T Chain T, Benzamidine In Complex With Bovine Trypsin Varinat X(Ssai) Bt.D1 Length = 223 Back     alignment and structure
>pdb|3UWI|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|3UNQ|A Chain A, Bovine Trypsin Variant X(Triplephe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|2F9O|A Chain A, Crystal Structure Of The Recombinant Human Alpha I Tryptase Mutant D216g Length = 245 Back     alignment and structure
>pdb|1BRB|E Chain E, Crystal Structures Of Rat Anionic Trypsin Complexed With The Protein Inhibitors Appi And Bpti Length = 223 Back     alignment and structure
>pdb|3P8G|A Chain A, Crystal Structure Of Mt-Sp1 In Complex With Benzamidine Length = 241 Back     alignment and structure
>pdb|2EST|E Chain E, Crystallographic Study Of The Binding Of A Trifluoroacetyl Dipeptide Anilide Inhibitor With Elastase Length = 240 Back     alignment and structure
>pdb|1V2S|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssfi.Glu)bt.D1 Length = 223 Back     alignment and structure
>pdb|2WPH|S Chain S, Factor Ixa Superactive Triple Mutant Length = 235 Back     alignment and structure
>pdb|1HAX|B Chain B, Snapshots Of Serine Protease Catalysis: (A) Acyl-Enzyme Intermediate Between Porcine Pancreatic Elastase And Human Beta-Casomorphin-7 At Ph 5 Length = 240 Back     alignment and structure
>pdb|1V2O|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Ssyi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1V2J|T Chain T, Benzamidine In Complex With Bovine Trypsin Variant X(Ssri) Bt.C1 Length = 223 Back     alignment and structure
>pdb|1LTO|A Chain A, Human Alpha1-Tryptase Length = 245 Back     alignment and structure
>pdb|1QRZ|A Chain A, Catalytic Domain Of Plasminogen Length = 246 Back     alignment and structure
>pdb|1YM0|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component B: A Novel, Glycosylated Two-chained Trypsin Length = 238 Back     alignment and structure
>pdb|2WPM|S Chain S, Factor Ixa Superactive Mutant, Egr-Cmk Inhibited Length = 235 Back     alignment and structure
>pdb|1V2Q|T Chain T, Trypsin Inhibitor In Complex With Bovine Trypsin Variant X(Sswi)bt.B4 Length = 223 Back     alignment and structure
>pdb|1H8I|H Chain H, X-Ray Crystal Structure Of Human Alpha-Thrombin With A Tripeptide Phosphonate Inhibitor Length = 253 Back     alignment and structure
>pdb|3GIC|B Chain B, Structure Of Thrombin Mutant Delta(146-149e) In The Free Form Length = 250 Back     alignment and structure
>pdb|1UTJ|A Chain A, Trypsin Specificity As Elucidated By Lie Calculations, X-Ray Structures And Association Constant Measurements Length = 242 Back     alignment and structure
>pdb|2WPI|S Chain S, Factor Ixa Superactive Double Mutant Length = 235 Back     alignment and structure
>pdb|1BZX|E Chain E, The Crystal Structure Of Anionic Salmon Trypsin In Complex With Bovine Pancreatic Trypsin Inhibitor Length = 222 Back     alignment and structure
>pdb|1L4Z|A Chain A, X-Ray Crystal Structure Of The Complex Of Microplasminogen With Alpha Domain Of Streptokinase In The Presence Cadmium Ions Length = 248 Back     alignment and structure
>pdb|1HJ8|A Chain A, 1.00 Aa Trypsin From Atlantic Salmon Length = 222 Back     alignment and structure
>pdb|1L4D|A Chain A, Crystal Structure Of Microplasminogen-streptokinase Alpha Domain Complex Length = 249 Back     alignment and structure
>pdb|3V0X|A Chain A, Bovine Trypsin Variant X(Tripleglu217phe227) In Complex With Small Molecule Inhibitor Length = 223 Back     alignment and structure
>pdb|1BIT|A Chain A, The Crystal Structure Of Anionic Salmon Trypsin In A Second Crystal Form Length = 237 Back     alignment and structure
>pdb|1DDJ|A Chain A, Crystal Structure Of Human Plasminogen Catalytic Domain Length = 247 Back     alignment and structure
>pdb|3UIR|A Chain A, Crystal Structure Of The Plasmin-Textilinin-1 Complex Length = 247 Back     alignment and structure
>pdb|1BUI|B Chain B, Structure Of The Ternary Microplasmin-Staphylokinase-Microplasmin Complex: A Proteinase-Cofactor-Substrate Complex In Action Length = 250 Back     alignment and structure
>pdb|3K65|B Chain B, Crystal Structure Of Prethombin-2FRAGMENT-2 Complex Length = 308 Back     alignment and structure
>pdb|1BML|A Chain A, Complex Of The Catalytic Domain Of Human Plasmin And Streptokinase Length = 250 Back     alignment and structure
>pdb|3JZ1|B Chain B, Crystal Structure Of Human Thrombin Mutant N143p In E:na+ Form Length = 259 Back     alignment and structure
>pdb|1EKB|B Chain B, The Serine Protease Domain Of Enteropeptidase Bound To Inhibitor Val- Asp-asp-asp-asp-lys-chloromethane Length = 235 Back     alignment and structure
>pdb|3SQE|E Chain E, Crystal Structure Of Prethrombin-2 Mutant S195a In The Alternative Form Length = 290 Back     alignment and structure
>pdb|1JOU|B Chain B, Crystal Structure Of Native S195a Thrombin With An Unoccupied Active Site Length = 259 Back     alignment and structure
>pdb|1Z8I|B Chain B, Crystal Structure Of The Thrombin Mutant G193a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|2OD3|B Chain B, Human Thrombin Chimera With Human Residues 184a, 186, 186a, 186b, 186c And 222 Replaced By Murine Thrombin Equivalents Length = 259 Back     alignment and structure
>pdb|2BVR|H Chain H, Human Thrombin Complexed With Fragment-based Small Molecules Occupying The S1 Pocket Length = 252 Back     alignment and structure
>pdb|1DM4|B Chain B, Ser195ala Mutant Of Human Thrombin Complexed With Fibrinopeptide A (7- 16) Length = 260 Back     alignment and structure
>pdb|1Z8J|B Chain B, Crystal Structure Of The Thrombin Mutant G193p Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1JWT|A Chain A, Crystal Structure Of Thrombin In Complex With A Novel Bicyclic Lactam Inhibitor Length = 305 Back     alignment and structure
>pdb|1MBQ|A Chain A, Anionic Trypsin From Pacific Chum Salmon Length = 220 Back     alignment and structure
>pdb|1HAG|E Chain E, The Isomorphous Structures Of Prethrombin2, Hirugen-And Ppack- Thrombin: Changes Accompanying Activation And Exosite Binding To Thrombin Length = 295 Back     alignment and structure
>pdb|1BTH|H Chain H, Structure Of Thrombin Complexed With Bovine Pancreatic Trypsin Inhibitor Length = 259 Back     alignment and structure
>pdb|1ABI|H Chain H, Structure Of The Hirulog 3-Thrombin Complex And Nature Of The S' Subsites Of Substrates And Inhibitors Length = 259 Back     alignment and structure
>pdb|1B7X|B Chain B, Structure Of Human Alpha-Thrombin Y225i Mutant Bound To D- Phe-Pro-Arg-Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1VZQ|H Chain H, Complex Of Thrombin With Designed Inhibitor 7165 Length = 250 Back     alignment and structure
>pdb|1NU9|A Chain A, Staphylocoagulase-prethrombin-2 Complex Length = 291 Back     alignment and structure
>pdb|2BDY|A Chain A, Thrombin In Complex With Inhibitor Length = 289 Back     alignment and structure
>pdb|3BN9|B Chain B, Crystal Structure Of Mt-Sp1 In Complex With Fab Inhibitor E2 Length = 241 Back     alignment and structure
>pdb|1RJX|B Chain B, Human Plasminogen Catalytic Domain, K698m Mutant Length = 247 Back     alignment and structure
>pdb|2TBS|A Chain A, Cold-Adaption Of Enzymes: Structural Comparison Between Salmon And Bovine Trypsins Length = 222 Back     alignment and structure
>pdb|3NXP|A Chain A, Crystal Structure Of Human Prethrombin-1 Length = 424 Back     alignment and structure
>pdb|1PFX|C Chain C, Porcine Factor Ixa Length = 235 Back     alignment and structure
>pdb|2ZPQ|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 1 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|2THF|B Chain B, Structure Of Human Alpha-thrombin Y225f Mutant Bound To D-phe-pro-arg- Chloromethylketone Length = 259 Back     alignment and structure
>pdb|1RFN|A Chain A, Human Coagulation Factor Ixa In Complex With P-Amino Benzamidine Length = 235 Back     alignment and structure
>pdb|3KCG|H Chain H, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 235 Back     alignment and structure
>pdb|1AUT|C Chain C, Human Activated Protein C Length = 250 Back     alignment and structure
>pdb|1WBG|B Chain B, Active Site Thrombin Inhibitors Length = 259 Back     alignment and structure
>pdb|1D9I|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 288 Back     alignment and structure
>pdb|3F6U|H Chain H, Crystal Structure Of Human Activated Protein C (Apc) Complexed With Ppack Length = 240 Back     alignment and structure
>pdb|1RD3|B Chain B, 2.5a Structure Of Anticoagulant Thrombin Variant E217k Length = 259 Back     alignment and structure
>pdb|1SFQ|B Chain B, Fast Form Of Thrombin Mutant R(77a)a Bound To Ppack Length = 259 Back     alignment and structure
>pdb|1FIZ|A Chain A, Three Dimensional Structure Of Beta-Acrosin From Boar Spermatozoa Length = 263 Back     alignment and structure
>pdb|1D6W|A Chain A, Structure Of Thrombin Complexed With Selective Non-Electrophilic Inhibitors Having Cyclohexyl Moieties At P1 Length = 287 Back     alignment and structure
>pdb|1EOJ|A Chain A, Design Of P1' And P3' Residues Of Trivalent Thrombin Inhibitors And Their Crystal Structures Length = 289 Back     alignment and structure
>pdb|1HJ9|A Chain A, Atomic Resolution Structures Of Trypsin Provide Insight Into Structural Radiation Damage Length = 223 Back     alignment and structure
>pdb|1NM6|A Chain A, Thrombin In Complex With Selective Macrocyclic Inhibitor At 1.8a Length = 287 Back     alignment and structure
>pdb|2ZPS|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 3 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1GJ5|H Chain H, Selectivity At S1, H2o Displacement, Upa, Tpa, Ser190ALA190 PROTEASE, Structure-Based Drug Design Length = 258 Back     alignment and structure
>pdb|1QUR|H Chain H, Human Alpha-Thrombin In Complex With Bivalent, Benzamidine-Based Synthetic Inhibitor Length = 257 Back     alignment and structure
>pdb|1H8D|H Chain H, X-Ray Structure Of The Human Alpha-Thrombin Complex With A Tripeptide Phosphonate Inhibitor Length = 260 Back     alignment and structure
>pdb|1DX5|M Chain M, Crystal Structure Of The Thrombin-Thrombomodulin Complex Length = 259 Back     alignment and structure
>pdb|1MZA|A Chain A, Crystal Structure Of Human Pro-Granzyme K Length = 240 Back     alignment and structure
>pdb|2EEK|A Chain A, Crystal Structure Of Atlantic Cod Trypsin Complexed With Benzamidine Length = 220 Back     alignment and structure
>pdb|4DUR|A Chain A, The X-Ray Crystal Structure Of Full-Length Type Ii Human Plasminogen Length = 791 Back     alignment and structure
>pdb|2GP9|B Chain B, Crystal Structure Of The Slow Form Of Thrombin In A Self- Inhibited Conformation Length = 259 Back     alignment and structure
>pdb|1BRU|P Chain P, Structure Of Porcine Pancreatic Elastase Complexed With The Elastase Inhibitor Gr143783 Length = 241 Back     alignment and structure
>pdb|1MH0|A Chain A, Crystal Structure Of The Anticoagulant Slow Form Of Thrombin Length = 287 Back     alignment and structure
>pdb|4H4F|A Chain A, Crystal Structure Of Human Chymotrypsin C (ctrc) Bound To Inhibitor Eglin C From Hirudo Medicinalis Length = 249 Back     alignment and structure
>pdb|1MKW|K Chain K, The Co-Crystal Structure Of Unliganded Bovine Alpha- Thrombin And Prethrombin-2: Movement Of The Yppw Segment And Active Site Residues Upon Ligand Binding Length = 308 Back     alignment and structure
>pdb|2A0Q|B Chain B, Structure Of Thrombin In 400 Mm Potassium Chloride Length = 257 Back     alignment and structure
>pdb|2ZPR|A Chain A, Crystal Structure Of Anionic Trypsin Isoform 2 From Chum Salmon Length = 222 Back     alignment and structure
>pdb|1BBR|K Chain K, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3GOV|B Chain B, Crystal Structure Of The Catalytic Region Of Human Masp-1 Length = 251 Back     alignment and structure
>pdb|2PGB|B Chain B, Inhibitor-Free Human Thrombin Mutant C191a-C220a Length = 259 Back     alignment and structure
>pdb|4IGD|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-1 Length = 406 Back     alignment and structure
>pdb|1L2E|A Chain A, Human Kallikrein 6 (Hk6) Active Form With Benzamidine Inhibitor Length = 223 Back     alignment and structure
>pdb|1ID5|H Chain H, Crystal Structure Of Bovine Thrombin Complex With Protease Inhibitor Ecotin Length = 256 Back     alignment and structure
>pdb|1VR1|H Chain H, Specifity For Plasminogen Activator Inhibitor-1 Length = 261 Back     alignment and structure
>pdb|1ELT|A Chain A, Structure Of Native Pancreatic Elastase From North Atlantic Salmon At 1.61 Angstroms Resolution Length = 236 Back     alignment and structure
>pdb|1DAN|H Chain H, Complex Of Active Site Inhibited Human Blood Coagulation Factor Viia With Human Recombinant Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1NPM|A Chain A, Neuropsin, A Serine Protease Expressed In The Limbic System Of Mouse Brain Length = 225 Back     alignment and structure
>pdb|1FIW|A Chain A, Three-Dimensional Structure Of Beta-Acrosin From Ram Spermatozoa Length = 290 Back     alignment and structure
>pdb|1GVL|A Chain A, Human Prokallikrein 6 (Hk6) PROZYME PROPROTEASE M Proneurosin Length = 223 Back     alignment and structure
>pdb|4D8N|A Chain A, Human Kallikrein 6 Inhibitors With A Para-Amidobenzylanmine P1 Group Carry A High Binding Efficiency Length = 223 Back     alignment and structure
>pdb|2TLD|E Chain E, Crystal Structure Of An Engineered Subtilisin Inhibitor Complexed With Bovine Trypsin Length = 220 Back     alignment and structure
>pdb|3ELA|H Chain H, Crystal Structure Of Active Site Inhibited Coagulation Factor Viia Mutant In Complex With Soluble Tissue Factor Length = 254 Back     alignment and structure
>pdb|1PYT|D Chain D, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 251 Back     alignment and structure
>pdb|2OQ5|A Chain A, Crystal Structure Of Desc1, A New Member Of The Type Ii Transmembrane Serine Proteinases Family Length = 232 Back     alignment and structure
>pdb|4DGJ|A Chain A, Structure Of A Human Enteropeptidase Light Chain Variant Length = 235 Back     alignment and structure
>pdb|3EE0|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF HUMAN Thrombin (Space Group P2(1)2(1)2(1)) Length = 259 Back     alignment and structure
>pdb|2PUX|B Chain B, Crystal Structure Of Murine Thrombin In Complex With The Extracellular Fragment Of Murine Par3 Length = 258 Back     alignment and structure
>pdb|2OCV|B Chain B, Structural Basis Of Na+ Activation Mimicry In Murine Thrombin Length = 259 Back     alignment and structure
>pdb|2CGA|A Chain A, Bovine Chymotrypsinogen A. X-Ray Crystal Structure Analysis And Refinement Of A New Crystal Form At 1.8 Angstroms Resolution Length = 245 Back     alignment and structure
>pdb|1DLK|B Chain B, Crystal Structure Analysis Of Delta-Chymotrypsin Bound To A Peptidyl Chloromethyl Ketone Inhibitor Length = 230 Back     alignment and structure
>pdb|1TQ0|B Chain B, Crystal Structure Of The Potent Anticoagulant Thrombin Mutant W215aE217A IN FREE FORM Length = 257 Back     alignment and structure
>pdb|3BSQ|A Chain A, Crystal Structure Of Human Kallikrein 7 Produced As A Secretion Protein In E.Coli Length = 227 Back     alignment and structure
>pdb|2QXG|A Chain A, Crystal Structure Of Human Kallikrein 7 In Complex With Ala- Ala-phe-chloromethylketone Length = 224 Back     alignment and structure
>pdb|2ZGC|A Chain A, Crystal Structure Of Active Human Granzyme M Length = 240 Back     alignment and structure
>pdb|1DST|A Chain A, Mutant Of Factor D With Enhanced Catalytic Activity Length = 228 Back     alignment and structure
>pdb|2ZGJ|A Chain A, Crystal Structure Of D86n-gzmm Complexed With Its Optimal Synthesized Substrate Length = 240 Back     alignment and structure
>pdb|3EDX|B Chain B, Crystal Structure Of The W215aE217A MUTANT OF MURINE THROMBIN Length = 258 Back     alignment and structure
>pdb|2PSX|A Chain A, Crystal Structure Of Human Kallikrein 5 In Complex With Leupeptin Length = 227 Back     alignment and structure
>pdb|1SGF|G Chain G, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 237 Back     alignment and structure
>pdb|4D9Q|A Chain A, Inhibiting Alternative Pathway Complement Activation By Targeting The Exosite On Factor D Length = 228 Back     alignment and structure
>pdb|2XWA|A Chain A, Crystal Structure Of Complement Factor D Mutant R202a Length = 228 Back     alignment and structure
>pdb|1FDP|A Chain A, Proenzyme Of Human Complement Factor D, Recombinant Profactor D Length = 235 Back     alignment and structure
>pdb|2XW9|A Chain A, Crystal Structure Of Complement Factor D Mutant S183a Length = 228 Back     alignment and structure
>pdb|1DSU|A Chain A, Human Factor D, Complement Activating Enzyme Length = 228 Back     alignment and structure
>pdb|1SGF|A Chain A, Crystal Structure Of 7s Ngf: A Complex Of Nerve Growth Factor With Four Binding Proteins (serine Proteinases) Length = 240 Back     alignment and structure
>pdb|2ZCH|P Chain P, Crystal Structure Of Human Prostate Specific Antigen Complexed With An Activating Antibody Length = 237 Back     alignment and structure
>pdb|1FI8|A Chain A, Rat Granzyme B [n66q] Complexed To Ecotin [81-84 Iepd] Length = 228 Back     alignment and structure
>pdb|1M9U|A Chain A, Crystal Structure Of Earthworm Fibrinolytic Enzyme Component A From Eisenia Fetida Length = 241 Back     alignment and structure
>pdb|1EQ9|A Chain A, Crystal Structure Of Fire Ant Chymotrypsin Complexed To Pmsf Length = 222 Back     alignment and structure
>pdb|2B9L|A Chain A, Crystal Structure Of Prophenoloxidase Activating Factor-Ii From The Beetle Holotrichia Diomphalia Length = 394 Back     alignment and structure
>pdb|1SPJ|A Chain A, Structure Of Mature Human Tissue Kallikrein (Human Kallikrein 1 Or Klk1) At 1.70 Angstrom Resolution With Vacant Active Site Length = 238 Back     alignment and structure
>pdb|2OLG|A Chain A, Crystal Structure Of The Serine Protease Domain Of Prophenoloxidase Activating Factor-I In A Zymogen Form Length = 278 Back     alignment and structure
>pdb|3RP2|A Chain A, The Structure Of Rat Mast Cell Protease Ii At 1.9-Angstroms Resolution Length = 224 Back     alignment and structure
>pdb|3FZZ|A Chain A, Structure Of Grc Length = 227 Back     alignment and structure
>pdb|3G01|A Chain A, Structure Of Grc Mutant E192rE193G Length = 227 Back     alignment and structure
>pdb|2XXL|A Chain A, Crystal Structure Of Drosophila Grass Clip Serine Protease Of Toll Pathway Length = 408 Back     alignment and structure
>pdb|2XRC|A Chain A, Human Complement Factor I Length = 565 Back     alignment and structure
>pdb|4GAW|A Chain A, Crystal Structure Of Active Human Granzyme H Length = 226 Back     alignment and structure
>pdb|2AIP|A Chain A, Crystal Structure Of Native Protein C Activator From The Venom Of Copperhead Snake Agkistrodon Contortrix Contortrix Length = 231 Back     alignment and structure
>pdb|1TON|A Chain A, Rat Submaxillary Gland Serine Protease, Tonin. Structure Solution And Refinement At 1.8 Angstroms Resolution Length = 235 Back     alignment and structure
>pdb|3TJU|A Chain A, Crystal Structure Of Human Granzyme H With An Inhibitor Length = 226 Back     alignment and structure
>pdb|1BHX|B Chain B, X-Ray Structure Of The Complex Of Human Alpha Thrombin With The Inhibitor Sdz 229-357 Length = 147 Back     alignment and structure
>pdb|1KLT|A Chain A, Crystal Structure Of Pmsf-Treated Human Chymase At 1.9 Angstroms Resolution Length = 226 Back     alignment and structure
>pdb|1PJP|A Chain A, The 2.2 A Crystal Structure Of Human Chymase In Complex With Succinyl- Ala-Ala-Pro-Phe-Chloromethylketone Length = 226 Back     alignment and structure
>pdb|4AFQ|A Chain A, Human Chymase - Fynomer Complex Length = 226 Back     alignment and structure
>pdb|1NN6|A Chain A, Human Pro-Chymase Length = 228 Back     alignment and structure
>pdb|1SI5|H Chain H, Protease-Like Domain From 2-Chain Hepatocyte Growth Factor Length = 240 Back     alignment and structure
>pdb|1SHY|A Chain A, The Crystal Structure Of Hgf Beta-Chain In Complex With The Sema Domain Of The Met Receptor Length = 234 Back     alignment and structure
>pdb|3N7O|A Chain A, X-Ray Structure Of Human Chymase In Complex With Small Molecule Inhibitor Length = 226 Back     alignment and structure
>pdb|1XVM|A Chain A, Trypsin From Fusarium Oxysporum- Room Temperature To Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1GDU|A Chain A, Fusarium Oxysporum Trypsin At Atomic Resolution Length = 224 Back     alignment and structure
>pdb|1PPZ|A Chain A, Trypsin Complexes At Atomic And Ultra-High Resolution Length = 224 Back     alignment and structure
>pdb|1ORF|A Chain A, The Oligomeric Structure Of Human Granzyme A Reveals The Molecular Determinants Of Substrate Specificity Length = 234 Back     alignment and structure
>pdb|1OP8|A Chain A, Crystal Structure Of Human Granzyme A Length = 234 Back     alignment and structure
>pdb|3I78|A Chain A, 3599170186220-Loops Of Fxa In Sgt Length = 229 Back     alignment and structure
>pdb|1EUF|A Chain A, Bovine Duodenase(New Serine Protease), Crystal Structure Length = 227 Back     alignment and structure
>pdb|1FUJ|A Chain A, Pr3 (Myeloblastin) Length = 221 Back     alignment and structure
>pdb|1MD8|A Chain A, Monomeric Structure Of The Active Catalytic Domain Of Complement Protease C1r Length = 329 Back     alignment and structure
>pdb|2QY0|B Chain B, Active Dimeric Structure Of The Catalytic Domain Of C1r Reveals Enzyme-product Like Contacts Length = 242 Back     alignment and structure
>pdb|1MD7|A Chain A, Monomeric Structure Of The Zymogen Of Complement Protease C1r Length = 328 Back     alignment and structure
>pdb|1GPZ|A Chain A, The Crystal Structure Of The Zymogen Catalytic Domain Of Complement Protease C1r Length = 399 Back     alignment and structure
>pdb|3BEU|A Chain A, Na+-Dependent Allostery Mediates Coagulation Factor Protease Active Site Selectivity Length = 224 Back     alignment and structure
>pdb|1HYL|A Chain A, The 1.8 A Structure Of Collagenase From Hypoderma Lineatum Length = 230 Back     alignment and structure
>pdb|1BBR|H Chain H, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 150 Back     alignment and structure
>pdb|1AO5|A Chain A, Mouse Glandular Kallikrein-13 (Prorenin Converting Enzyme) Length = 237 Back     alignment and structure
>pdb|1PYT|C Chain C, Ternary Complex Of Procarboxypeptidase A, Proproteinase E, And Chymotrypsinogen C Length = 253 Back     alignment and structure
>pdb|1BQY|A Chain A, Plasminogen Activator (tsv-pa) From Snake Venom Length = 234 Back     alignment and structure
>pdb|3I77|A Chain A, 3599170-Loops Of Fxa In Sgt Length = 230 Back     alignment and structure
>pdb|4GSO|A Chain A, Structure Of Jararacussin-I Length = 232 Back     alignment and structure
>pdb|3S9A|A Chain A, Russell's Viper Venom Serine Proteinase, Rvv-V (Closed-Form) Length = 234 Back     alignment and structure
>pdb|1FQ3|A Chain A, Crystal Structure Of Human Granzyme B Length = 227 Back     alignment and structure
>pdb|1IAU|A Chain A, Human Granzyme B In Complex With Ac-Iepd-Cho Length = 227 Back     alignment and structure
>pdb|1FON|A Chain A, Crystal Structure Of Bovine Procarboxypeptidase A-S6 Subunit Iii, A Highly Structured Truncated Zymogen E Length = 240 Back     alignment and structure
>pdb|1AKS|A Chain A, Crystal Structure Of The First Active Autolysate Form Of The Porcine Alpha Trypsin Length = 125 Back     alignment and structure
>pdb|1KYN|B Chain B, Cathepsin-G Length = 235 Back     alignment and structure
>pdb|1AU8|A Chain A, Human Cathepsin G Length = 224 Back     alignment and structure
>pdb|2FMJ|A Chain A, 220-Loop Mutant Of Streptomyces Griseus Trypsin Length = 222 Back     alignment and structure
>pdb|2ASU|B Chain B, Crystal Structure Of The Beta-Chain Of HgflMSP Length = 234 Back     alignment and structure
>pdb|1ELV|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Complement C1s Protease Length = 333 Back     alignment and structure
>pdb|1AZZ|A Chain A, Fiddler Crab Collagenase Complexed To Ecotin Length = 226 Back     alignment and structure
>pdb|3TVJ|B Chain B, Catalytic Fragment Of Masp-2 In Complex With Its Specific Inhibitor Developed By Directed Evolution On Sgci Scaffold Length = 242 Back     alignment and structure
>pdb|4FXG|H Chain H, Complement C4 In Complex With Masp-2 Length = 242 Back     alignment and structure
>pdb|1Q3X|A Chain A, Crystal Structure Of The Catalytic Region Of Human Masp-2 Length = 328 Back     alignment and structure
>pdb|1ZJK|A Chain A, Crystal Structure Of The Zymogen Catalytic Region Of Human Masp-2 Length = 403 Back     alignment and structure
>pdb|2RDL|A Chain A, Hamster Chymase 2 Length = 226 Back     alignment and structure
>pdb|1GVZ|A Chain A, Prostate Specific Antigen (Psa) From Stallion Seminal Plasma Length = 237 Back     alignment and structure
>pdb|4E7N|A Chain A, Crystal Structure Of Ahv_tl-I, A Glycosylated Snake-Venom Thrombin- Like Enzyme From Agkistrodon Halys Length = 238 Back     alignment and structure
>pdb|1MTN|B Chain B, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 131 Back     alignment and structure
>pdb|1FY1|A Chain A, [r23s,F25e]hbp, A Mutant Of Human Heparin Binding Protein (Cap37) Length = 225 Back     alignment and structure
>pdb|1OSS|A Chain A, T190p Streptomyces Griseus Trypsin In Complex With Benzamidine Length = 223 Back     alignment and structure
>pdb|1OS8|A Chain A, Recombinant Streptomyces Griseus Trypsin Length = 223 Back     alignment and structure
>pdb|1SGT|A Chain A, Refined Crystal Structure Of Streptomyces Griseus Trypsin At 1.7 Angstroms Resolution Length = 223 Back     alignment and structure
>pdb|2KAI|B Chain B, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 152 Back     alignment and structure
>pdb|1FY3|A Chain A, [g175q]hbp, A Mutant Of Human Heparin Binding Protein (cap37) Length = 225 Back     alignment and structure
>pdb|1A7S|A Chain A, Atomic Resolution Structure Of Hbp Length = 225 Back     alignment and structure
>pdb|3H7O|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-I1 (Smipp-S-I1) Length = 228 Back     alignment and structure
>pdb|1EPT|C Chain C, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 98 Back     alignment and structure
>pdb|1UHB|B Chain B, Crystal Structure Of Porcine Alpha Trypsin Bound With Auto Catalyticaly Produced Native Peptide At 2.15 A Resolution Length = 98 Back     alignment and structure
>pdb|1OP0|A Chain A, Crystal Structure Of Aav-sp-i, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1OP2|A Chain A, Crystal Structure Of Aav-Sp-Ii, A Glycosylated Snake Venom Serine Proteinase From Agkistrodon Acutus Length = 234 Back     alignment and structure
>pdb|1HNE|E Chain E, Structure Of Human Neutrophil Elastase In Complex With A Peptide Chloromethyl Ketone Inhibitor At 1.84-Angstroms Resolution Length = 218 Back     alignment and structure
>pdb|1PPG|E Chain E, The Refined 2.3 Angstroms Crystal Structure Of Human Leukocyte Elastase In A Complex With A Valine Chloromethyl Ketone Inhibitor Length = 218 Back     alignment and structure
>pdb|3S69|A Chain A, Crystal Structure Of Saxthrombin Length = 234 Back     alignment and structure
>pdb|2I6Q|A Chain A, Complement Component C2a Length = 517 Back     alignment and structure
>pdb|2RG3|A Chain A, Covalent Complex Structure Of Elastase Length = 218 Back     alignment and structure
>pdb|2ODP|A Chain A, Complement Component C2a, The Catalytic Fragment Of C3- And C5- Convertase Of Human Complement Length = 509 Back     alignment and structure
>pdb|2BDG|A Chain A, Human Kallikrein 4 Complex With Nickel And P-aminobenzamidine Length = 223 Back     alignment and structure
>pdb|2JET|B Chain B, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 128 Back     alignment and structure
>pdb|3H7T|A Chain A, Crystal Structure Of Scabies Mite Inactivated Protease Paralogue S-D1 (Smipp-S-D1) Length = 235 Back     alignment and structure
>pdb|1KDQ|A Chain A, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 131 Back     alignment and structure
>pdb|1B0F|A Chain A, Crystal Structure Of Human Neutrophil Elastase With Mdl 101, 146 Length = 218 Back     alignment and structure
>pdb|1PPF|E Chain E, X-Ray Crystal Structure Of The Complex Of Human Leukocyte Elastase (Pmn Elastase) And The Third Domain Of The Turkey Ovomucoid Inhibitor Length = 218 Back     alignment and structure
>pdb|2XWB|F Chain F, Crystal Structure Of Complement C3b In Complex With Factors B And D Length = 732 Back     alignment and structure
>pdb|1DLE|A Chain A, Factor B Serine Protease Domain Length = 298 Back     alignment and structure
>pdb|3HRZ|D Chain D, Cobra Venom Factor (Cvf) In Complex With Human Factor B Length = 741 Back     alignment and structure
>pdb|2OK5|A Chain A, Human Complement Factor B Length = 752 Back     alignment and structure
>pdb|2WIN|I Chain I, C3 Convertase (C3bbb) Stabilized By Scin Length = 507 Back     alignment and structure
>pdb|1RRK|A Chain A, Crystal Structure Analysis Of The Bb Segment Of Factor B Length = 497 Back     alignment and structure
>pdb|2HNT|E Chain E, Crystallographic Structure Of Human Gamma-Thrombin Length = 81 Back     alignment and structure
>pdb|2JET|C Chain C, Crystal Structure Of A Trypsin-Like Mutant (S189d, A226g) Chymotrypsin Length = 99 Back     alignment and structure
>pdb|1KDQ|B Chain B, Crystal Structure Analysis Of The Mutant S189d Rat Chymotrypsin Length = 99 Back     alignment and structure
>pdb|4F4O|C Chain C, Structure Of The Haptoglobin-Haemoglobin Complex Length = 347 Back     alignment and structure
>pdb|1MTN|C Chain C, Bovine Alpha-Chymotrypsin:bpti Crystallization Length = 97 Back     alignment and structure
>pdb|1AFQ|C Chain C, Crystal Structure Of Bovine Gamma-Chymotrypsin Complexed With A Synthetic Inhibitor Length = 96 Back     alignment and structure
>pdb|1EPT|B Chain B, Refined 1.8 Angstroms Resolution Crystal Structure Of Porcine Epsilon-Trypsin Length = 82 Back     alignment and structure
>pdb|2HNT|F Chain F, Crystallographic Structure Of Human Gamma-Thrombin Length = 105 Back     alignment and structure
>pdb|2HNT|C Chain C, Crystallographic Structure Of Human Gamma-Thrombin Length = 70 Back     alignment and structure
>pdb|3H5C|B Chain B, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 317 Back     alignment and structure
>pdb|3F1S|B Chain B, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 283 Back     alignment and structure
>pdb|2KAI|A Chain A, Refined 2.5 Angstroms X-Ray Crystal Structure Of The Complex Formed By Porcine Kallikrein A And The Bovine Pancreatic Trypsin Inhibitor. Crystallization, Patterson Search, Structure Determination, Refinement, Structure And Comparison With Its Components And With The Bovine Trypsin- Pancreatic Trypsin Inhibitor Complex Length = 80 Back     alignment and structure
>pdb|1BBR|E Chain E, The Structure Of Residues 7-16 Of The A Alpha Chain Of Human Fibrinogen Bound To Bovine Thrombin At 2.3 Angstroms Resolution Length = 109 Back     alignment and structure
>pdb|2PKS|C Chain C, Thrombin In Complex With Inhibitor Length = 102 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query384
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 4e-98
2r0l_A248 Hepatocyte growth factor activator; serine proteas 4e-96
2jde_A276 Urokinase-type plasminogen activator; plasminogen 1e-95
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 3e-95
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 1e-94
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 2e-94
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 3e-94
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 9e-93
1aut_C250 Activated protein C; serine proteinase, plasma cal 2e-92
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 2e-92
3bg8_A238 Coagulation factor XIA light chain; protease inhib 2e-91
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 2e-91
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 4e-91
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 2e-90
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 1e-89
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 2e-89
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 1e-88
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 2e-88
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 4e-21
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 1e-87
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 5e-19
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 3e-87
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 4e-19
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 6e-87
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 1e-86
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 1e-86
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 1e-86
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 1e-86
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 1e-86
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 9e-86
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 1e-85
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 5e-17
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 1e-85
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 1e-85
2qy0_B242 Complement C1R subcomponent; serine protease, beta 2e-85
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 2e-85
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 2e-85
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 6e-85
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 4e-84
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 4e-84
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 2e-20
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 6e-84
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 2e-17
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 7e-84
1md8_A329 C1R complement serine protease; innate immunity, a 8e-84
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 1e-83
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 4e-83
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 3e-17
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 4e-83
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 5e-20
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 8e-83
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 9e-21
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 1e-82
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 2e-82
1gpz_A399 Complement C1R component; hydrolase, activation, i 2e-82
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 4e-82
2asu_B234 Hepatocyte growth factor-like protein; serine prot 8e-82
2asu_B234 Hepatocyte growth factor-like protein; serine prot 7e-14
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 1e-81
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 4e-16
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 2e-81
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 2e-16
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 6e-81
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 4e-17
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 4e-80
2xw9_A228 Complement factor D; immune system, hydrolase, ser 1e-79
2xw9_A228 Complement factor D; immune system, hydrolase, ser 8e-19
2xxl_A408 GRAM-positive specific serine protease, isoform B; 2e-79
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 2e-79
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 1e-19
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 2e-79
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 1e-15
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 5e-79
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 5e-79
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 1e-18
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 2e-78
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 3e-78
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 8e-16
2aiq_A231 Protein C activator; snake venom serine proteinase 4e-78
2aiq_A231 Protein C activator; snake venom serine proteinase 9e-15
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 6e-78
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 8e-16
1ao5_A237 Glandular kallikrein-13; serine protease, protein 7e-78
1ao5_A237 Glandular kallikrein-13; serine protease, protein 3e-16
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 8e-78
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 3e-15
2xrc_A565 Human complement factor I; immune system, hydrolas 1e-77
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 1e-77
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 4e-16
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 2e-77
1azz_A226 Collagenase; complex (serine protease/inhibitor), 2e-76
1azz_A226 Collagenase; complex (serine protease/inhibitor), 1e-17
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 2e-76
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 7e-17
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 5e-76
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 2e-15
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 6e-76
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 2e-16
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 1e-75
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 8e-16
1a7s_A225 Heparin binding protein; serine protease homolog, 1e-75
1a7s_A225 Heparin binding protein; serine protease homolog, 1e-17
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 1e-75
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 1e-13
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 3e-75
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 9e-15
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 3e-75
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 5e-13
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 7e-75
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 1e-16
1euf_A227 Duodenase; serine protease, dual specificity, hydr 2e-74
1euf_A227 Duodenase; serine protease, dual specificity, hydr 2e-16
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 4e-74
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 1e-15
2z7f_E218 Leukocyte elastase; serine protease, serine protea 9e-74
2z7f_E218 Leukocyte elastase; serine protease, serine protea 2e-18
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 9e-74
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 2e-16
1elv_A333 Complement C1S component; trypsin-like serin prote 1e-73
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 2e-73
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 2e-73
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 1e-16
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 1e-72
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 3e-16
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 4e-70
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 1e-16
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 9e-69
2odp_A509 Complement C2; C3/C5 convertase, complement serin 7e-66
2odp_A509 Complement C2; C3/C5 convertase, complement serin 3e-18
3hrz_D741 Complement factor B; serine protease, glycosilated 4e-63
3hrz_D741 Complement factor B; serine protease, glycosilated 2e-12
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 4e-60
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 8e-44
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 5e-31
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 3e-17
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 2e-14
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 1e-15
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 6e-04
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 7e-13
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 6e-09
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 3e-06
2o8l_A274 V8 protease, taphylococcal serine; serine protease 3e-07
2o8l_A274 V8 protease, taphylococcal serine; serine protease 1e-04
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 4e-06
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 1e-05
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Length = 283 Back     alignment and structure
 Score =  292 bits (750), Expect = 4e-98
 Identities = 93/328 (28%), Positives = 150/328 (45%), Gaps = 80/328 (24%)

Query: 58  TCGSRVVNHEPQRAANVKIVGGTSTPYGAYPWQVEIQVRSSTGQGEHQCGGAIISDTVIL 117
            CG R   H+ +     +I+GG+S+  G++PW   I +      G+  C G+++    ++
Sbjct: 21  ACGRR---HKKRTFLRPRIIGGSSSLPGSHPWLAAIYI------GDSFCAGSLVHTCWVV 71

Query: 118 TAAHCLQGIS-KSKLRIIVGKHNLNGVDKFEKTFKVEIQVRSSTGQGEHQCGGAIISDTV 176
           +AAHC      +  + +++G+H  N      +TF +E                       
Sbjct: 72  SAAHCFSHSPPRDSVSVVLGQHFFNRTTDVTQTFGIE----------------------- 108

Query: 177 ILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKVEKAVLHHRFRKEGTHSNDIAVVK 236
                           + I                       +  +       +D+ +++
Sbjct: 109 ----------------KYIP----------------------YTLYSVFNPSDHDLVLIR 130

Query: 237 IRG----NIEFNQYVQPICIPDRD-NAAASDWCVVTGWGAQNAESIDDISNTLRAATVKV 291
           ++         +Q+VQPIC+P+      A   C + GWG  + E++   S++LR A V +
Sbjct: 131 LKKKGDRCATRSQFVQPICLPEPGSTFPAGHKCQIAGWGHLD-ENVSGYSSSLREALVPL 189

Query: 292 IDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGGPLACKIGGRFVLSGVVSW 351
           +  + C S  VYG    +I  +MLCAGY +   DAC GDSGGPLAC+  G   L G++SW
Sbjct: 190 VADHKCSSPEVYGA---DISPNMLCAGYFDCKSDACQGDSGGPLACEKNGVAYLYGIISW 246

Query: 352 GDGCAKKNKPGVYTRVSYYTKWINDRIQ 379
           GDGC + +KPGVYTRV+ Y  WINDRI+
Sbjct: 247 GDGCGRLHKPGVYTRVANYVDWINDRIR 274


>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Length = 248 Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Length = 247 Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Length = 254 Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} PDB: 4djz_B Length = 251 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Length = 241 Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Length = 235 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Length = 250 Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Length = 252 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Length = 238 Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Length = 241 Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Length = 290 Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Length = 235 Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Length = 261 Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Length = 238 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Length = 247 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Length = 228 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Length = 240 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Length = 289 Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Length = 278 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Length = 232 Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Length = 625 Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} Length = 242 Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Length = 259 Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Length = 424 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Length = 240 Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Length = 240 Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Length = 251 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Length = 242 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Length = 245 Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Length = 372 Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} PDB: 3bn9_B* 3nps_A 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Length = 241 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Length = 240 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Length = 224 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Length = 223 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Length = 224 Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Length = 329 Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Length = 236 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Length = 222 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Length = 235 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Length = 245 Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Length = 403 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Length = 399 Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Length = 241 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Length = 234 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 1bqy_A* Length = 234 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Length = 238 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Length = 223 Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Length = 394 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Length = 228 Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Length = 408 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Length = 222 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Length = 224 Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Length = 240 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} Length = 228 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Length = 283 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Length = 240 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Length = 231 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Length = 234 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Length = 237 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Length = 235 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Length = 234 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Length = 317 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Length = 226 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Length = 224 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Length = 237 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Length = 227 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Length = 225 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Length = 225 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Length = 223 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Length = 237 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Length = 791 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Length = 227 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Length = 227 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Length = 238 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Length = 218 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} PDB: 3g01_A Length = 227 Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Length = 333 Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Length = 221 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Length = 224 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Length = 226 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Length = 230 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Length = 497 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Length = 509 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Length = 741 Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Length = 152 Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Length = 97 Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Length = 131 Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Length = 80 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Length = 215 Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Length = 218 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Length = 268 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Length = 274 Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Length = 268 Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Length = 246 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query384
2jde_A276 Urokinase-type plasminogen activator; plasminogen 100.0
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 100.0
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 100.0
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 100.0
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 100.0
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 100.0
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 100.0
3bg8_A238 Coagulation factor XIA light chain; protease inhib 100.0
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 100.0
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 100.0
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 100.0
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 100.0
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 100.0
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 100.0
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 100.0
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 100.0
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 100.0
2r0l_A248 Hepatocyte growth factor activator; serine proteas 100.0
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 100.0
1aut_C250 Activated protein C; serine proteinase, plasma cal 100.0
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 100.0
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 100.0
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 100.0
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 100.0
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 100.0
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 100.0
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 100.0
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 100.0
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 100.0
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 100.0
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 100.0
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 100.0
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 100.0
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 100.0
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 100.0
2xxl_A408 GRAM-positive specific serine protease, isoform B; 100.0
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 100.0
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 100.0
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 100.0
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 100.0
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 100.0
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 100.0
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 100.0
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 100.0
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 100.0
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 100.0
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 100.0
1ao5_A237 Glandular kallikrein-13; serine protease, protein 100.0
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 100.0
1euf_A227 Duodenase; serine protease, dual specificity, hydr 100.0
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 100.0
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 100.0
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 100.0
2asu_B234 Hepatocyte growth factor-like protein; serine prot 100.0
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 100.0
2xw9_A228 Complement factor D; immune system, hydrolase, ser 100.0
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 100.0
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 100.0
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 100.0
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 100.0
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 100.0
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 100.0
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 100.0
1md8_A329 C1R complement serine protease; innate immunity, a 100.0
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 100.0
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 100.0
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 100.0
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 100.0
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 100.0
1azz_A226 Collagenase; complex (serine protease/inhibitor), 100.0
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 100.0
2aiq_A231 Protein C activator; snake venom serine proteinase 100.0
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 100.0
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 100.0
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 100.0
2z7f_E218 Leukocyte elastase; serine protease, serine protea 100.0
2qy0_B242 Complement C1R subcomponent; serine protease, beta 100.0
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 100.0
1elv_A333 Complement C1S component; trypsin-like serin prote 100.0
1a7s_A225 Heparin binding protein; serine protease homolog, 100.0
1gpz_A399 Complement C1R component; hydrolase, activation, i 100.0
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 100.0
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 100.0
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 100.0
2xrc_A565 Human complement factor I; immune system, hydrolas 100.0
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 100.0
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 100.0
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 100.0
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 100.0
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 100.0
2odp_A509 Complement C2; C3/C5 convertase, complement serin 100.0
3hrz_D741 Complement factor B; serine protease, glycosilated 100.0
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 100.0
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 100.0
2pka_B152 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 100.0
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 99.98
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 99.97
2o8l_A274 V8 protease, taphylococcal serine; serine protease 99.97
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 99.96
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 99.96
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 99.96
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 99.95
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 99.92
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 99.92
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 99.91
1yph_E97 Chymotrypsin A, chain C; serine protease, hydrolas 99.9
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 99.87
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 99.84
3k6y_A237 Serine protease, possible membrane-associated seri 99.75
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 99.7
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 99.69
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 99.68
3qo6_A 348 Protease DO-like 1, chloroplastic; protease, HTRA, 99.68
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 99.64
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 99.59
3num_A 332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 99.59
1hpg_A187 Glutamic acid specific protease; serine protease, 99.58
1lcy_A 325 HTRA2 serine protease; apoptosis, PDZ domain, casp 99.57
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 99.55
2ea3_A189 Chymotrypsin; celloulomonas, protease, hydrolase; 99.5
3stj_A 345 Protease DEGQ; serine protease, PDZ domain, protea 99.38
2pfe_A186 Protease A, alkaline serine protease, TFPA; beta-b 99.26
4a8c_A 436 Periplasmic PH-dependent serine endoprotease DEGQ; 99.22
3pv2_A 451 DEGQ; trypsin fold, PDZ domain, chaperone protease 99.19
2oua_A188 Serine protease, protein NAPA; kinetic stability, 99.09
1ky9_A 448 Protease DO, DEGP, HTRA; protein quality control, 98.95
1yph_C131 Chymotrypsin A, chain B; serine protease, hydrolas 98.92
2vnt_A276 Urokinase-type plasminogen activator; UPA, inhibit 98.79
1fuj_A221 PR3, myeloblastin; hydrolase, serine protease, gly 98.78
3bg8_A238 Coagulation factor XIA light chain; protease inhib 98.78
2f9n_A245 Alpha I tryptase; serine proteinase, trypsin-like, 98.77
2any_A241 Kininogenin, plasma kallikrein, light chain, fletc 98.76
2olg_A278 Pro-phenoloxidase activating enzyme-I; prophenolox 98.73
3mhw_U247 Urokinase-type plasminogen activator; hydrolase, b 98.72
1m9u_A241 Earthworm fibrinolytic enzyme; hydrolase, serine p 98.71
2zgc_A240 Granzyme M; serine protease, cytolysis, glycoprote 98.68
2jde_A276 Urokinase-type plasminogen activator; plasminogen 98.68
3gov_B251 MAsp-1; complement, serine protease, beta barrel, 98.67
2zch_P237 Prostate-specific antigen; human PSA, kallikrein r 98.67
1a7s_A225 Heparin binding protein; serine protease homolog, 98.67
1rtf_B252 (TC)-T-PA, two chain tissue plasminogen activator; 98.66
2xw9_A228 Complement factor D; immune system, hydrolase, ser 98.65
3ncl_A241 Suppressor of tumorigenicity 14 protein; proteinas 98.65
1fiw_A290 Beta-acrosin heavy chain; anti-parallel beta-barre 98.65
2oq5_A232 Transmembrane protease, serine 11E; type II trans- 98.65
2z7f_E218 Leukocyte elastase; serine protease, serine protea 98.64
2bz6_H254 Blood coagulation factor VIIA; serine protease, en 98.64
1eq9_A222 Chymotrypsin; FIRE ANT, serine proteinase, hydrola 98.64
1mza_A240 Pro-granzyme K; apoptosis, serine protease, S1 fam 98.64
1orf_A234 Granzyme A; hydrolase-hydrolase inhibitor complex; 98.64
2f91_A237 Hepatopancreas trypsin; trypsin, canonical inhibit 98.63
2bdy_A289 Thrombin; thrombin, complex structure, hydrolase, 98.63
3h7o_A228 Group 3 allergen smipp-S YV6023A04; hydrolase; 1.8 98.62
1ddj_A247 Plasminogen; catalytic domain, blood clotting; 2.0 98.62
3h7t_A235 Group 3 allergen smipp-S YVT004A06; hydrolase; 2.0 98.62
3rm2_H259 Thrombin heavy chain; serine protease, kringle, hy 98.62
1si5_H240 Scatter factor, hepatocyte growth factor, SF, hepa 98.62
3gyl_B261 Prostasin; ENAC, zymogen, divalent cation, channel 98.62
2r0l_A248 Hepatocyte growth factor activator; serine proteas 98.62
4dgj_A235 Enteropeptidase catalytic light chain; serine prot 98.61
1pq7_A224 Trypsin; ultra-high resolution, catalysis, hydrola 98.61
1gvk_B240 Elastase 1, peptide inhibitor; hydrolase, serine p 98.6
1azz_A226 Collagenase; complex (serine protease/inhibitor), 98.6
2h5c_A198 Alpha-lytic protease; serine protease, acylation t 98.6
1ym0_A238 Fibrinotic enzyme component B; two chains, glycosy 98.6
1bru_P241 Elastase, PPE; serine protease, hydrolase; HET: 1N 98.59
1t8o_A245 Chymotrypsin A; chymotrypsin, serine proteinase, B 98.59
2hlc_A230 Collagenase; serine protease, hydrolase, collagen 98.59
3tvj_B242 Mannan-binding lectin serine protease 2 B chain; i 98.58
1yc0_A283 Hepatocyte growth factor activator; hydrolase/inhi 98.56
1fxy_A228 Coagulation factor XA-trypsin chimera; protease, c 98.56
1aut_C250 Activated protein C; serine proteinase, plasma cal 98.56
1pyt_D251 TC, PCPA-TC, chymotrypsinogen C; ternary complex ( 98.56
2jkh_A241 Activated factor XA heavy chain; plasma, calcium, 98.55
1fon_A240 Procarboxypeptidase A-S6; truncated zymogen E, ser 98.54
2asu_B234 Hepatocyte growth factor-like protein; serine prot 98.53
2wph_S235 Coagulation factor IXA heavy chain; serine proteas 98.52
1elt_A236 Elastase; serine proteinase; 1.61A {Salmo salar} S 98.51
2qy0_B242 Complement C1R subcomponent; serine protease, beta 98.51
3beu_A224 Trypsin, SGT; beta sheets, serine protease, hydrol 98.5
1z8g_A372 Serine protease hepsin; serine protease hepsin, pr 98.49
2xxl_A408 GRAM-positive specific serine protease, isoform B; 98.48
4f4o_C347 Haptoglobin; globin fold, serine protease fold, co 98.46
2f83_A625 Coagulation factor XI; protease, apple domain, hyd 98.45
3nxp_A424 Prethrombin-1; allostery, blood coagulation, hydro 98.44
2b9l_A394 Prophenoloxidase activating factor; CLIP domain, e 98.44
2odp_A509 Complement C2; C3/C5 convertase, complement serin 98.43
2pka_A80 Kallikrein A; serine proteinase; 2.05A {Sus scrofa 98.42
1md8_A329 C1R complement serine protease; innate immunity, a 98.42
3cp7_A218 Alkaline serine protease Al20; trypsin-like, hydro 98.41
2w5e_A163 Putative serine protease; coiled coil, transmembra 98.39
1wxr_A 1048 Haemoglobin protease; hemoglobine protease, autotr 98.38
1elv_A333 Complement C1S component; trypsin-like serin prote 98.34
1rrk_A497 Complement factor B; BB, hydrolase; 2.00A {Homo sa 98.33
3f1s_B283 Vitamin K-dependent protein Z; PZ, ZPI, complex, s 98.33
1zjk_A403 Mannan-binding lectin serine protease 2; beta barr 98.32
1wcz_A268 Glutamyl endopeptidase; virulence factor, hydrolas 98.31
1gpz_A399 Complement C1R component; hydrolase, activation, i 98.29
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 98.28
4fln_A 539 Protease DO-like 2, chloroplastic; protease, DEG, 98.27
2o8l_A274 V8 protease, taphylococcal serine; serine protease 98.26
4dur_A791 Plasminogen, serine protease; fibrinolysis, hydrol 98.24
1arb_A268 Achromobacter protease I; hydrolase(serine proteas 98.22
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 98.21
3hrz_D741 Complement factor B; serine protease, glycosilated 98.16
2xrc_A565 Human complement factor I; immune system, hydrolas 98.15
1p3c_A215 Glutamyl-endopeptidase; serine protease, hydrolase 98.13
3rp2_A224 RAT MAST cell protease II; serine proteinase; 1.90 98.01
1iau_A227 Granzyme B; hydrolase-hydrolase inhibitor complex; 98.01
1cgh_A224 Cathepsin G; inflammation, specificity, serine pro 98.01
1euf_A227 Duodenase; serine protease, dual specificity, hydr 98.01
3fzz_A227 Granzyme C; hydrolase, cytolysis, protease, serine 98.01
4ag1_A226 Chymase; hydrolase-de novo protein complex, inhibi 97.98
1agj_A242 Epidermolytic toxin A; hydrolase, serine protease; 97.9
2bdg_A223 Kallikrein-4; serine proteinase, S1 subsite, 70-80 97.89
4i8h_A223 Cationic trypsin, beta-trypsin; serine protease, h 97.87
4e7n_A238 Snake-venom thrombin-like enzyme; beta-barrel, hyd 97.85
1hj8_A222 Trypsin I; hydrolase, radiation damage, disulphide 97.83
1lo6_A223 Kallikrein 6, HK6; serine protease, human kallikre 97.83
3s9c_A234 Vipera russelli proteinase RVV-V gamma; serine pro 97.83
2psx_A227 Kallikrein-5; zinc inhibition, stratum corneum, gl 97.83
1ao5_A237 Glandular kallikrein-13; serine protease, protein 97.82
1qtf_A246 Exfoliative toxin B; serine protease, superantigen 97.82
1gvz_A237 Kallikrein-1E2; antigen, prostate specific antigen 97.81
1spj_A238 Kallikrein 1; serine protease, KLK1, HK1, hydrolas 97.8
1npm_A225 Neuropsin; serine proteinase, glycoprotein; HET: N 97.8
3mfj_A223 Cationic trypsin; serine proteinase, hydrolase; 0. 97.79
2aiq_A231 Protein C activator; snake venom serine proteinase 97.75
3s69_A234 Thrombin-like enzyme defibrase; beta-barrel, serin 97.75
1ton_A235 Tonin; hydrolase(serine proteinase); 1.80A {Rattus 97.72
1sgf_A240 7S NGF, nerve growth factor; growth factor (beta-N 97.7
2w7s_A200 Serine protease SPLA; hydrolase, family S1; 1.80A 97.7
2qxi_A224 Kallikrein-7; S1 pocket, chloromethyl ketone, alte 97.68
2vid_A204 Serine protease SPLB; hydrolase; 1.80A {Staphyloco 97.65
2as9_A210 Serine protease; trypsin-like fold, hydrolase; 1.7 97.45
3k6y_A237 Serine protease, possible membrane-associated seri 97.01
3syj_A 1011 Adhesion and penetration protein autotransporter; 96.7
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 96.61
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 95.8
3tjo_A231 Serine protease HTRA1; peptidase, hydrolase; HET: 95.72
1l1j_A239 Heat shock protease HTRA; hydrolase, serine protei 95.54
2sga_A181 Proteinase A; hydrolase (serine proteinase); 1.50A 94.9
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 94.74
3mmg_A241 Nuclear inclusion protein A; 3C-type protease, TEV 94.65
3lgi_A237 Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydro 94.57
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 93.75
4ash_A185 NS6 protease; hydrolase, trypsin-like, calicivirus 93.25
2qa9_E185 Streptogrisin-B; chymotrypsin-type serine peptidas 92.85
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 92.81
1lvm_A229 Catalytic domain of the nuclear inclusion protein 92.81
2fyq_A194 Chymotrypsin-like cysteine proteinase; protease, n 92.68
3sti_A245 Protease DEGQ; serine protease, PDZ domain, chaper 91.13
2bhg_A209 Foot-and-mouth disease virus 3C protease; chymotry 88.59
1zyo_A191 Serine protease; beta-barrel, glutamyl endopeptida 87.22
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 85.87
1mbm_A198 NSP4 proteinase, chymotrypsin-like serine protease 84.32
3h09_A 989 IGA1 protease, immunoglobulin A1 protease; serine 83.09
3sze_A 968 Serine protease ESPP; parallel beta-helix, hydrola 81.26
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2pka_B Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_B 1hia_B Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>1yph_E Chymotrypsin A, chain C; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1ca0_C 1cbw_C 1cho_G 1gct_C 1ab9_C* 1ggd_C* 1gha_G 1ghb_G* 1gmc_G 1gmd_G 1gmh_G 1hja_C 1mtn_C 1n8o_C 1vgc_C* 1gg6_C 2cha_C* 2gch_G 2gct_C 2gmt_C* ... Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>1hpg_A Glutamic acid specific protease; serine protease, hydrolase-hydrolase inhibitor complex; 1.50A {Streptomyces griseus} SCOP: b.47.1.1 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2ea3_A Chymotrypsin; celloulomonas, protease, hydrolase; 1.78A {Cellulomonas bogoriensis} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2pfe_A Protease A, alkaline serine protease, TFPA; beta-barrels, thermophIle, kinetic stabilit thermostability, protein folding; HET: 2AB; 1.44A {Thermobifida fusca} Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>2oua_A Serine protease, protein NAPA; kinetic stability, acid stability, electros hydrolase; HET: 2AB; 1.85A {Nocardiopsis alba} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1yph_C Chymotrypsin A, chain B; serine protease, hydrolase; 1.34A {Bos taurus} PDB: 1afq_B* 1ca0_B 1cbw_B 1cho_F 1gct_B 1ab9_B* 1ggd_B* 1gha_F 1ghb_F* 1gmc_F 1gmd_F 1gmh_F 1hja_B 1mtn_B 1n8o_B 1vgc_B* 1gg6_B 2cha_B* 2gch_F 2gct_B ... Back     alignment and structure
>2vnt_A Urokinase-type plasminogen activator; UPA, inhibitor complex, hydrolase; HET: QGG; 2.2A {Homo sapiens} Back     alignment and structure
>1fuj_A PR3, myeloblastin; hydrolase, serine protease, glycoprotein, zymogen, hydrolase protease); HET: NAG FUC; 2.20A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3bg8_A Coagulation factor XIA light chain; protease inhibitor, factor XIA inhibitor complex, covalent inhibitor, alternative splicing, blood coagulation; HET: INH; 1.60A {Homo sapiens} PDB: 3sor_A* 3sos_A* 1zsl_A* 1zpz_A* 1zrk_A* 1xx9_A* 1zjd_A 1zhr_A 1zmj_A* 1zml_A* 1zmn_A* 1zom_A* 1zpb_A* 1zpc_A* 1zsj_A* 1zsk_A* 1ztj_A* 1ztk_A* 1ztl_A* 2fda_A* ... Back     alignment and structure
>2f9n_A Alpha I tryptase; serine proteinase, trypsin-like, difucosylation, hydrolase-hydrolase inhibitor complex; HET: AR7 NAG FUC; 1.60A {Homo sapiens} PDB: 2f9o_A* 2f9p_A* 1lto_A 2fpz_A* 2bm2_A* 2fs8_A* 2fs9_A* 2fww_A* 2fxr_A* 2gdd_A* 2za5_A* 3v7t_A* 4a6l_A* 1a0l_A* 2zec_A* 2zeb_A* Back     alignment and structure
>2any_A Kininogenin, plasma kallikrein, light chain, fletcher factor; mutagenically deglycosyalted human plasma kallikrein protease domain; HET: BAM; 1.40A {Homo sapiens} PDB: 2anw_A* Back     alignment and structure
>2olg_A Pro-phenoloxidase activating enzyme-I; prophenoloxidase activating factor-I, PPAF-I, serine proteas hydrolase; HET: NAG; 1.70A {Holotrichia diomphalia} Back     alignment and structure
>3mhw_U Urokinase-type plasminogen activator; hydrolase, blood coagulation, fibrinolysis, plasminogen activation; HET: ABV; 1.45A {Homo sapiens} SCOP: b.47.1.2 PDB: 1w10_U* 1w11_U* 1w12_U* 1w13_U* 1w14_U* 1w0z_U* 2vip_A* 1f5k_U 1f5l_A* 1f92_A* 2r2w_U* 2vin_A* 2vio_A* 1ejn_A* 2viq_A* 2viv_A* 2viw_A* 1vja_U* 1vj9_U* 1sc8_U* ... Back     alignment and structure
>1m9u_A Earthworm fibrinolytic enzyme; hydrolase, serine protease (elastase-like); 2.30A {Eisenia fetida} SCOP: b.47.1.2 Back     alignment and structure
>2zgc_A Granzyme M; serine protease, cytolysis, glycoprotein, hydrolase, secrete zymogen; 1.96A {Homo sapiens} PDB: 2zgh_A 2zks_A 2zgj_A Back     alignment and structure
>3gov_B MAsp-1; complement, serine protease, beta barrel, hydrolase, hydroxy immune response, innate immunity, sushi, coagulation, compl pathway; 2.55A {Homo sapiens} SCOP: b.47.1.0 PDB: 4djz_B Back     alignment and structure
>2zch_P Prostate-specific antigen; human PSA, kallikrein related peptidases, antibodies, prostate cancer, glycoprotein, hydrolase, polymorphism; HET: NDG; 2.83A {Homo sapiens} PDB: 2zck_P* 2zcl_P* 3qum_P* Back     alignment and structure
>1a7s_A Heparin binding protein; serine protease homolog, endotoxin binding; HET: NAG; 1.12A {Homo sapiens} SCOP: b.47.1.2 PDB: 1ae5_A* 1fy3_A* 1fy1_A* Back     alignment and structure
>1rtf_B (TC)-T-PA, two chain tissue plasminogen activator; serine protease, fibrinolytic enzymes; HET: BEN; 2.30A {Homo sapiens} SCOP: b.47.1.2 PDB: 1a5h_A* 1bda_A* 1a5i_A* Back     alignment and structure
>2xw9_A Complement factor D; immune system, hydrolase, serine protease, alternative pathw; HET: GOL; 1.20A {Homo sapiens} PDB: 2xwb_I* 1bio_A 1dfp_A* 1dic_A* 1dsu_A 1hfd_A 4d9r_A 1fdp_A 2xwa_A 1dst_A 4d9q_A Back     alignment and structure
>3ncl_A Suppressor of tumorigenicity 14 protein; proteinase-inhibitor complex, serine proteinase, benzamidine phosphonate, serine endopeptidases; HET: CCZ; 1.19A {Homo sapiens} SCOP: b.47.1.2 PDB: 3bn9_B* 3nps_A 3so3_A* 1eax_A 1eaw_A 2gv6_A* 2gv7_A* 3p8g_A* 3p8f_A* Back     alignment and structure
>1fiw_A Beta-acrosin heavy chain; anti-parallel beta-barrel, hydrolase; HET: NAG FUL BMA MAN PBZ; 2.10A {Ovis aries} SCOP: b.47.1.2 PDB: 1fiz_A* Back     alignment and structure
>2oq5_A Transmembrane protease, serine 11E; type II trans-membrane serine proteinases, trypsin-like serine protease, tumor marker, hydrolase; 1.61A {Homo sapiens} Back     alignment and structure
>2z7f_E Leukocyte elastase; serine protease, serine protease inhibitor, disease mutation glycoprotein, hydrolase, zymogen, secreted; HET: NAG FUC; 1.70A {Homo sapiens} SCOP: b.47.1.2 PDB: 1h1b_A* 1ppg_E* 1ppf_E* 3q76_A* 3q77_A* 1hne_E 2rg3_A* 1b0f_A* Back     alignment and structure
>2bz6_H Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: b.47.1.2 PDB: 1cvw_H* 1dva_H* 1fak_H* 1j9c_H* 1jbu_H 1dan_H 1klj_H 1o5d_H* 1qfk_H* 1w0y_H* 1w2k_H* 1w7x_H* 1w8b_H* 1wqv_H* 1wss_H* 1wtg_H* 1wun_H* 1wv7_H* 1ygc_H* 1z6j_H* ... Back     alignment and structure
>1eq9_A Chymotrypsin; FIRE ANT, serine proteinase, hydrolase; HET: PMS; 1.70A {Solenopsis invicta} SCOP: b.47.1.2 Back     alignment and structure
>1mza_A Pro-granzyme K; apoptosis, serine protease, S1 family, hydrolase; 2.23A {Homo sapiens} SCOP: b.47.1.2 PDB: 1mzd_A Back     alignment and structure
>1orf_A Granzyme A; hydrolase-hydrolase inhibitor complex; HET: 0G6; 2.40A {Homo sapiens} SCOP: b.47.1.2 PDB: 1op8_A Back     alignment and structure
>2f91_A Hepatopancreas trypsin; trypsin, canonical inhibitor, atomic resolution, hydrolase/hydrolase inhibitor complex; 1.20A {Pontastacus leptodactylus} SCOP: b.47.1.2 Back     alignment and structure
>2bdy_A Thrombin; thrombin, complex structure, hydrolase, hydrolase-hydrolase complex; HET: TYS UNB; 1.61A {Homo sapiens} SCOP: b.47.1.2 PDB: 3k65_B 1doj_A* 1hag_E* 1xm1_A* 1nu9_A* 3sqe_E 3sqh_E 1jwt_A* 1d9i_A* 1d6w_A* 1g37_A* 1nm6_A* 1nt1_A* 1sl3_A* 1ta2_A* 1ta6_A* 1z71_A* 1zgi_A* 1zgv_A* 1zrb_A* ... Back     alignment and structure
>3h7o_A Group 3 allergen smipp-S YV6023A04; hydrolase; 1.85A {Sarcoptes scabiei type hominis} SCOP: b.47.1.0 Back     alignment and structure
>1ddj_A Plasminogen; catalytic domain, blood clotting; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1bml_A 1l4d_A 1l4z_A 1bui_A* 1rjx_B 1qrz_A Back     alignment and structure
>3h7t_A Group 3 allergen smipp-S YVT004A06; hydrolase; 2.00A {Sarcoptes scabiei type hominis} Back     alignment and structure
>3rm2_H Thrombin heavy chain; serine protease, kringle, hydrolase, blood coagulation, BLOO clotting, convertion of fibrinogen to fibrin; HET: TYS NAG S00; 1.23A {Homo sapiens} PDB: 1a2c_H* 1a3e_H* 1a46_H* 1a4w_H* 1a5g_H* 1a61_H* 1abi_H* 1abj_H* 1ad8_H* 1ae8_H* 1afe_H* 1a3b_H* 1ai8_H* 1aix_H* 1awf_H* 1awh_B* 1ay6_H* 1b5g_H* 1ba8_B* 1bb0_B* ... Back     alignment and structure
>1si5_H Scatter factor, hepatocyte growth factor, SF, hepatopoeitin A, LUNG; chymotrypsin homology, hormone/growth factor complex; 2.53A {Homo sapiens} SCOP: b.47.1.2 PDB: 1shy_A Back     alignment and structure
>3gyl_B Prostasin; ENAC, zymogen, divalent cation, channel activatin membrane, disulfide bond, glycoprotein, hydrolase, membrane protease, secreted; 1.30A {Homo sapiens} PDB: 3gym_A 3e16_B* 3e0p_B* 3e0n_B* 3e1x_B 3fvf_B* 3dfj_A 3dfl_A* Back     alignment and structure
>2r0l_A Hepatocyte growth factor activator; serine protease, antibody, allosteric inhibitor, EGF-like DO glycoprotein, hydrolase, kringle, secreted; HET: NAG BMA; 2.20A {Homo sapiens} PDB: 3k2u_A* 2wub_A* 2wuc_A* Back     alignment and structure
>4dgj_A Enteropeptidase catalytic light chain; serine protease, hydrolase; 1.90A {Homo sapiens} PDB: 1ekb_B Back     alignment and structure
>1pq7_A Trypsin; ultra-high resolution, catalysis, hydrolase; HET: ARG; 0.80A {Fusarium oxysporum} SCOP: b.47.1.2 PDB: 1fy4_A 1fy5_A 1gdn_A 1gdq_A 1gdu_A 1ppz_A* 1pq5_A* 1fn8_A* 1pq8_A* 1try_A 1xvm_A 1xvo_A* 2g51_A 2g52_A 2vu8_E 1pqa_A* Back     alignment and structure
>1gvk_B Elastase 1, peptide inhibitor; hydrolase, serine protease, catalytic intermediate, atomic resolution, hydrolase-hydrolase inhibitor complex; 0.94A {Sus scrofa} SCOP: b.47.1.2 PDB: 1bma_A* 1b0e_A* 1e34_B* 1e35_B* 1e36_B* 1e37_B* 1e38_B* 1eas_A* 1eat_A* 1eau_A* 1ela_A* 1elb_A* 1elc_A* 1eld_E* 1ele_E* 1elf_A* 1elg_A* 1esa_A 1esb_A* 1est_A* ... Back     alignment and structure
>1azz_A Collagenase; complex (serine protease/inhibitor), serine protease, inhibitor, complex, protease-substrate interactions, collagen; 2.30A {Celuca pugilator} SCOP: b.47.1.2 Back     alignment and structure
>2h5c_A Alpha-lytic protease; serine protease, acylation transition STAT catalysis, protein folding, protein stability, packing DIST hydrolase; HET: SO4; 0.82A {Lysobacter enzymogenes} SCOP: b.47.1.1 PDB: 1p02_A 1p03_A 1p04_A 1p05_A 1p06_A* 1p01_A 1p11_E 1p12_E 1qrx_A* 1tal_A 2alp_A 1ssx_A* 2h5d_A* 2ull_A 3qgj_A* 9lpr_A 1boq_A 1gbj_A 1gbk_A 1gbl_A ... Back     alignment and structure
>1ym0_A Fibrinotic enzyme component B; two chains, glycosylation, pyroglutamation, eight-membered R peptide bond, hydrolase; HET: NAG MAN FUC; 2.06A {Eisenia fetida} Back     alignment and structure
>1bru_P Elastase, PPE; serine protease, hydrolase; HET: 1NB; 2.30A {Sus scrofa} SCOP: b.47.1.2 Back     alignment and structure
>1t8o_A Chymotrypsin A; chymotrypsin, serine proteinase, BPTI, protein-protein interaction, non-cognate binding, S1 pocket, primary specificity; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1cgi_E 1cgj_E 1chg_A 1ex3_A 1acb_E 1gl0_E 1gl1_A 1gcd_A* 1oxg_A 1k2i_1 1p2n_A 1p2o_A 1p2q_A 1t7c_A 1t8l_A 1t8m_A 1t8n_A 1p2m_A 2cga_A 2y6t_A ... Back     alignment and structure
>2hlc_A Collagenase; serine protease, hydrolase, collagen degradation; 1.70A {Hypoderma lineatum} SCOP: b.47.1.2 PDB: 1hyl_A Back     alignment and structure
>3tvj_B Mannan-binding lectin serine protease 2 B chain; in vitro evolution, specific inhibitor, allostery, hydrolase; 1.28A {Homo sapiens} PDB: 4fxg_H* Back     alignment and structure
>1yc0_A Hepatocyte growth factor activator; hydrolase/inhibitor, hydrolase-inhibitor complex; 2.60A {Homo sapiens} PDB: 1ybw_A 2r0k_A Back     alignment and structure
>1fxy_A Coagulation factor XA-trypsin chimera; protease, chloromethylketone, hydrolase-hydrolase I complex; HET: 0G6; 2.15A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>1aut_C Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 3f6u_H* Back     alignment and structure
>1pyt_D TC, PCPA-TC, chymotrypsinogen C; ternary complex (zymogen), serine proteinase, C-terminal peptidase; 2.35A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>2jkh_A Activated factor XA heavy chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_A* 2vvc_A* 2vvu_A* 2vvv_A* 2vwl_A* 2vwm_A* 2vwn_A* 2vwo_A* 2xbv_A* 1c5m_D 2vh0_A* 1ezq_A* 1f0s_A* 1ksn_A* 1f0r_A* 1lpk_B* 1lpz_B* 1lqd_B* 1nfu_A* 1nfw_A* ... Back     alignment and structure
>1fon_A Procarboxypeptidase A-S6; truncated zymogen E, serine protease; 1.70A {Bos taurus} SCOP: b.47.1.2 PDB: 1pyt_C Back     alignment and structure
>2asu_B Hepatocyte growth factor-like protein; serine proteinase, beta-chain, MSP, HGFL, hydrolase; 1.85A {Homo sapiens} Back     alignment and structure
>2wph_S Coagulation factor IXA heavy chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpj_S* 2wpk_S* 2wpl_S* 2wpi_S* 2wpm_S 3lc3_A* 1rfn_A* 3lc5_A* 3kcg_H* 1x7a_C* 1pfx_C* Back     alignment and structure
>1elt_A Elastase; serine proteinase; 1.61A {Salmo salar} SCOP: b.47.1.2 Back     alignment and structure
>2qy0_B Complement C1R subcomponent; serine protease, beta barrel, complement pathway like domain, glycoprotein, hydrolase, hydroxylation, immune response; 2.60A {Homo sapiens} SCOP: b.47.1.2 Back     alignment and structure
>3beu_A Trypsin, SGT; beta sheets, serine protease, hydrolase, zymogen; HET: BEN; 1.05A {Streptomyces griseus} PDB: 3i78_A 3i77_A 2fmj_A 1os8_A 1oss_A 1sgt_A Back     alignment and structure
>1z8g_A Serine protease hepsin; serine protease hepsin, protease, hydrolase-hydrolase inhibi complex; HET: AR7; 1.55A {Homo sapiens} SCOP: b.47.1.2 d.170.1.2 PDB: 3t2n_A 1o5e_H* 1o5f_H* 1p57_B* 1o5e_L* 1o5f_L* 1p57_A* Back     alignment and structure
>2xxl_A GRAM-positive specific serine protease, isoform B; hydrolase, innate immunity; HET: NAG FUC BMA; 1.80A {Drosophila melanogaster} Back     alignment and structure
>4f4o_C Haptoglobin; globin fold, serine protease fold, complement control protei haemoglobin scavenging, oxygen storage-transport complex; HET: HEM NAG FUC; 2.90A {Sus scrofa} Back     alignment and structure
>2f83_A Coagulation factor XI; protease, apple domain, hydrolase; HET: NAG; 2.87A {Homo sapiens} PDB: 2j8j_A 2j8l_A Back     alignment and structure
>3nxp_A Prethrombin-1; allostery, blood coagulation, hydro kringle, serine protease, zymogen; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2b9l_A Prophenoloxidase activating factor; CLIP domain, easter, innate immunity, melanin, immune system binding complex; HET: NAG FUC; 2.00A {Holotrichia diomphalia} Back     alignment and structure
>2odp_A Complement C2; C3/C5 convertase, complement serin protease, human complement system, glycoprotein, SP, VWFA,; HET: NAG; 1.90A {Homo sapiens} PDB: 2odq_A* 2i6q_A* 2i6s_A* Back     alignment and structure
>2pka_A Kallikrein A; serine proteinase; 2.05A {Sus scrofa} SCOP: b.47.1.2 PDB: 2kai_A 1hia_A Back     alignment and structure
>1md8_A C1R complement serine protease; innate immunity, activation, substrate specificity, hydrolase; 2.80A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 PDB: 1md7_A* Back     alignment and structure
>3cp7_A Alkaline serine protease Al20; trypsin-like, hydrolase; 1.39A {Nesterenkonia abyssinica} Back     alignment and structure
>2w5e_A Putative serine protease; coiled coil, transmembrane, thiol protease, RNA replication, ribosomal frameshifting, catalytic triad, membrane; 2.00A {Human astrovirus 1} Back     alignment and structure
>1wxr_A Haemoglobin protease; hemoglobine protease, autotransporter, beta helix, heme uptake, spate, hydrolase; 2.20A {Escherichia coli} PDB: 3ak5_A Back     alignment and structure
>1elv_A Complement C1S component; trypsin-like serin protease, CCP (OR sushi or SCR)module, HY; HET: NAG FUC NES; 1.70A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 Back     alignment and structure
>1rrk_A Complement factor B; BB, hydrolase; 2.00A {Homo sapiens} SCOP: b.47.1.2 c.62.1.1 PDB: 1rs0_A* 1rtk_A* 2win_I* 1dle_A Back     alignment and structure
>3f1s_B Vitamin K-dependent protein Z; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} Back     alignment and structure
>1zjk_A Mannan-binding lectin serine protease 2; beta barrel, modular protein, hydrolase; 2.18A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 PDB: 1q3x_A Back     alignment and structure
>1wcz_A Glutamyl endopeptidase; virulence factor, hydrolase; 2.00A {Staphylococcus aureus} SCOP: b.47.1.1 Back     alignment and structure
>1gpz_A Complement C1R component; hydrolase, activation, innate immunity, modular structure, serine protease; HET: NAG FUC MAN; 2.9A {Homo sapiens} SCOP: b.47.1.2 g.18.1.1 g.18.1.1 Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>2o8l_A V8 protease, taphylococcal serine; serine protease, enzyme, hydrolase; 1.50A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1qy6_A Back     alignment and structure
>4dur_A Plasminogen, serine protease; fibrinolysis, hydrolase; HET: NAG GAL SIA; 2.45A {Homo sapiens} PDB: 4a5t_S* 4duu_A 2feb_A Back     alignment and structure
>1arb_A Achromobacter protease I; hydrolase(serine protease); 1.20A {Achromobacter lyticus} SCOP: b.47.1.1 PDB: 1arc_A* Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>3hrz_D Complement factor B; serine protease, glycosilated, multi-domain, complement SYST convertase, complement alternate pathway; HET: NAG P6G; 2.20A {Homo sapiens} PDB: 2xwj_I* 3hs0_D* 2ok5_A* 2xwb_F* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>1p3c_A Glutamyl-endopeptidase; serine protease, hydrolase; 1.50A {Bacillus intermedius} SCOP: b.47.1.1 PDB: 1p3e_A Back     alignment and structure
>3rp2_A RAT MAST cell protease II; serine proteinase; 1.90A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1iau_A Granzyme B; hydrolase-hydrolase inhibitor complex; HET: ASJ NAG FUC MAN BMA; 2.00A {Homo sapiens} SCOP: b.47.1.2 PDB: 1fq3_A* 1fi8_A 3tk9_A 3tju_A 3tjv_A Back     alignment and structure
>1cgh_A Cathepsin G; inflammation, specificity, serine protease, hydrolase-hydrol inhibitor complex; HET: 1ZG; 1.80A {Homo sapiens} SCOP: b.47.1.2 PDB: 1au8_A* 1t32_A* 1kyn_A* Back     alignment and structure
>1euf_A Duodenase; serine protease, dual specificity, hydrola; HET: NAG; 2.40A {Bos taurus} SCOP: b.47.1.2 Back     alignment and structure
>3fzz_A Granzyme C; hydrolase, cytolysis, protease, serine protease, zymogen; 2.50A {Mus musculus} SCOP: b.47.1.2 PDB: 3g01_A Back     alignment and structure
>4ag1_A Chymase; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Homo sapiens} PDB: 4afs_A 4afu_A 4afz_A* 4afq_A 4ag2_A* 1nn6_A* 1klt_A* 3n7o_A* 1t31_A* 1pjp_A* 2hvx_A* 3s0n_A* 2rdl_A Back     alignment and structure
>1agj_A Epidermolytic toxin A; hydrolase, serine protease; 1.70A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dua_A 1exf_A 1due_A Back     alignment and structure
>2bdg_A Kallikrein-4; serine proteinase, S1 subsite, 70-80 loop, structural proteo europe, spine, structural genomics, hydrolase; HET: PBZ; 1.95A {Homo sapiens} PDB: 2bdh_A* 2bdi_A* Back     alignment and structure
>4i8h_A Cationic trypsin, beta-trypsin; serine protease, hydrolase; HET: BEN; 0.75A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>4e7n_A Snake-venom thrombin-like enzyme; beta-barrel, hydrolase, arginine esterase, glycosylation, extracellular; HET: NAG; 1.75A {Agkistrodon halys} Back     alignment and structure
>1hj8_A Trypsin I; hydrolase, radiation damage, disulphide bond breakage, salmon, atomic resolution; HET: BAM; 1.00A {Salmo salar} SCOP: b.47.1.2 PDB: 1utm_A 1utj_A 1utl_M* 1utk_A 1bit_A 2sta_E 1bzx_E 2stb_E 2zpq_A 2zps_A 2tbs_A 2zpr_A 1mbq_A 2eek_A Back     alignment and structure
>1lo6_A Kallikrein 6, HK6; serine protease, human kallikrein 6, benzamidine, protease, brain serine protease, myelencephalon specific protease, MSP, ZYME; 1.56A {Homo sapiens} SCOP: b.47.1.2 PDB: 1l2e_A 1gvl_A 4d8n_A* Back     alignment and structure
>3s9c_A Vipera russelli proteinase RVV-V gamma; serine proteinase, double six-stranded beta-barrels, hydrola glycosylation; HET: NAG BMA BGC GLC; 1.80A {Daboia russellii siamensis} PDB: 3s9b_A* 3s9a_A* 3sbk_A* Back     alignment and structure
>2psx_A Kallikrein-5; zinc inhibition, stratum corneum, glcosylation, hydrolase, H hydrolase inhibitor complex; HET: AR7 NAG; 2.30A {Homo sapiens} PDB: 2psy_A* Back     alignment and structure
>1ao5_A Glandular kallikrein-13; serine protease, protein maturation; HET: NAG; 2.60A {Mus musculus} SCOP: b.47.1.2 PDB: 1sgf_G* Back     alignment and structure
>1qtf_A Exfoliative toxin B; serine protease, superantigen, hydrolase; 2.40A {Staphylococcus aureus} SCOP: b.47.1.1 PDB: 1dt2_A Back     alignment and structure
>1gvz_A Kallikrein-1E2; antigen, prostate specific antigen, hydrolase; 1.42A {Equus caballus} SCOP: b.47.1.2 Back     alignment and structure
>1spj_A Kallikrein 1; serine protease, KLK1, HK1, hydrolase; HET: NAG; 1.70A {Homo sapiens} Back     alignment and structure
>1npm_A Neuropsin; serine proteinase, glycoprotein; HET: NAG; 2.10A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>3mfj_A Cationic trypsin; serine proteinase, hydrolase; 0.80A {Bos taurus} PDB: 1aq7_A* 1auj_A* 1bju_A* 1bjv_A* 1az8_A* 1c1o_A 1c1n_A* 1c1q_A* 1c1r_A* 1c1s_A* 1c1t_A* 1c2d_A* 1c2e_A* 1c2f_A* 1c2g_A* 1c2h_A* 1c2i_A* 1c2j_A* 1c2k_A* 1c2l_A ... Back     alignment and structure
>2aiq_A Protein C activator; snake venom serine proteinase, hydrolas; HET: NAG NDG; 1.54A {Agkistrodon contortrix contortrix} PDB: 2aip_A* Back     alignment and structure
>3s69_A Thrombin-like enzyme defibrase; beta-barrel, serine enzymes, fibrinogen binding, glycosylati hydrolase; 1.43A {Gloydius saxatilis} PDB: 1op2_A* 1op0_A* 4gso_A 1bqy_A* Back     alignment and structure
>1ton_A Tonin; hydrolase(serine proteinase); 1.80A {Rattus rattus} SCOP: b.47.1.2 Back     alignment and structure
>1sgf_A 7S NGF, nerve growth factor; growth factor (beta-NGF), hydrolase - serine proteinase (GAM inactive serine proteinase (alpha-NGF); HET: NAG NDG; 3.15A {Mus musculus} SCOP: b.47.1.2 Back     alignment and structure
>2w7s_A Serine protease SPLA; hydrolase, family S1; 1.80A {Staphylococcus aureus} PDB: 2w7u_A Back     alignment and structure
>2qxi_A Kallikrein-7; S1 pocket, chloromethyl ketone, alternate conformations, alternative splicing, glycoprotein, hydrolase, protease, secreted; HET: K7J; 1.00A {Homo sapiens} PDB: 2qxg_A* 2qxh_A* 2qxj_A* 3bsq_A Back     alignment and structure
>2vid_A Serine protease SPLB; hydrolase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>2as9_A Serine protease; trypsin-like fold, hydrolase; 1.70A {Staphylococcus aureus} Back     alignment and structure
>3k6y_A Serine protease, possible membrane-associated serine protease; oxidative stress, disulfide, BENT helix, HY protease; 1.30A {Mycobacterium tuberculosis} PDB: 3k6z_A 3lt3_A Back     alignment and structure
>3syj_A Adhesion and penetration protein autotransporter; bacterial aggregation and biofilm formation, SELF-associatin autotransporter (SAAT); 2.20A {Haemophilus influenzae} Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>3tjo_A Serine protease HTRA1; peptidase, hydrolase; HET: BOG; 2.30A {Homo sapiens} PDB: 3tjn_A 3nwu_A Back     alignment and structure
>1l1j_A Heat shock protease HTRA; hydrolase, serine proteinase; 2.80A {Thermotoga maritima} SCOP: b.47.1.1 Back     alignment and structure
>2sga_A Proteinase A; hydrolase (serine proteinase); 1.50A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sgc_A 3sga_E* 4sga_E 5sga_E 2sfa_A Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3mmg_A Nuclear inclusion protein A; 3C-type protease, TEV, TVMV, viral protein, hydrolase; 1.70A {Tobacco vein mottling virus} SCOP: b.47.1.0 Back     alignment and structure
>3lgi_A Protease DEGS; stress-sensor, HTRA, PDZ OMP, hydrolase, serine PR; 1.65A {Escherichia coli} PDB: 2qf3_A 2qf0_A 2rce_A* 3lh3_A* 3b8j_A 2qgr_A 3lh1_A 3lgy_A 3lgu_A 3lgv_A 3lgw_A 3lgt_A 2r3u_A Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>4ash_A NS6 protease; hydrolase, trypsin-like, calicivirus; 1.58A {Murine norovirus 1} Back     alignment and structure
>2qa9_E Streptogrisin-B; chymotrypsin-type serine peptidase, second tetrahedral inter tetrapeptide, beta barrels, alpha helix, hydrolase; HET: GOL; 1.18A {Streptomyces griseus} SCOP: b.47.1.1 PDB: 1sge_E 1sgn_E 1sgy_E 1sgd_E 2nu0_E 2nu1_E 2gkv_E 2nu3_E 2nu4_E 2nu2_E* 2qaa_A* 2sgd_E 2sge_E 2sgf_E 2sgp_E 2sgq_E 3sgq_E 1sgp_E 1cso_E 1ct0_E ... Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1lvm_A Catalytic domain of the nuclear inclusion protein A (NIA); beta barrel, chymotrypsin-type cystein protease, enzyme- peptide complex; 1.80A {Tobacco etch virus} SCOP: b.47.1.3 PDB: 1lvb_A 1q31_A Back     alignment and structure
>2fyq_A Chymotrypsin-like cysteine proteinase; protease, norovirus, calicivirus, viral protein; 1.50A {Norwalk virus} PDB: 2fyr_A 2iph_A* 1wqs_A* Back     alignment and structure
>3sti_A Protease DEGQ; serine protease, PDZ domain, chaperone, hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>2bhg_A Foot-and-mouth disease virus 3C protease; chymotrypsin-like cysteine protease, capsid protein, core protein; 1.9A {Foot-and-mouth disease virus} SCOP: b.47.1.4 PDB: 2j92_A 2wv4_A 2wv5_A Back     alignment and structure
>1zyo_A Serine protease; beta-barrel, glutamyl endopeptidase, hydrolase; 2.40A {Sesbania mosaic virus} Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>1mbm_A NSP4 proteinase, chymotrypsin-like serine protease; serine proteinase, chymotrypsin-like proteinase, collapsed O HOLE, transferase; 2.00A {Equine arteritis virus} SCOP: b.47.1.3 Back     alignment and structure
>3h09_A IGA1 protease, immunoglobulin A1 protease; serine protease, beta helix, hydrolase, M protease, secreted, transmembrane, virulence; 1.75A {Haemophilus influenzae} Back     alignment and structure
>3sze_A Serine protease ESPP; parallel beta-helix, hydrolase; 2.50A {Escherichia coli O157} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 384
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 3e-48
d1xx9a_237 b.47.1.2 (A:) Coagulation factor XI {Human (Homo s 2e-13
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 5e-48
d2f91a1237 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed c 5e-13
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 3e-47
d1ekbb_235 b.47.1.2 (B:) Enteropeptidase (enterokinase light 6e-13
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 9e-47
d1z8ga1255 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Hum 5e-14
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 2e-44
g2pka.1232 b.47.1.2 (A:,B:) Kallikrein A {Pig (Sus scrofa) [T 2e-12
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 2e-44
d1hj8a_222 b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon 7e-12
d1ao5a_237 b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) 7e-44
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 1e-43
d1rfna_235 b.47.1.2 (A:) Coagulation factor IXa, protease dom 8e-13
d1rrka1287 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens 6e-43
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 8e-43
d2fpza1243 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sap 6e-14
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 8e-43
d1sgfa_228 b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus 4e-10
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 6e-42
d1eaxa_241 b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapien 3e-13
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 3e-41
d1mzaa_240 b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [Ta 8e-13
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 4e-41
d1j16a_223 b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicu 5e-12
g1rtf.1260 b.47.1.2 (A:,B:) Two-chain tissue plasminogen acti 8e-41
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 9e-41
g1gj7.1256 b.47.1.2 (A:,B:) Urokinase-type plasminogen activa 4e-13
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 1e-40
d1pytd_251 b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Co 7e-10
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 8e-40
g1h8d.1289 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [T 5e-13
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 9e-40
d2p3ub1233 b.47.1.2 (B:16-243) Coagulation factor Xa, proteas 3e-12
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 1e-39
d1fxya_228 b.47.1.2 (A:) Coagulation factor Xa-trypsin chimer 1e-11
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 1e-39
d1autc_240 b.47.1.2 (C:) Activated protein c (autoprothrombin 1e-12
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 2e-39
d2bz6h1254 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human 4e-14
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 3e-39
d1lo6a_221 b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [ 7e-12
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 3e-39
g1gg6.1238 b.47.1.2 (A:,B:,C:) (alpha,gamma)-chymotrypsin(oge 2e-10
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 4e-39
d1rjxb_247 b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Hum 6e-13
d1tona_235 b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 1 5e-39
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 1e-38
d1gvkb_240 b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9 4e-13
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 2e-38
d1npma_225 b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [Tax 4e-11
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 7e-38
d1fona_232 b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III 2e-12
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 1e-36
d1gdna_224 b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxyspo 3e-12
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 4e-36
d1q3xa1242 b.47.1.2 (A:445-686) Mannan-binding lectin serine 1e-13
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 8e-36
d1orfa_232 b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [Ta 5e-12
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 2e-35
g1fiw.1274 b.47.1.2 (L:,A:) Beta-acrosin {Sheep (Ovis aries) 2e-12
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 2e-35
d1hj9a_223 b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [Tax 8e-12
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 3e-35
d1si5h_234 b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human 7e-13
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 3e-35
d1fi8a_227 b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) 4e-11
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 4e-35
d1elta_236 b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxI 5e-13
d1gvza_237 b.47.1.2 (A:) Prostate specific antigen (PSA kalli 1e-33
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 3e-33
d1bioa_228 b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxI 6e-13
d3rp2a_224 b.47.1.2 (A:) Chymase II (mast cell proteinase II) 4e-33
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 4e-33
d1m9ua_241 b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [Tax 6e-14
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 5e-33
d2qy0b1240 b.47.1.2 (B:447-686) Complement C1R protease, cata 9e-13
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 7e-33
d1brup_241 b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9 3e-13
d1arba_263 b.47.1.1 (A:) Achromobacter protease {Achromobacte 1e-32
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 5e-32
d1op0a_234 b.47.1.2 (A:) Venom serine protease {Hundred-pace 2e-12
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 2e-31
d1eufa_224 b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 8e-11
d1nn6a_224 b.47.1.2 (A:) Chymase (mast cell protease I) {Huma 5e-31
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 1e-30
d1azza_226 b.47.1.2 (A:) Crab collagenase {Atlantic sand fidd 1e-12
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 5e-30
d1os8a_223 b.47.1.1 (A:) Trypsin {Streptomyces griseus, strai 6e-12
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 6e-30
d1fq3a_227 b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [Ta 8e-12
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 1e-28
d1eq9a_222 b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Re 2e-12
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 1e-28
d1t32a1224 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapie 3e-11
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 6e-28
d1fuja_221 b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapie 6e-12
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 2e-27
d1elva1259 b.47.1.2 (A:410-668) Complement C1S protease, cata 5e-10
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 4e-27
d1a7sa_225 b.47.1.2 (A:) Heparin binding protein, HBP {Human 8e-13
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 8e-27
d2z7fe1218 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) 1e-12
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 5e-22
d2hlca_230 b.47.1.2 (A:) HL collagenase {Common cattle grub ( 3e-11
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 2e-21
d1p3ca_215 b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus int 3e-07
d1hpga_187 b.47.1.1 (A:) Glutamic acid-specific protease {Str 9e-14
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 3e-12
d2o8la1216 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aur 1e-06
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 1e-06
d1agja_242 b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A 0.002
d1qtfa_246 b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus 4e-06
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure

class: All beta proteins
fold: Trypsin-like serine proteases
superfamily: Trypsin-like serine proteases
family: Eukaryotic proteases
domain: Coagulation factor XI
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  161 bits (408), Expect = 3e-48
 Identities = 73/226 (32%), Positives = 114/226 (50%), Gaps = 5/226 (2%)

Query: 154 IQVRSSTGQGEHQCGGAIISDTVILTAAHCLQGISKSKLRIIVGKHNLNGVDKFEKTFKV 213
           + + +++    H CGG+II +  ILTAAHC  G+   K+  +          K + +F  
Sbjct: 16  VTLHTTSPTQRHLCGGSIIGNQWILTAAHCFYGVESPKILRVYSGILNQSEIKEDTSFFG 75

Query: 214 EKAVLHHRFRKEGTHSNDIAVVKIRGNIEFNQYVQPICIPDRDNAAASDWCVVTGWGAQN 273
            + ++ H   K      DIA++K+   + +    +PIC+P + +     +      G   
Sbjct: 76  VQEIIIHDQYKMAESGYDIALLKLETTVNYTDSQRPICLPSKGDRN-VIYTDCWVTGWGY 134

Query: 274 AESIDDISNTLRAATVKVIDQNTCRSSAVYGNSNQNILDSMLCAGYLNGGIDACGGDSGG 333
            +  D I NTL+ A + ++    C+           I   M+CAGY  GG DAC GDSGG
Sbjct: 135 RKLRDKIQNTLQKAKIPLVTNEECQKR----YRGHKITHKMICAGYREGGKDACKGDSGG 190

Query: 334 PLACKIGGRFVLSGVVSWGDGCAKKNKPGVYTRVSYYTKWINDRIQ 379
           PL+CK    + L G+ SWG+GCA++ +PGVYT V  Y  WI ++ Q
Sbjct: 191 PLSCKHNEVWHLVGITSWGEGCAQRERPGVYTNVVEYVDWILEKTQ 236


>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Length = 237 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Length = 237 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Length = 235 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 255 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Length = 222 Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Length = 237 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 235 Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Length = 287 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Length = 243 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Length = 228 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 241 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 223 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 251 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Length = 233 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Length = 228 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 247 Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Length = 235 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 240 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Length = 225 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Length = 224 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Length = 232 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Length = 223 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Length = 234 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 227 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Length = 236 Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Length = 237 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Length = 224 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Length = 241 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 240 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Length = 241 Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Length = 263 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Length = 234 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Length = 224 Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Length = 226 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Length = 223 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Length = 227 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Length = 222 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Length = 224 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 259 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Length = 225 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Length = 230 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Length = 215 Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Length = 187 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Length = 216 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Length = 242 Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Length = 246 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query384
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 100.0
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 100.0
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 100.0
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 100.0
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 100.0
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 100.0
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 100.0
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 100.0
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 100.0
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 100.0
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 100.0
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 100.0
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 100.0
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 100.0
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 100.0
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 100.0
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 100.0
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 100.0
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 100.0
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 100.0
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 100.0
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 100.0
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 100.0
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 100.0
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 100.0
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 100.0
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 100.0
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 100.0
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 100.0
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 100.0
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 100.0
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 100.0
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 100.0
d1elva1259 Complement C1S protease, catalytic domain {Human ( 100.0
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 100.0
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 100.0
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 100.0
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 100.0
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 100.0
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 100.0
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 100.0
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 100.0
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 100.0
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 100.0
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 99.93
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.93
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 99.75
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 99.74
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 99.7
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 99.42
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 99.25
d1arba_263 Achromobacter protease {Achromobacter lyticus, str 99.05
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 99.0
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.85
d1fuja_221 Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 96 98.82
d2hlca_230 HL collagenase {Common cattle grub (Hypoderma line 98.79
d1xx9a_237 Coagulation factor XI {Human (Homo sapiens) [TaxId 98.78
d1ao5a_237 Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090] 98.76
d2fpza1243 beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1mzaa_240 Granzyme K {Human (Homo sapiens) [TaxId: 9606]} 98.74
d1bioa_228 Factor D {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1a7sa_225 Heparin binding protein, HBP {Human (Homo sapiens) 98.73
d1fq3a_227 Granzyme B {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1orfa_232 Granzyme A {Human (Homo sapiens) [TaxId: 9606]} 98.73
d1m9ua_241 Elastase {Worm (Eisenia fetida) [TaxId: 6396]} 98.72
d1hj8a_222 Trypsin(ogen) {North atlantic salmon (Salmo salar) 98.72
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 98.71
d1lcya2205 Mitochondrial serine protease HtrA2, catalytic dom 98.7
d1npma_225 Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} 98.7
d1j16a_223 Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 101 98.69
d1gvkb_240 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 98.69
d1l1ja_228 Protease Do (DegP, HtrA), catalytic domain {Thermo 98.67
d1tona_235 Tonin {Rat (Rattus rattus) [TaxId: 10117]} 98.67
d1fxya_228 Coagulation factor Xa-trypsin chimera {Synthetic, 98.66
d2bz6h1254 Coagulation factor VIIa {Human (Homo sapiens) [Tax 98.66
g1gj7.1256 Urokinase-type plasminogen activator (LMW U-PA), c 98.66
d2z7fe1218 Elastase {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1lo6a_221 Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1gdna_224 Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5 98.65
d1ky9a2249 Protease Do (DegP, HtrA), catalytic domain {Escher 98.64
d1autc_240 Activated protein c (autoprothrombin IIa) {Human ( 98.64
d1hj9a_223 Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} 98.63
d1azza_226 Crab collagenase {Atlantic sand fiddler crab (Uca 98.63
d2f91a1237 Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus 98.63
g2pka.1232 Kallikrein A {Pig (Sus scrofa) [TaxId: 9823]} 98.63
d2qf3a1210 Stress sensor protease DegS, catalytic domain {Esc 98.62
d1op0a_234 Venom serine protease {Hundred-pace snake (Agkistr 98.62
d1rfna_235 Coagulation factor IXa, protease domain {Human (Ho 98.61
d1rjxb_247 Plasmin(ogen), catalytic domain {Human (Homo sapie 98.61
d1ekbb_235 Enteropeptidase (enterokinase light chain) {Cow (B 98.61
d1gvza_237 Prostate specific antigen (PSA kallikrein) {Horse 98.61
d1eq9a_222 (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (So 98.61
d1q3xa1242 Mannan-binding lectin serine protease 2 (MASP-2), 98.61
g1gg6.1238 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 98.6
d2p3ub1233 Coagulation factor Xa, protease domain {Human (Hom 98.6
d1eaxa_241 Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 960 98.6
d1z8ga1255 Hepsin, catalytic domain {Human (Homo sapiens) [Ta 98.59
g1fiw.1274 Beta-acrosin {Sheep (Ovis aries) [TaxId: 9940]} 98.59
d1brup_241 Elastase {Pig (Sus scrofa) [TaxId: 9823]} 98.59
d1pytd_251 (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) 98.59
g1rtf.1260 Two-chain tissue plasminogen activator (TC)-T-PA { 98.58
g1h8d.1289 Thrombin {Human (Homo sapiens) [TaxId: 9606]} 98.56
d1si5h_234 Hepatocyte growth factor, HGF {Human (Homo sapiens 98.54
d1os8a_223 Trypsin {Streptomyces griseus, strain k1 [TaxId: 1 98.53
d1elta_236 Elastase {Salmon (Salmo salar) [TaxId: 8030]} 98.51
d2qy0b1240 Complement C1R protease, catalytic domain {Human ( 98.49
d1rrka1287 Factor B {Human (Homo sapiens) [TaxId: 9606]} 98.47
d1fona_232 Procarboxypeptidase A-S6 subunit III (zymogen E) { 98.43
d1elva1259 Complement C1S protease, catalytic domain {Human ( 98.41
d1sgfa_228 7S NGF protease subunits {Mouse (Mus musculus) [Ta 98.28
d1lvmb_219 TEV protease (nucleat inclusion protein A, NIA) {T 98.27
d2bhga1199 3C cysteine protease (picornain 3C) {Foot-and-mout 98.2
d1t32a1224 Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} 98.18
d1eufa_224 Duodenase {Cow (Bos taurus) [TaxId: 9913]} 98.17
d2o8la1216 V8 protease {Staphylococcus aureus [TaxId: 1280]} 98.16
d3rp2a_224 Chymase II (mast cell proteinase II) {Rat (Rattus 98.02
d1fi8a_227 Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116] 98.02
d1p3ca_215 Glutamyl endopeptidase {Bacillus intermedius [TaxI 97.98
d1nn6a_224 Chymase (mast cell protease I) {Human (Homo sapien 97.84
d1agja_242 Epidermolytic (exfoliative) toxin A {Staphylococcu 97.27
d1cqqa_180 3C cysteine protease (picornain 3C) {Human rhinovi 96.65
d1qtfa_246 Exfoliative toxin B {Staphylococcus aureus [TaxId: 96.33
d1hpga_187 Glutamic acid-specific protease {Streptomyces gris 96.11
d2h5ca1198 alpha-Lytic protease {Lysobacter enzymogenes, 495 90.1
d2h6ma1212 3C cysteine protease (picornain 3C) {Human hepatit 89.86
d1l1na_180 3C cysteine protease (picornain 3C) {Human poliovi 86.33
d2qaaa1185 Protease B {Streptomyces griseus, strain k1 [TaxId 85.27
d2z9ia2221 Protease PepD {Mycobacterium tuberculosis [TaxId: 82.98
d2sgaa_181 Protease A {Streptomyces griseus, strain k1 [TaxId 82.57
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1arba_ b.47.1.1 (A:) Achromobacter protease {Achromobacter lyticus, strain m497-1 [TaxId: 224]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fuja_ b.47.1.2 (A:) Myeloblastin, PR3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hlca_ b.47.1.2 (A:) HL collagenase {Common cattle grub (Hypoderma lineatum) [TaxId: 7389]} Back     information, alignment and structure
>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ao5a_ b.47.1.2 (A:) Kallikrein-13 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fpza1 b.47.1.2 (A:16-244) beta-Tryptase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mzaa_ b.47.1.2 (A:) Granzyme K {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bioa_ b.47.1.2 (A:) Factor D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7sa_ b.47.1.2 (A:) Heparin binding protein, HBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fq3a_ b.47.1.2 (A:) Granzyme B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orfa_ b.47.1.2 (A:) Granzyme A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9ua_ b.47.1.2 (A:) Elastase {Worm (Eisenia fetida) [TaxId: 6396]} Back     information, alignment and structure
>d1hj8a_ b.47.1.2 (A:) Trypsin(ogen) {North atlantic salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d1lcya2 b.47.1.1 (A:6-210) Mitochondrial serine protease HtrA2, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1npma_ b.47.1.2 (A:) Neuropsin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gvkb_ b.47.1.2 (B:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1l1ja_ b.47.1.1 (A:) Protease Do (DegP, HtrA), catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1tona_ b.47.1.2 (A:) Tonin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fxya_ b.47.1.2 (A:) Coagulation factor Xa-trypsin chimera {Synthetic, based on Homo sapiens sequence} Back     information, alignment and structure
>d2bz6h1 b.47.1.2 (H:16-257) Coagulation factor VIIa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z7fe1 b.47.1.2 (E:16-243) Elastase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lo6a_ b.47.1.2 (A:) Kallikrein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gdna_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ky9a2 b.47.1.1 (A:11-259) Protease Do (DegP, HtrA), catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1autc_ b.47.1.2 (C:) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hj9a_ b.47.1.2 (A:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1azza_ b.47.1.2 (A:) Crab collagenase {Atlantic sand fiddler crab (Uca pugilator) [TaxId: 6772]} Back     information, alignment and structure
>d2f91a1 b.47.1.2 (A:16-244) Trypsin(ogen) {Narrow-clawed crayfish (Pontastacus leptodactylus) [TaxId: 6717]} Back     information, alignment and structure
>d2qf3a1 b.47.1.1 (A:43-252) Stress sensor protease DegS, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1op0a_ b.47.1.2 (A:) Venom serine protease {Hundred-pace snake (Agkistrodon acutus) [TaxId: 36307]} Back     information, alignment and structure
>d1rfna_ b.47.1.2 (A:) Coagulation factor IXa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjxb_ b.47.1.2 (B:) Plasmin(ogen), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ekbb_ b.47.1.2 (B:) Enteropeptidase (enterokinase light chain) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gvza_ b.47.1.2 (A:) Prostate specific antigen (PSA kallikrein) {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1eq9a_ b.47.1.2 (A:) (alpha,gamma)-chymotrypsin(ogen) {Red fire ant (Solenopsis invicta) [TaxId: 13686]} Back     information, alignment and structure
>d1q3xa1 b.47.1.2 (A:445-686) Mannan-binding lectin serine protease 2 (MASP-2), catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ub1 b.47.1.2 (B:16-243) Coagulation factor Xa, protease domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaxa_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z8ga1 b.47.1.2 (A:163-417) Hepsin, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1brup_ b.47.1.2 (P:) Elastase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pytd_ b.47.1.2 (D:) (alpha,gamma)-chymotrypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1si5h_ b.47.1.2 (H:) Hepatocyte growth factor, HGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1os8a_ b.47.1.1 (A:) Trypsin {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d1elta_ b.47.1.2 (A:) Elastase {Salmon (Salmo salar) [TaxId: 8030]} Back     information, alignment and structure
>d2qy0b1 b.47.1.2 (B:447-686) Complement C1R protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rrka1 b.47.1.2 (A:453-739) Factor B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fona_ b.47.1.2 (A:) Procarboxypeptidase A-S6 subunit III (zymogen E) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1elva1 b.47.1.2 (A:410-668) Complement C1S protease, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgfa_ b.47.1.2 (A:) 7S NGF protease subunits {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lvmb_ b.47.1.3 (B:) TEV protease (nucleat inclusion protein A, NIA) {Tobacco etch virus, TEV [TaxId: 12227]} Back     information, alignment and structure
>d2bhga1 b.47.1.4 (A:7-205) 3C cysteine protease (picornain 3C) {Foot-and-mouth disease virus FMDV [TaxId: 12110]} Back     information, alignment and structure
>d1t32a1 b.47.1.2 (A:16-244) Cathepsin G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eufa_ b.47.1.2 (A:) Duodenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2o8la1 b.47.1.1 (A:1-216) V8 protease {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3rp2a_ b.47.1.2 (A:) Chymase II (mast cell proteinase II) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1fi8a_ b.47.1.2 (A:) Granzyme B {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1p3ca_ b.47.1.1 (A:) Glutamyl endopeptidase {Bacillus intermedius [TaxId: 1400]} Back     information, alignment and structure
>d1nn6a_ b.47.1.2 (A:) Chymase (mast cell protease I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1agja_ b.47.1.1 (A:) Epidermolytic (exfoliative) toxin A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1cqqa_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human rhinovirus 2 [TaxId: 12130]} Back     information, alignment and structure
>d1qtfa_ b.47.1.1 (A:) Exfoliative toxin B {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1hpga_ b.47.1.1 (A:) Glutamic acid-specific protease {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2h5ca1 b.47.1.1 (A:15A-245) alpha-Lytic protease {Lysobacter enzymogenes, 495 [TaxId: 69]} Back     information, alignment and structure
>d2h6ma1 b.47.1.4 (A:1-212) 3C cysteine protease (picornain 3C) {Human hepatitis A virus [TaxId: 208726]} Back     information, alignment and structure
>d1l1na_ b.47.1.4 (A:) 3C cysteine protease (picornain 3C) {Human poliovirus 1 Mahoney [TaxId: 12081]} Back     information, alignment and structure
>d2qaaa1 b.47.1.1 (A:16-242) Protease B {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure
>d2z9ia2 b.47.1.1 (A:6-226) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2sgaa_ b.47.1.1 (A:) Protease A {Streptomyces griseus, strain k1 [TaxId: 1911]} Back     information, alignment and structure