Psyllid ID: psy17442

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MRFDVKFSPSTVVRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVHLNN
ccccccccHHHHHHHHcccccEEEEEHHHHHHHHHccccEEEEccccccccEEEEEcccccccHHHHHHHHHcccccHHHHHHHHHcccc
cccccccHHHHHHHHHcccccEEEEEHHHHHHHHcccccEEEEcEEEEccccEEEEcccccccccccHHHHHHccccHHHHHHHHHHHcc
mrfdvkfspstvvrhGTKKLMAFIWDSSRLDFEAAQDCElvtagelfgrsgyaiglqkgspwadAVTLAILDFHESTVCYLFMAKVHLNN
mrfdvkfspstvvrhgtkKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVHLNN
MRFDVKFSPSTVVRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVHLNN
**********TVVRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVH***
***************GTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVHL**
************VRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVHLNN
**FDVKFSPSTVVRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVHLN*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRFDVKFSPSTVVRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFMAKVHLNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query90 2.2.26 [Sep-21-2011]
B4MU83 982 Glutamate [NMDA] receptor N/A N/A 0.644 0.059 0.879 1e-25
B3P2E5 997 Glutamate [NMDA] receptor N/A N/A 0.711 0.064 0.794 1e-25
B4QWW7 997 Glutamate [NMDA] receptor N/A N/A 0.711 0.064 0.794 1e-25
B4I414 997 Glutamate [NMDA] receptor N/A N/A 0.711 0.064 0.794 1e-25
B4PVB0 997 Glutamate [NMDA] receptor N/A N/A 0.711 0.064 0.794 1e-25
B3LZ39 994 Glutamate [NMDA] receptor N/A N/A 0.711 0.064 0.794 1e-25
Q24418 997 Glutamate [NMDA] receptor yes N/A 0.711 0.064 0.794 1e-25
B4JHV0 982 Glutamate [NMDA] receptor N/A N/A 0.711 0.065 0.794 2e-25
B4KD90 980 Glutamate [NMDA] receptor N/A N/A 0.711 0.065 0.794 2e-25
B4GF83 1004 Glutamate [NMDA] receptor N/A N/A 0.711 0.063 0.764 4e-25
>sp|B4MU83|NMDA1_DROWI Glutamate [NMDA] receptor subunit 1 OS=Drosophila willistoni GN=Nmdar1 PE=3 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/58 (87%), Positives = 56/58 (96%)

Query: 19  KLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHES 76
           KLMAFIWDSSRL++EA++DCELVTAGELFGRSGY IGLQKGSPW DAVTLAIL+FHES
Sbjct: 728 KLMAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHES 785
NMDA receptor subtype of glutamate-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Mediated by glycine. This protein plays a key role in synaptic plasticity, synaptogenesis, excitotoxicity, memory acquisition and learning. It mediates neuronal functions in glutamate neurotransmission. Is involved in the cell surface targeting of NMDA receptors. Plays a role in associative learning and in long-term memory consolidation.
Drosophila willistoni (taxid: 7260)
>sp|B3P2E5|NMDA1_DROER Glutamate [NMDA] receptor subunit 1 OS=Drosophila erecta GN=Nmdar1 PE=3 SV=1 Back     alignment and function description
>sp|B4QWW7|NMDA1_DROSI Glutamate [NMDA] receptor subunit 1 OS=Drosophila simulans GN=Nmdar1 PE=3 SV=1 Back     alignment and function description
>sp|B4I414|NMDA1_DROSE Glutamate [NMDA] receptor subunit 1 OS=Drosophila sechellia GN=Nmdar1 PE=3 SV=1 Back     alignment and function description
>sp|B4PVB0|NMDA1_DROYA Glutamate [NMDA] receptor subunit 1 OS=Drosophila yakuba GN=Nmdar1 PE=3 SV=1 Back     alignment and function description
>sp|B3LZ39|NMDA1_DROAN Glutamate [NMDA] receptor subunit 1 OS=Drosophila ananassae GN=Nmdar1 PE=3 SV=1 Back     alignment and function description
>sp|Q24418|NMDA1_DROME Glutamate [NMDA] receptor subunit 1 OS=Drosophila melanogaster GN=Nmdar1 PE=1 SV=1 Back     alignment and function description
>sp|B4JHV0|NMDA1_DROGR Glutamate [NMDA] receptor subunit 1 OS=Drosophila grimshawi GN=Nmdar1 PE=3 SV=1 Back     alignment and function description
>sp|B4KD90|NMDA1_DROMO Glutamate [NMDA] receptor subunit 1 OS=Drosophila mojavensis GN=Nmdar1 PE=3 SV=1 Back     alignment and function description
>sp|B4GF83|NMDA1_DROPE Glutamate [NMDA] receptor subunit 1 OS=Drosophila persimilis GN=Nmdar1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
307189011 965 Glutamate [NMDA] receptor subunit zeta-1 0.644 0.060 0.965 4e-26
322787090 956 hypothetical protein SINV_00626 [Solenop 0.644 0.060 0.965 4e-26
332025508 962 Glutamate [NMDA] receptor subunit 1 [Acr 0.644 0.060 0.965 5e-26
242006424 940 N-methyl-D-aspartate receptor, putative 0.688 0.065 0.890 7e-26
307214882 1001 Glutamate [NMDA] receptor subunit zeta-1 0.644 0.057 0.948 9e-26
379070096 383 putative ionotropic receptor iGluR, part 0.711 0.167 0.848 1e-25
357629457 924 putative NMDA-type glutamate receptor 1 0.711 0.069 0.848 2e-25
312384925 1756 hypothetical protein AND_01382 [Anophele 0.811 0.041 0.674 2e-25
91090776 946 PREDICTED: similar to NMDA-type glutamat 0.644 0.061 0.931 3e-25
68124058 317 NMDA-type glutamate receptor subunit 1, 0.644 0.182 0.948 5e-25
>gi|307189011|gb|EFN73528.1| Glutamate [NMDA] receptor subunit zeta-1 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  122 bits (305), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 56/58 (96%), Positives = 57/58 (98%)

Query: 19  KLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHES 76
           KLMAFIWDSSRL+FEAAQDCELVTAGELFGRSGY IGLQKGSPWADAVTLAILDFHES
Sbjct: 743 KLMAFIWDSSRLEFEAAQDCELVTAGELFGRSGYGIGLQKGSPWADAVTLAILDFHES 800

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|322787090|gb|EFZ13311.1| hypothetical protein SINV_00626 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332025508|gb|EGI65671.1| Glutamate [NMDA] receptor subunit 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242006424|ref|XP_002424050.1| N-methyl-D-aspartate receptor, putative [Pediculus humanus corporis] gi|212507356|gb|EEB11312.1| N-methyl-D-aspartate receptor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307214882|gb|EFN89750.1| Glutamate [NMDA] receptor subunit zeta-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|379070096|gb|AFC91759.1| putative ionotropic receptor iGluR, partial [Cydia pomonella] Back     alignment and taxonomy information
>gi|357629457|gb|EHJ78211.1| putative NMDA-type glutamate receptor 1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|312384925|gb|EFR29535.1| hypothetical protein AND_01382 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|91090776|ref|XP_969654.1| PREDICTED: similar to NMDA-type glutamate receptor 1 [Tribolium castaneum] gi|270013267|gb|EFA09715.1| hypothetical protein TcasGA2_TC011848 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|68124058|emb|CAJ09699.1| NMDA-type glutamate receptor subunit 1, variant 11 (NR1.11) [Apis mellifera carnica] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query90
UNIPROTKB|B4KD90 980 Nmdar1 "Glutamate [NMDA] recep 0.644 0.059 0.879 7.6e-23
UNIPROTKB|B4JHV0 982 Nmdar1 "Glutamate [NMDA] recep 0.644 0.059 0.879 7.6e-23
UNIPROTKB|B4MU83 982 Nmdar1 "Glutamate [NMDA] recep 0.644 0.059 0.879 7.6e-23
UNIPROTKB|B3LZ39 994 Nmdar1 "Glutamate [NMDA] recep 0.644 0.058 0.879 7.8e-23
FB|FBgn0010399 997 Nmdar1 "NMDA receptor 1" [Dros 0.644 0.058 0.879 7.8e-23
UNIPROTKB|B3P2E5 997 Nmdar1 "Glutamate [NMDA] recep 0.644 0.058 0.879 7.8e-23
UNIPROTKB|B4I414 997 Nmdar1 "Glutamate [NMDA] recep 0.644 0.058 0.879 7.8e-23
UNIPROTKB|B4PVB0 997 Nmdar1 "Glutamate [NMDA] recep 0.644 0.058 0.879 7.8e-23
UNIPROTKB|B4QWW7 997 Nmdar1 "Glutamate [NMDA] recep 0.644 0.058 0.879 7.8e-23
UNIPROTKB|B4GF83 1004 Nmdar1 "Glutamate [NMDA] recep 0.644 0.057 0.844 2.1e-22
UNIPROTKB|B4KD90 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila mojavensis (taxid:7230)] Back     alignment and assigned GO terms
 Score = 276 (102.2 bits), Expect = 7.6e-23, P = 7.6e-23
 Identities = 51/58 (87%), Positives = 56/58 (96%)

Query:    19 KLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHES 76
             KLMAFIWDSSRL++EA++DCELVTAGELFGRSGY IGLQKGSPW DAVTLAIL+FHES
Sbjct:   737 KLMAFIWDSSRLEYEASKDCELVTAGELFGRSGYGIGLQKGSPWTDAVTLAILEFHES 794
GO:0004970 "ionotropic glutamate receptor activity" evidence=ISS
GO:0007268 "synaptic transmission" evidence=ISS
GO:0007616 "long-term memory" evidence=ISS
GO:0008355 "olfactory learning" evidence=ISS
GO:0017146 "N-methyl-D-aspartate selective glutamate receptor complex" evidence=ISS
GO:0035235 "ionotropic glutamate receptor signaling pathway" evidence=ISS
GO:0042391 "regulation of membrane potential" evidence=ISS
GO:0045211 "postsynaptic membrane" evidence=ISS
GO:0055074 "calcium ion homeostasis" evidence=ISS
UNIPROTKB|B4JHV0 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila grimshawi (taxid:7222)] Back     alignment and assigned GO terms
UNIPROTKB|B4MU83 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila willistoni (taxid:7260)] Back     alignment and assigned GO terms
UNIPROTKB|B3LZ39 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila ananassae (taxid:7217)] Back     alignment and assigned GO terms
FB|FBgn0010399 Nmdar1 "NMDA receptor 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B3P2E5 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila erecta (taxid:7220)] Back     alignment and assigned GO terms
UNIPROTKB|B4I414 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|B4PVB0 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|B4QWW7 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B4GF83 Nmdar1 "Glutamate [NMDA] receptor subunit 1" [Drosophila persimilis (taxid:7234)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5R1P0NMDZ1_CANFANo assigned EC number0.62060.64440.0615yesN/A
Q05586NMDZ1_HUMANNo assigned EC number0.62060.64440.0618yesN/A
Q296F7NMDA1_DROPSNo assigned EC number0.76470.71110.0637yesN/A
P35439NMDZ1_RATNo assigned EC number0.62060.64440.0618yesN/A
P35438NMDZ1_MOUSENo assigned EC number0.61010.65550.0628yesN/A
Q24418NMDA1_DROMENo assigned EC number0.79410.71110.0641yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 2e-22
pfam00060268 pfam00060, Lig_chan, Ligand-gated ion channel 5e-20
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information 
 Score = 83.9 bits (208), Expect = 2e-22
 Identities = 29/64 (45%), Positives = 39/64 (60%)

Query: 13  VRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILD 72
           V+       AFI +S  LD+E +++C+L+T GE FGR GY I   KGSP  D ++ AIL 
Sbjct: 57  VQRVRVSNYAFIMESPYLDYELSRNCDLMTVGEEFGRKGYGIAFPKGSPLRDDLSRAILK 116

Query: 73  FHES 76
             ES
Sbjct: 117 LSES 120

Prokaryotic homologues are represented by a separate alignment: PBPb. Length = 133
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 90
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 99.88
KOG1053|consensus 1258 99.8
KOG4440|consensus 993 99.76
PRK10797302 glutamate and aspartate transporter subunit; Provi 99.6
PRK09495247 glnH glutamine ABC transporter periplasmic protein 99.52
PRK11260266 cystine transporter subunit; Provisional 99.52
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 99.51
TIGR01096250 3A0103s03R lysine-arginine-ornithine-binding perip 99.48
PRK15007243 putative ABC transporter arginine-biding protein; 99.43
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 99.41
TIGR02285268 conserved hypothetical protein. Members of this fa 99.4
COG0834275 HisJ ABC-type amino acid transport/signal transduc 99.39
KOG1054|consensus 897 99.39
PRK15010260 ABC transporter lysine/arginine/ornithine binding 99.35
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 99.35
PRK15437259 histidine ABC transporter substrate-binding protei 99.29
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 99.29
KOG1052|consensus656 99.27
TIGR03870246 ABC_MoxJ methanol oxidation system protein MoxJ. T 99.21
smart00062219 PBPb Bacterial periplasmic substrate-binding prote 99.2
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.17
cd00134218 PBPb Bacterial periplasmic transport systems use m 99.16
TIGR03871232 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associa 99.15
PRK09959 1197 hybrid sensory histidine kinase in two-component r 99.0
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 98.52
PRK00489287 hisG ATP phosphoribosyltransferase; Reviewed 98.36
COG4623 473 Predicted soluble lytic transglycosylase fused to 98.16
TIGR03431288 PhnD phosphonate ABC transporter, periplasmic phos 98.16
PF12974243 Phosphonate-bd: ABC transporter, phosphonate, peri 96.94
PF03401274 TctC: Tripartite tricarboxylate transporter family 96.75
COG3221299 PhnD ABC-type phosphate/phosphonate transport syst 95.92
PF09084 216 NMT1: NMT1/THI5 like; InterPro: IPR015168 This ent 95.71
PRK11553314 alkanesulfonate transporter substrate-binding subu 95.66
COG3181319 Uncharacterized protein conserved in bacteria [Fun 95.15
smart00094 332 TR_FER Transferrin. 93.62
PF00405 330 Transferrin: Transferrin; InterPro: IPR001156 Tran 93.19
TIGR01256216 modA molybdenum ABC transporter, periplasmic molyb 92.99
PRK03537188 molybdate ABC transporter periplasmic molybdate-bi 92.83
TIGR01728 288 SsuA_fam ABC transporter, substrate-binding protei 92.49
PRK11553 314 alkanesulfonate transporter substrate-binding subu 92.24
TIGR01729300 taurine_ABC_bnd taurine ABC transporter, periplasm 90.75
PF12974 243 Phosphonate-bd: ABC transporter, phosphonate, peri 89.56
TIGR03261334 phnS2 putative 2-aminoethylphosphonate ABC transpo 89.31
TIGR01728288 SsuA_fam ABC transporter, substrate-binding protei 89.02
TIGR01729 300 taurine_ABC_bnd taurine ABC transporter, periplasm 88.81
PF03466209 LysR_substrate: LysR substrate binding domain; Int 88.13
PF14503232 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B. 87.24
TIGR00363 258 lipoprotein, YaeC family. This family of putative 87.14
COG1910223 Periplasmic molybdate-binding protein/domain [Inor 87.09
PF13531230 SBP_bac_11: Bacterial extracellular solute-binding 86.59
TIGR01098254 3A0109s03R phosphate/phosphite/phosphonate ABC tra 86.16
PF13379252 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_ 85.87
TIGR03427 328 ABC_peri_uca ABC transporter periplasmic binding p 84.82
PF14503232 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B. 84.67
TIGR03339279 phn_lysR aminoethylphosphonate catabolism associat 82.78
cd00134218 PBPb Bacterial periplasmic transport systems use m 82.13
COG0715 335 TauA ABC-type nitrate/sulfonate/bicarbonate transp 81.77
COG0725258 ModA ABC-type molybdate transport system, periplas 81.65
PRK10677257 modA molybdate transporter periplasmic protein; Pr 81.56
PF03180 237 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR0048 81.15
TIGR00787257 dctP tripartite ATP-independent periplasmic transp 80.34
PRK04168334 molybdate ABC transporter periplasmic substrate-bi 80.31
PRK00489 287 hisG ATP phosphoribosyltransferase; Reviewed 80.03
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information 
Probab=99.88  E-value=6.8e-22  Score=118.84  Aligned_cols=84  Identities=39%  Similarity=0.555  Sum_probs=79.3

Q ss_pred             ccCChHHHHHHhhcCCceEEEeehhHHhHHHhcCCCeEEeCCcccccceEEEEeCCCCChHHHHHHHHHhhhccHHHHHH
Q psy17442          4 DVKFSPSTVVRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFM   83 (90)
Q Consensus         4 ~~~~~~~~~~~l~~G~ida~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~ia~~kgs~l~~~vn~~l~~l~~~G~~~~l~   83 (90)
                      .+++.++++.+|++|+ ||++.|.+++.++++++|++.+++..+..++|||++|||++|++.||.+|.+|+++|+++++.
T Consensus        50 ~~~~~~~~~~~l~~g~-da~v~d~~~~~~~~~~~~~~~~~~~~~~~~~~~ia~~k~~~l~~~vn~~l~~l~~~G~~~~l~  128 (134)
T smart00079       50 FVKSYAEGVQRVRVSN-YAFLMESTYLDYELSQNCDLMTVGENFGRKGYGIAFPKGSPLRDDLSRAILKLSESGELQKLE  128 (134)
T ss_pred             CCCCHHHHHHHHHcCC-CEEEeehHhHHHHHhCCCCeEEcCcccCCCceEEEecCCCHHHHHHHHHHHHHHhcCcHHHHH
Confidence            4689999999999999 999999999999988788899998888889999999999999999999999999999999999


Q ss_pred             HHhcc
Q psy17442         84 AKVHL   88 (90)
Q Consensus        84 ~kW~~   88 (90)
                      +|||.
T Consensus       129 ~kw~~  133 (134)
T smart00079      129 NKWWK  133 (134)
T ss_pred             Hhhcc
Confidence            99985

Prokaryotic homologues are represented by a separate alignment: PBPb
>KOG1053|consensus Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK11260 cystine transporter subunit; Provisional Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>TIGR01096 3A0103s03R lysine-arginine-ornithine-binding periplasmic protein Back     alignment and domain information
>PRK15007 putative ABC transporter arginine-biding protein; Provisional Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>TIGR03870 ABC_MoxJ methanol oxidation system protein MoxJ Back     alignment and domain information
>smart00062 PBPb Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>TIGR03871 ABC_peri_MoxJ_2 quinoprotein dehydrogenase-associated probable ABC transporter substrate-binding protein Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information
>COG4623 Predicted soluble lytic transglycosylase fused to an ABC-type amino acid-binding protein [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03431 PhnD phosphonate ABC transporter, periplasmic phosphonate binding protein Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>PF03401 TctC: Tripartite tricarboxylate transporter family receptor; InterPro: IPR005064 Bordetella pertussis, the causative agent of human whooping cough (pertussis), is an obligate human pathogen with diverse high-affinity transport systems for the assimilation of iron, a biometal that is essential for growth [] Back     alignment and domain information
>COG3221 PhnD ABC-type phosphate/phosphonate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF09084 NMT1: NMT1/THI5 like; InterPro: IPR015168 This entry is found in the NMT1 and THI5 proteins Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>COG3181 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>smart00094 TR_FER Transferrin Back     alignment and domain information
>PF00405 Transferrin: Transferrin; InterPro: IPR001156 Transferrins are eukaryotic iron-binding glycoproteins that control the level of free iron in biological fluids [] Back     alignment and domain information
>TIGR01256 modA molybdenum ABC transporter, periplasmic molybdate-binding protein Back     alignment and domain information
>PRK03537 molybdate ABC transporter periplasmic molybdate-binding protein; Provisional Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>PRK11553 alkanesulfonate transporter substrate-binding subunit; Provisional Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PF12974 Phosphonate-bd: ABC transporter, phosphonate, periplasmic substrate-binding protein ; PDB: 3N5L_B 3QUJ_C 3P7I_A 3QK6_A 3S4U_A Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein Back     alignment and domain information
>TIGR01728 SsuA_fam ABC transporter, substrate-binding protein, aliphatic sulfonates family Back     alignment and domain information
>TIGR01729 taurine_ABC_bnd taurine ABC transporter, periplasmic binding protein Back     alignment and domain information
>PF03466 LysR_substrate: LysR substrate binding domain; InterPro: IPR005119 The structure of this domain is known and is similar to the periplasmic binding proteins [] Back     alignment and domain information
>PF14503 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B Back     alignment and domain information
>TIGR00363 lipoprotein, YaeC family Back     alignment and domain information
>COG1910 Periplasmic molybdate-binding protein/domain [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13531 SBP_bac_11: Bacterial extracellular solute-binding protein; PDB: 2HXW_B 3FJG_C 3FJM_B 3FJ7_B 3FIR_B 3AXF_C 1WOD_A 1AMF_A 3R26_A 1SBP_A Back     alignment and domain information
>TIGR01098 3A0109s03R phosphate/phosphite/phosphonate ABC transporters, periplasmic binding protein Back     alignment and domain information
>PF13379 NMT1_2: NMT1-like family; PDB: 2G29_A 3UN6_A 2I4C_A 2I49_A 2I4B_A 2I48_A 3QSL_A Back     alignment and domain information
>TIGR03427 ABC_peri_uca ABC transporter periplasmic binding protein, urea carboxylase region Back     alignment and domain information
>PF14503 YhfZ_C: YhfZ C-terminal domain; PDB: 2OZZ_B Back     alignment and domain information
>TIGR03339 phn_lysR aminoethylphosphonate catabolism associated LysR family transcriptional regulator Back     alignment and domain information
>cd00134 PBPb Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>COG0715 TauA ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0725 ModA ABC-type molybdate transport system, periplasmic component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10677 modA molybdate transporter periplasmic protein; Provisional Back     alignment and domain information
>PF03180 Lipoprotein_9: NLPA lipoprotein; InterPro: IPR004872 This family of bacterial lipoproteins contains several antigenic members, that may be involved in bacterial virulence Back     alignment and domain information
>TIGR00787 dctP tripartite ATP-independent periplasmic transporter solute receptor, DctP family Back     alignment and domain information
>PRK04168 molybdate ABC transporter periplasmic substrate-binding protein; Provisional Back     alignment and domain information
>PRK00489 hisG ATP phosphoribosyltransferase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
1pb8_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 1e-16
1pb7_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 1e-16
2a5s_A284 Crystal Structure Of The Nr2a Ligand Binding Core I 2e-11
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 6e-08
3oek_A286 Crystal Structure Of Glun2d Ligand-Binding Core In 1e-07
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-07
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-07
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-07
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-07
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 2e-07
2rc7_A294 Crystal Structure Of The Nr3a Ligand Binding Core C 3e-07
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 4e-07
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 4e-07
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 4e-07
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 4e-07
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 1e-06
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 1e-06
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 1e-06
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 2e-06
2v3u_A265 Structure Of The Ligand-binding Core Of The Ionotro 2e-06
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 2e-06
2v3t_A265 Structure Of The Ligand-Binding Core Of The Ionotro 2e-06
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 3e-06
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 3e-06
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 3e-06
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 3e-06
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 3e-06
2rca_B292 Crystal Structure Of The Nr3b Ligand Binding Core C 6e-06
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure 
Iteration: 1

 Score = 81.3 bits (199), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%)
Query: 19  KLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHES 76
           KL AFIWDS+ L+FEA+Q C+LVT GELF RSG+ IG++K SPW   V+L+IL  HE+
Sbjct: 217 KLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHEN 274
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3OEK|A Chain A, Crystal Structure Of Glun2d Ligand-Binding Core In Complex With L- Aspartate Length = 286 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2RC7|A Chain A, Crystal Structure Of The Nr3a Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 294 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2V3U|A Chain A, Structure Of The Ligand-binding Core Of The Ionotropic Glutamate Receptor-like Glurdelta2 In Complex With D- Serine Length = 265 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2V3T|A Chain A, Structure Of The Ligand-Binding Core Of The Ionotropic Glutamate Receptor-Like Glurdelta2 In The Apo Form Length = 265 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2RCA|B Chain B, Crystal Structure Of The Nr3b Ligand Binding Core Complex With Glycine At 1.58 Angstrom Resolution Length = 292 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query90
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 6e-17
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 2e-14
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 1e-13
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 7e-13
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 2e-11
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 4e-11
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-09
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 7e-09
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score = 72.9 bits (178), Expect = 6e-17
 Identities = 16/60 (26%), Positives = 26/60 (43%), Gaps = 1/60 (1%)

Query: 18  KKLMAFIWDSSRLDFEAAQ-DCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHES 76
           K   A++ +S+  ++   +  C+ +  G      GY I   KGS     V LA+L   E 
Sbjct: 688 KGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLGTPVNLAVLKLSEQ 747
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 99.79
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 99.74
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 99.73
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 99.72
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 99.71
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 99.71
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 99.7
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 99.67
3kzg_A237 Arginine 3RD transport system periplasmic binding 99.66
3del_B242 Arginine binding protein; alpha and beta protein ( 99.66
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 99.65
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 99.64
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 99.63
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 99.63
3k4u_A245 Binding component of ABC transporter; structural g 99.62
3qax_A268 Probable ABC transporter arginine-binding protein; 99.61
3hv1_A268 Polar amino acid ABC uptake transporter substrate 99.59
3kg2_A823 Glutamate receptor 2; ION channel, membrane protei 99.59
4eq9_A246 ABC transporter substrate-binding protein-amino A 99.59
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 99.58
3tql_A227 Arginine-binding protein; transport and binding pr 99.57
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 99.56
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 99.56
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 99.56
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 99.55
4i62_A269 Amino acid ABC transporter, periplasmic amino ACI 99.54
2yln_A283 Putative ABC transporter, periplasmic binding Pro 99.53
2vha_A287 Periplasmic binding transport protein; periplasmic 99.53
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 99.53
1xt8_A292 Putative amino-acid transporter periplasmic solut 99.53
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 99.51
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 99.49
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 99.46
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 99.45
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 99.42
2q88_A257 EHUB, putative ABC transporter amino acid-binding 99.4
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 99.25
3n5l_A310 Binding protein component of ABC phosphonate TRAN; 98.93
3p7i_A321 PHND, subunit of alkylphosphonate ABC transporter; 98.86
2f5x_A312 BUGD; periplasmic binding protein, transport prote 98.19
2qpq_A301 Protein BUG27; alpha/beta domain, venus flytrap, t 98.18
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 98.13
2dvz_A314 BUGE, putative exported protein; periplamsic bindi 98.07
2x26_A308 Periplasmic aliphatic sulphonates-binding protein; 97.05
3un6_A341 Hypothetical protein saouhsc_00137; structural gen 96.91
3ix1_A 302 N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine 95.21
3ksx_A 324 Nitrate transport protein; SSUA, alkanesulfonate-b 95.02
1zbm_A280 Hypothetical protein AF1704; alpha-beta protein, s 94.97
3lr1_A236 Tungstate ABC transporter, periplasmic tungstate- 94.85
3ksx_A324 Nitrate transport protein; SSUA, alkanesulfonate-b 94.84
3muq_A237 Uncharacterized conserved protein; structural geno 94.65
3un6_A 341 Hypothetical protein saouhsc_00137; structural gen 94.58
3qsl_A 346 Putative exported protein; unknown, structural gen 94.55
3uif_A 348 Sulfonate ABC transporter, periplasmic sulfonate- 94.52
1h45_A 334 Lactoferrin; metal transport, iron transport, meta 94.13
3qsl_A346 Putative exported protein; unknown, structural gen 93.93
4esw_A 342 Pyrimidine biosynthesis enzyme THI13; thiamin pyri 93.87
1ryo_A 327 Serotransferrin; iron transport, metal transport; 93.5
1iej_A 332 Ovotransferrin; iron, metal binding protein; 1.65A 92.98
2x26_A 308 Periplasmic aliphatic sulphonates-binding protein; 92.87
3uif_A 348 Sulfonate ABC transporter, periplasmic sulfonate- 92.82
2x7q_A321 Ca3427, possible thiamine biosynthesis enzyme; unk 92.54
2de3_A365 Dibenzothiophene desulfurization enzyme B; alpha-b 92.29
4edp_A351 ABC transporter, substrate-binding protein; clostr 92.2
2g29_A 417 Nitrate transport protein NRTA; solute-binding pro 91.93
1blf_A 689 Lactoferrin; transferrin, iron-binding protein, ca 91.75
2xxp_A 398 CPS2A; replication, peptidoglycan, LCP, LYTR; HET: 91.69
1cb6_A 691 Protein (lactoferrin); iron transport, apolactofer 91.62
2d3i_A 686 Ovotransferrin; aluminum, metal-binding, transport 91.38
3v83_A 698 Serotransferrin; iron binding domain, iron carrier 91.02
2x7q_A 321 Ca3427, possible thiamine biosynthesis enzyme; unk 90.92
3up9_A 245 Putative uncharacterized protein; membrane lipopro 90.81
3l6g_A 256 Betaine ABC transporter permease and substrate BI 90.59
3skp_A 342 Serotransferrin; iron binding protein, transferrin 90.38
3tmg_A 280 Glycine betaine, L-proline ABC transporter, glycin 90.17
2ozz_A231 Hypothetical protein YHFZ; alpha-beta structure, s 89.82
3r26_A237 Molybdate-binding periplasmic protein; protein bin 89.51
4i1d_A324 ABC transporter substrate-binding protein; structu 89.46
3gxa_A 275 Outer membrane lipoprotein GNA1946; periplasmic, L 89.31
1blf_A 689 Lactoferrin; transferrin, iron-binding protein, ca 89.31
3v83_A 698 Serotransferrin; iron binding domain, iron carrier 89.21
3rpw_A365 ABC transporter; structural genomics, PSI-biology, 88.72
3gzg_A253 Molybdate-binding periplasmic protein; permease; m 88.29
1cb6_A 691 Protein (lactoferrin); iron transport, apolactofer 88.2
4euo_A320 ABC transporter, substrate binding protein (polya; 88.12
2b4l_A268 Glycine betaine-binding protein; substrate-binding 86.76
4ib2_A 252 Putative lipoprotein; putative methionine-bindning 86.14
2d3i_A 686 Ovotransferrin; aluminum, metal-binding, transport 86.0
3ir1_A 245 Outer membrane lipoprotein GNA1946; D-methionine c 85.98
3p7i_A 321 PHND, subunit of alkylphosphonate ABC transporter; 85.95
3mc2_A 687 Inhibitor of carbonic anhydrase; MICA, transferrin 85.86
3k2d_A 237 ABC-type metal ION transport system, periplasmic; 85.23
3n5l_A 310 Binding protein component of ABC phosphonate TRAN; 84.78
1us5_A314 Putative GLUR0 ligand binding core; receptor, memb 84.74
1ryo_A327 Serotransferrin; iron transport, metal transport; 84.27
3tqw_A 240 Methionine-binding protein; transport and binding 83.98
4ddd_A 327 Immunogenic protein; ssgcid, structural genomics, 83.9
4eqb_A330 Spermidine/putrescine ABC superfamily ATP binding 83.87
3tod_A 335 Lactotransferrin; C-LOBE, metal binding protein, 1 82.69
4ef1_A 246 Pheromone COB1/lipoprotein, YAEC family; periplasm 82.19
1xs5_A 241 29 kDa protein, membrane lipoprotein TPN32; peripl 82.17
3kn3_A 242 Putative periplasmic protein; alpha-beta structure 82.13
3hn0_A283 Nitrate transport protein; ABC transporter, struct 81.65
1us5_A 314 Putative GLUR0 ligand binding core; receptor, memb 81.46
2rin_A 298 Putative glycine betaine-binding ABC transporter p 80.97
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
Probab=99.79  E-value=9.4e-19  Score=115.59  Aligned_cols=86  Identities=42%  Similarity=0.676  Sum_probs=81.3

Q ss_pred             ccCChHHHHHHhhcCCceEEEeehhHHhHHHhcCCCeEEeCCcccccceEEEEeCCCCChHHHHHHHHHhhhccHHHHHH
Q psy17442          4 DVKFSPSTVVRHGTKKLMAFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHESTVCYLFM   83 (90)
Q Consensus         4 ~~~~~~~~~~~l~~G~ida~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~ia~~kgs~l~~~vn~~l~~l~~~G~~~~l~   83 (90)
                      .+++..+++.+|.+|++||++.|.+.+.++++++|++.+++..+...+|+|+++|+++|++.||.+|.+|+++|++++|.
T Consensus       202 ~~~~~~~~~~~l~~G~vDa~i~d~~~~~~~~~~~~~l~~~~~~~~~~~~~ia~~k~~~l~~~in~al~~l~~~G~~~~l~  281 (292)
T 1pb7_A          202 NYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLD  281 (292)
T ss_dssp             CBSSHHHHHHHHHTTSCSEEEEEHHHHHHHHHHCTTEEECSSCSEEEEECCEEETTCSSHHHHHHHHHHHHHSSHHHHHH
T ss_pred             cCCCHHHHHHHHHcCCceEEEEcHHHHHHHHhcCCCEEEcCccccCCceEEEEeCCCHHHHHHHHHHHHHHhCCCHHHHH
Confidence            57889999999999999999999999999998889999998888889999999999999999999999999999999999


Q ss_pred             HHhccC
Q psy17442         84 AKVHLN   89 (90)
Q Consensus        84 ~kW~~~   89 (90)
                      +||+..
T Consensus       282 ~kw~~~  287 (292)
T 1pb7_A          282 KTWVRY  287 (292)
T ss_dssp             HHHTSS
T ss_pred             HhhCCC
Confidence            999964
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} SCOP: c.94.1.0 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>4i62_A Amino acid ABC transporter, periplasmic amino ACI protein, putative; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases (NIAI niaid; HET: ARG; 1.05A {Streptococcus pneumoniae} Back     alignment and structure
>2yln_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-BIND protein; HET: CYS GOL; 1.12A {Neisseria gonorrhoeae} PDB: 3zsf_A Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>2f5x_A BUGD; periplasmic binding protein, transport protein; 1.72A {Bordetella pertussis tohama I} Back     alignment and structure
>2qpq_A Protein BUG27; alpha/beta domain, venus flytrap, transport protein; HET: CIT; 1.92A {Bordetella pertussis} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>2dvz_A BUGE, putative exported protein; periplamsic binding proteins, carboxylate binding, glutamate, transport protein; HET: GLU; 2.30A {Bordetella pertussis} Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3ix1_A N-formyl-4-amino-5-aminomethyl-2-methylpyrimidine protein; periplasmic N-formyl-4-amino-5-aminomethyl-2-methylpyrimidin protein; HET: NFM; 2.40A {Bacillus halodurans c-125} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>1zbm_A Hypothetical protein AF1704; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.30A {Archaeoglobus fulgidus} SCOP: c.94.1.1 Back     alignment and structure
>3lr1_A Tungstate ABC transporter, periplasmic tungstate- binding protein; the tungstate ABC transporter, structural genomics, PSI, MCSG; 1.80A {Geobacter sulfurreducens} Back     alignment and structure
>3ksx_A Nitrate transport protein; SSUA, alkanesulfonate-binding protein, periplasmic-binding P transport protein; HET: MPO; 1.70A {Xanthomonas axonopodis PV} PDB: 3e4r_A* 3ksj_A* Back     alignment and structure
>3muq_A Uncharacterized conserved protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; 2.05A {Vibrio parahaemolyticus} Back     alignment and structure
>3un6_A Hypothetical protein saouhsc_00137; structural genomics, center for structural genomics of infec diseases, csgid; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>1h45_A Lactoferrin; metal transport, iron transport, metal binding; 1.95A {Homo sapiens} SCOP: c.94.1.2 PDB: 1eh3_A 2pms_A* 1h43_A 1h44_A 1dsn_A 1lct_A 1hse_A 1vfe_A 1l5t_A 1vfd_A 1lgb_C* 1z6v_A 1z6w_A Back     alignment and structure
>3qsl_A Putative exported protein; unknown, structural genomics, PSI-biology, midwest center FO structural genomics, MCSG, unknown function; HET: MSE CIT; 2.00A {Bordetella bronchiseptica} Back     alignment and structure
>4esw_A Pyrimidine biosynthesis enzyme THI13; thiamin pyrimidine biosynthesis, transferase; HET: CIT; 1.60A {Candida albicans} PDB: 4esx_A* Back     alignment and structure
>1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Back     alignment and structure
>1iej_A Ovotransferrin; iron, metal binding protein; 1.65A {Gallus gallus} SCOP: c.94.1.2 PDB: 1tfa_A 1nft_A 1nnt_A 1ovb_A 1gv8_A 1gvc_A* Back     alignment and structure
>2x26_A Periplasmic aliphatic sulphonates-binding protein; transport protein; 1.75A {Escherichia coli} Back     alignment and structure
>3uif_A Sulfonate ABC transporter, periplasmic sulfonate- protein SSUA; structural genomics; 2.60A {Methylobacillus flagellatus} Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>2de3_A Dibenzothiophene desulfurization enzyme B; alpha-beta, hydrolase; HET: OBP; 1.60A {Rhodococcus SP} PDB: 2de4_A* 2de2_A Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Back     alignment and structure
>2g29_A Nitrate transport protein NRTA; solute-binding protein, alpha-beta protein; 1.50A {Synechocystis SP} Back     alignment and structure
>1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Back     alignment and structure
>2xxp_A CPS2A; replication, peptidoglycan, LCP, LYTR; HET: DSL PEG; 1.69A {Streptococcus pneumoniae} PDB: 3tep_A* 3tfl_A* 2xxq_A* 3tel_A* 4de8_A* Back     alignment and structure
>1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Back     alignment and structure
>2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Back     alignment and structure
>2x7q_A Ca3427, possible thiamine biosynthesis enzyme; unknown function; 2.00A {Candida albicans} PDB: 2x7p_A Back     alignment and structure
>3up9_A Putative uncharacterized protein; membrane lipoprotein, L-methionine binding protein, NLPA LIP structural genomics; HET: PG4 PE4; 2.35A {Actinomyces odontolyticus} SCOP: c.94.1.0 Back     alignment and structure
>3l6g_A Betaine ABC transporter permease and substrate BI protein; glycine betaine binding, substrate binding domain, venus FLY cell membrane; HET: B3P; 1.90A {Lactococcus lactis} PDB: 3l6h_A Back     alignment and structure
>3skp_A Serotransferrin; iron binding protein, transferrin receptor, TBP metal binding protein; 1.70A {Homo sapiens} PDB: 3v89_B 1suv_E Back     alignment and structure
>3tmg_A Glycine betaine, L-proline ABC transporter, glycine/betaine/L-proline-binding protein...; ssgcid, structural genomics; 1.90A {Borrelia burgdorferi} Back     alignment and structure
>2ozz_A Hypothetical protein YHFZ; alpha-beta structure, structural genomics, PSI-2, protein structure initiative; 2.30A {Shigella flexneri 2A} SCOP: c.94.1.1 Back     alignment and structure
>3r26_A Molybdate-binding periplasmic protein; protein binding; 1.70A {Escherichia coli} SCOP: c.94.1.1 PDB: 3axf_A 1amf_A 1wod_A Back     alignment and structure
>4i1d_A ABC transporter substrate-binding protein; structural genomics, PSI-biology; 2.20A {Bradyrhizobium japonicum} Back     alignment and structure
>3gxa_A Outer membrane lipoprotein GNA1946; periplasmic, L-methionine bingding, protein binding; 2.25A {Neisseria meningitidis} Back     alignment and structure
>1blf_A Lactoferrin; transferrin, iron-binding protein, carbohydrate structure; HET: NAG BMA MAN; 2.80A {Bos taurus} SCOP: c.94.1.2 c.94.1.2 PDB: 1lfc_A Back     alignment and structure
>3v83_A Serotransferrin; iron binding domain, iron carrier/transporter, transferrin R serum, metal transport; HET: P6G; 2.10A {Homo sapiens} PDB: 3v8x_B* 3qyt_A* 4h0w_A* 3ve1_B 2hav_A* 3s9l_C* 3s9m_C* 3s9n_C* 2hau_A* 1jnf_A 1h76_A* Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Back     alignment and structure
>3gzg_A Molybdate-binding periplasmic protein; permease; molybdate complex, mutant K127S, metal binding protein; 1.55A {Xanthomonas axonopodis PV} PDB: 2h5y_A Back     alignment and structure
>1cb6_A Protein (lactoferrin); iron transport, apolactoferrin, conformational change; 2.00A {Homo sapiens} SCOP: c.94.1.2 c.94.1.2 PDB: 1bka_A 1b0l_A 1lfi_A* 1fck_A 1lcf_A* 2bjj_X* 1lfh_A 1n76_A 1lfg_A* 1sqy_A* 1b1x_A 1b7u_A 1b7z_A 1i6b_A 1qjm_A 3cr9_A* 1f9b_A* 1dtz_A 1i6q_A 1jw1_A ... Back     alignment and structure
>4euo_A ABC transporter, substrate binding protein (polya; class D of PBP, GABA-binding, transport protein; 1.28A {Agrobacterium tumefaciens} PDB: 4eq7_A Back     alignment and structure
>2b4l_A Glycine betaine-binding protein; substrate-binding protein, closed liganded, ABC-transporter, compatible solutes, transport protein; 2.00A {Bacillus subtilis} PDB: 2b4m_A* 3chg_D Back     alignment and structure
>4ib2_A Putative lipoprotein; putative methionine-bindning, NLPA lipoprotein, PF03180 FAMI structural genomics, joint center for structural genomics; 1.76A {Ruminococcus gnavus} Back     alignment and structure
>2d3i_A Ovotransferrin; aluminum, metal-binding, transport, metal transport; 2.15A {Gallus gallus} SCOP: c.94.1.2 c.94.1.2 PDB: 1ovt_A 1aiv_A* 1n04_A 1ryx_A 1dot_A* 1aov_A* 1iq7_A* Back     alignment and structure
>3ir1_A Outer membrane lipoprotein GNA1946; D-methionine cultured, protein binding; 2.15A {Neisseria meningitidis} Back     alignment and structure
>3p7i_A PHND, subunit of alkylphosphonate ABC transporter; phosphonate binding protein, transport protein; 1.71A {Escherichia coli UTI89} PDB: 3qk6_A 3quj_A* 3s4u_A Back     alignment and structure
>3mc2_A Inhibitor of carbonic anhydrase; MICA, transferrin superfamily, lyase inhibitor; 2.40A {Mus musculus} Back     alignment and structure
>3k2d_A ABC-type metal ION transport system, periplasmic; alpha/beta domain, immune system; 2.60A {Vibrio vulnificus} Back     alignment and structure
>3n5l_A Binding protein component of ABC phosphonate TRAN; structural genomics, joint center for structural genomics; HET: UNL; 1.97A {Pseudomonas aeruginosa} Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>1ryo_A Serotransferrin; iron transport, metal transport; 1.20A {Homo sapiens} SCOP: c.94.1.2 PDB: 1bp5_A 1btj_A 1n84_A 1oqg_A 2o84_X 1fqf_A 1fqe_A 1oqh_A 2o7u_B 1jqf_A 1n7x_A 3fgs_A 1a8e_A 1a8f_A 1suv_C 1dtg_A 1d3k_A 1d4n_A 1n7w_A 1b3e_A ... Back     alignment and structure
>3tqw_A Methionine-binding protein; transport and binding proteins, transport protein; HET: MSE; 2.00A {Coxiella burnetii} Back     alignment and structure
>4ddd_A Immunogenic protein; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, immune system; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Back     alignment and structure
>3tod_A Lactotransferrin; C-LOBE, metal binding protein, 1- butyl1-H-pyrazol-5-carboxy hydrolase; HET: NAG XXB; 1.38A {Bos taurus} PDB: 1sdx_A* 3u72_A* 3u8q_A* 3ugw_A* 3uk4_A* 3usd_A* 3v5a_A* 3vdf_A* 4dig_A* 4dxu_A* 4fim_A* 4fjp_A* 4for_A* 4g2z_A* 4grk_A* 2b6d_A* 2b65_A* 2doj_A* 2dp8_A* 2dqv_A* ... Back     alignment and structure
>4ef1_A Pheromone COB1/lipoprotein, YAEC family; periplasmic methionine binding protein, NLPA lipoprotein, ST genomics; 1.90A {Enterococcus faecalis} PDB: 4ef2_A* Back     alignment and structure
>1xs5_A 29 kDa protein, membrane lipoprotein TPN32; periplasmic binding protein, methionine, membrane protein; 1.85A {Treponema pallidum} SCOP: c.94.1.1 Back     alignment and structure
>3kn3_A Putative periplasmic protein; alpha-beta structure, periplasmic binding protein fold, STRU genomics, PSI-2, protein structure initiative; HET: GSH CIT; 2.41A {Wolinella succinogenes} Back     alignment and structure
>3hn0_A Nitrate transport protein; ABC transporter, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; 1.75A {Parabacteroides distasonis} Back     alignment and structure
>1us5_A Putative GLUR0 ligand binding core; receptor, membrane protein, glutamate receptor, L-glutamate; HET: GLU; 1.5A {Thermus thermophilus} SCOP: c.94.1.1 PDB: 1us4_A* Back     alignment and structure
>2rin_A Putative glycine betaine-binding ABC transporter protein; type II binding protein, aromatic BOX, acetylcholine, protein binding; HET: ACH; 1.80A {Rhizobium meliloti} PDB: 2rej_A 2rf1_A 2reg_A* 3hcq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 90
d2f34a1246 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor li 2e-09
d1pb7a_289 c.94.1.1 (A:) N-methyl-D-aspartate receptor subuni 3e-09
d1mqia_260 c.94.1.1 (A:) Glutamate receptor ligand binding co 2e-07
d2a5sa1277 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate 1e-06
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Length = 246 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: Glutamate receptor ligand binding core
species: Rat (Rattus norvegicus), GluR5 [TaxId: 10116]

 Score = 50.2 bits (118), Expect = 2e-09
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 22  AFIWDSSRLDFEAAQDCELVTAGELFGRSGYAIGLQKGSPWADAVTLAILDFHES 76
           A + +S+ +++   ++C L   G L    GY +G   GSP+ D +T+AIL   E 
Sbjct: 180 ALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEE 234
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 289 Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Length = 260 Back     information, alignment and structure
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Length = 277 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query90
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.83
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 99.82
d1ii5a_226 Glutamate receptor ligand binding core {Synechocys 99.68
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 99.68
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 99.6
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 99.59
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 99.55
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 99.5
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 97.43
d1ce2a1 333 Lactoferrin {Domestic water buffalo (Bubalus arnee 93.22
d1eh3a_ 324 Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} 91.57
d1xs5a_ 240 Putative lipoprotein (NlpA family) {Treponema pall 91.25
d1ryoa_ 324 Transferrin {Human (Homo sapiens) [TaxId: 9606]} 90.41
d2b6da1 344 Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} 90.31
d1ieja_ 329 Ovotransferrin {Chicken (Gallus gallus) [TaxId: 90 90.2
d2hava1 325 Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId 89.83
d1h76a2 346 Transferrin {Pig (Sus scrofa) [TaxId: 9823]} 85.85
d1amfa_231 Molybdate-binding protein, ModA {Escherichia coli 85.38
d2fyia1220 LysR-type regulatory protein Cbl {Escherichia coli 84.91
d1atga_231 Molybdate-binding protein, ModA {Azotobacter vinel 83.14
d1pota_322 Spermidine/putrescine-binding protein PotD {Escher 80.52
d1xs5a_240 Putative lipoprotein (NlpA family) {Treponema pall 80.46
d2ozza1228 Hypothetical protein YhfZ {Shigella flexneri [TaxI 80.03
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: N-methyl-D-aspartate receptor subunit 1
species: Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]

Probab=99.83  E-value=1.6e-20  Score=121.97  Aligned_cols=87  Identities=36%  Similarity=0.589  Sum_probs=78.1

Q ss_pred             cccCChHHHHHHhhcCCceEEEeehhHHhHHHhc--CCCeEEeC--CcccccceEEEEeCCCCChHHHHHHHHHhhhccH
Q psy17442          3 FDVKFSPSTVVRHGTKKLMAFIWDSSRLDFEAAQ--DCELVTAG--ELFGRSGYAIGLQKGSPWADAVTLAILDFHESTV   78 (90)
Q Consensus         3 ~~~~~~~~~~~~l~~G~ida~i~d~~~~~~~~~~--~~~l~~~~--~~~~~~~~~ia~~kgs~l~~~vn~~l~~l~~~G~   78 (90)
                      +.+++.++++.+|.+|++||++.|.+++.|++++  .|++..++  ..+...+||||+||||||++.||.+|.+|+++|+
T Consensus       184 ~~~~~~~~~~~~l~~G~~Da~i~d~~~~~y~~~~~~~~~l~~~~~~~~~~~~~ygia~~k~s~l~~~in~al~~l~~~G~  263 (277)
T d2a5sa1         184 FNQRGVEDALVSLKTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGE  263 (277)
T ss_dssp             GCCSSHHHHHHHHHTTSCSEEEEEHHHHHHHHHTCTTSCEEEEECCCGGGCEEECCEEETTCTTHHHHHHHHHHHHHHTH
T ss_pred             ecCCCHHHHHHHHHcCCcceecccHHHHHHHHhhCCCCcEEEecCCCCcCcceEEEEEeCChHHHHHHHHHHHHHHHCCH
Confidence            4578889999999999999999999999998886  37776663  3577889999999999999999999999999999


Q ss_pred             HHHHHHHhccC
Q psy17442         79 CYLFMAKVHLN   89 (90)
Q Consensus        79 ~~~l~~kW~~~   89 (90)
                      +++|.+|||..
T Consensus       264 ~~~L~~KW~~g  274 (277)
T d2a5sa1         264 MEELETLWLTG  274 (277)
T ss_dssp             HHHHHHHHTCC
T ss_pred             HHHHHhhhcCC
Confidence            99999999964
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ii5a_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Synechocystis sp., GluR0 [TaxId: 1143]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1ce2a1 c.94.1.2 (A:1-333) Lactoferrin {Domestic water buffalo (Bubalus arnee bubalis) [TaxId: 89462]} Back     information, alignment and structure
>d1eh3a_ c.94.1.2 (A:) Lactoferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d1ryoa_ c.94.1.2 (A:) Transferrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b6da1 c.94.1.2 (A:342-685) Lactoferrin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ieja_ c.94.1.2 (A:) Ovotransferrin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2hava1 c.94.1.2 (A:340-664) Transferrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1h76a2 c.94.1.2 (A:342-687) Transferrin {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1amfa_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fyia1 c.94.1.1 (A:88-307) LysR-type regulatory protein Cbl {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1atga_ c.94.1.1 (A:) Molybdate-binding protein, ModA {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xs5a_ c.94.1.1 (A:) Putative lipoprotein (NlpA family) {Treponema pallidum [TaxId: 160]} Back     information, alignment and structure
>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure