Psyllid ID: psy17573


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100--
WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF
ccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccc
wfdgfnweglrnrtlippilpkirsqtdssnfdeyppdqaiflsfpcrwfdgfnweglrnrtlippilpkirsqtdssnfdeyppdqdpppaddltgwdadf
wfdgfnweglrnrtlippilpkIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFdeyppdqdpppaddlTGWDADF
WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFdeyppdqdpppaddLTGWDADF
***GFNWEGLRNRTLIPPILPKI***********YPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILP*********************************
WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF
WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF
WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQD******LT*W****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query102 2.2.26 [Sep-21-2011]
Q13976671 cGMP-dependent protein ki yes N/A 0.539 0.081 0.636 3e-18
P00516671 cGMP-dependent protein ki yes N/A 0.539 0.081 0.636 3e-18
P0C605671 cGMP-dependent protein ki yes N/A 0.539 0.081 0.636 3e-18
O77676671 cGMP-dependent protein ki yes N/A 0.539 0.081 0.636 5e-18
O76360780 cGMP-dependent protein ki yes N/A 0.529 0.069 0.636 2e-17
A8X6H1749 cGMP-dependent protein ki N/A N/A 0.529 0.072 0.618 5e-17
Q13237762 cGMP-dependent protein ki no N/A 0.529 0.070 0.509 2e-12
Q61410762 cGMP-dependent protein ki no N/A 0.529 0.070 0.490 7e-12
Q64595762 cGMP-dependent protein ki no N/A 0.529 0.070 0.490 7e-12
Q03042768 cGMP-dependent protein ki yes N/A 0.529 0.070 0.509 5e-11
>sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 Back     alignment and function desciption
 Score = 90.5 bits (223), Expect = 3e-18,   Method: Composition-based stats.
 Identities = 35/55 (63%), Positives = 42/55 (76%)

Query: 48  RWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF 102
           +WF+GFNWEGLR  TL PPI+P + S TD+SNFD +P D D PP DD +GWD DF
Sbjct: 617 KWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDNDEPPPDDNSGWDIDF 671




Serine/threonine protein kinasethat acts as key mediator of the nitric oxide (NO)/cGMP signaling pathway. GMP binding activates PRKG1, which phosphorylates serines and threonines on many cellular proteins. Numerous protein targets for PRKG1 phosphorylation are implicated in modulating cellular calcium, but the contribution of each of these targets may vary substantially among cell types. Proteins that are phosphorylated by PRKG1 regulate platelet activation and adhesion, smooth muscle contraction, cardiac function, gene expression, feedback of the NO-signaling pathway, and other processes involved in several aspects of the CNS like axon guidance, hippocampal and cerebellar learning, circadian rhythm and nociception. Smoth muscle relaxation is mediated through lowering of intracellular free calcium, by desensitization of contractile proteins to calcium, and by decrease in the contractile state of smooth muscle or in platelet activation. Regulates intracellular calcium levels via several pathways: phosphorylates MRVI1/IRAG and inhibits IP3-induced Ca(2+) release from intracellular stores, phosphorylation of KCNMA1 (BKCa) channels decreases intracellular Ca(2+) levels, which leads to increased opening of this channel. PRKG1 phosphorylates the canonical transient receptor potential channel (TRPC) family which inactivates the associated inward calcium current. Another mode of action of NO/cGMP/PKGI signaling involves PKGI-mediated inactivation of the Ras homolog gene family member A (RhoA). Phosphorylation of RHOA by PRKG1 blocks the action of this protein in myriad processes: regulation of RHOA translocation; decreasing contraction; controlling vesicle trafficking, reduction of myosin light chain phosphorylation resulting in vasorelaxation. Activation of PRKG1 by NO signaling alters also gene expression in a number of tissues. In smooth muscle cells, increased cGMP and PRKG1 activity influence expression of smooth muscle-specific contractile proteins, levels of proteins in the NO/cGMP signaling pathway, down-regulation of the matrix proteins osteopontin and thrombospondin-1 to limit smooth muscle cell migration and phenotype. Regulates vasodilator-stimulated phosphoprotein (VASP) functions in platelets and smooth muscle.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 2
>sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 Back     alignment and function description
>sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 Back     alignment and function description
>sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 Back     alignment and function description
>sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 Back     alignment and function description
>sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 Back     alignment and function description
>sp|Q61410|KGP2_MOUSE cGMP-dependent protein kinase 2 OS=Mus musculus GN=Prkg2 PE=2 SV=1 Back     alignment and function description
>sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=2 SV=1 Back     alignment and function description
>sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
321473349 685 hypothetical protein DAPPUDRAFT_194528 [ 0.539 0.080 0.745 5e-21
449662592 599 PREDICTED: cGMP-dependent protein kinase 0.529 0.090 0.672 2e-17
307171913 682 cGMP-dependent protein kinase, isozyme 2 0.539 0.080 0.709 2e-17
194205910 671 PREDICTED: cGMP-dependent protein kinase 0.539 0.081 0.636 9e-17
344275005 671 PREDICTED: cGMP-dependent protein kinase 0.539 0.081 0.636 1e-16
426252721 664 PREDICTED: cGMP-dependent protein kinase 0.539 0.082 0.636 1e-16
332212184 671 PREDICTED: cGMP-dependent protein kinase 0.539 0.081 0.636 1e-16
27806091 671 cGMP-dependent protein kinase 1 [Bos tau 0.539 0.081 0.636 1e-16
148612818 671 cGMP-dependent protein kinase 1 isoform 0.539 0.081 0.636 1e-16
113205750 671 cGMP-dependent protein kinase 1 [Sus scr 0.539 0.081 0.636 1e-16
>gi|321473349|gb|EFX84317.1| hypothetical protein DAPPUDRAFT_194528 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  105 bits (261), Expect = 5e-21,   Method: Composition-based stats.
 Identities = 41/55 (74%), Positives = 47/55 (85%)

Query: 48  RWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF 102
           +WFDGFNWEGLRNRTL PPI+P+I+S  DSSNFDEYPPD D  P DD++GWD DF
Sbjct: 631 KWFDGFNWEGLRNRTLTPPIIPQIKSAMDSSNFDEYPPDMDGLPPDDVSGWDVDF 685




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|449662592|ref|XP_002156911.2| PREDICTED: cGMP-dependent protein kinase 1-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|307171913|gb|EFN63550.1| cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|194205910|ref|XP_001917720.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 2 [Equus caballus] Back     alignment and taxonomy information
>gi|344275005|ref|XP_003409304.1| PREDICTED: cGMP-dependent protein kinase 1-like isoform 2 [Loxodonta africana] Back     alignment and taxonomy information
>gi|426252721|ref|XP_004020051.1| PREDICTED: cGMP-dependent protein kinase 1 [Ovis aries] Back     alignment and taxonomy information
>gi|332212184|ref|XP_003255198.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 2 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|27806091|ref|NP_776861.1| cGMP-dependent protein kinase 1 [Bos taurus] gi|125377|sp|P00516.2|KGP1_BOVIN RecName: Full=cGMP-dependent protein kinase 1; Short=cGK 1; Short=cGK1; AltName: Full=cGMP-dependent protein kinase I; Short=cGKI gi|212|emb|CAA34214.1| unnamed protein product [Bos taurus] gi|296472851|tpg|DAA14966.1| TPA: cGMP-dependent protein kinase 1 [Bos taurus] gi|226414|prf||1511094A cGMP dependent protein kinase I alpha Back     alignment and taxonomy information
>gi|148612818|ref|NP_001091982.1| cGMP-dependent protein kinase 1 isoform 1 [Homo sapiens] gi|109089775|ref|XP_001099261.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 1 [Macaca mulatta] gi|114630569|ref|XP_001162783.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 2 [Pan troglodytes] gi|6225588|sp|Q13976.3|KGP1_HUMAN RecName: Full=cGMP-dependent protein kinase 1; Short=cGK 1; Short=cGK1; AltName: Full=cGMP-dependent protein kinase I; Short=cGKI gi|1255602|dbj|BAA08297.1| cGMP-dependent protein kinase type I alpha [Homo sapiens] gi|3063840|emb|CAB07436.1| cGMP-dependent protein kinase type I alpha [Homo sapiens] gi|119574526|gb|EAW54141.1| protein kinase, cGMP-dependent, type I, isoform CRA_b [Homo sapiens] gi|410210994|gb|JAA02716.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] gi|410263736|gb|JAA19834.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] gi|410292180|gb|JAA24690.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] gi|410353187|gb|JAA43197.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] Back     alignment and taxonomy information
>gi|113205750|ref|NP_001038039.1| cGMP-dependent protein kinase 1 [Sus scrofa] gi|73425907|gb|AAZ75707.1| cGMP-dependent protein kinase type I [Sus scrofa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query102
UNIPROTKB|Q5JP05283 PRKG1 "cGMP-dependent protein 0.372 0.134 0.657 6e-11
WB|WBGene00001173780 egl-4 [Caenorhabditis elegans 0.519 0.067 0.547 8.4e-11
UNIPROTKB|F1SD02459 PRKG1 "Uncharacterized protein 0.372 0.082 0.657 2.1e-10
RGD|1587390459 Prkg1 "protein kinase, cGMP-de 0.372 0.082 0.657 2.1e-10
UNIPROTKB|J9NWY9474 PRKG1 "Uncharacterized protein 0.372 0.080 0.657 2.2e-10
UNIPROTKB|J9JHE0489 PRKG1 "Uncharacterized protein 0.372 0.077 0.657 2.3e-10
UNIPROTKB|Q5SQU3659 PRKG1 "cGMP-dependent protein 0.372 0.057 0.657 3.7e-10
ZFIN|ZDB-GENE-040426-1308667 prkg1a "protein kinase, cGMP-d 0.372 0.056 0.631 3.8e-10
MGI|MGI:108174671 Prkg1 "protein kinase, cGMP-de 0.372 0.056 0.657 3.8e-10
UNIPROTKB|P00516671 PRKG1 "cGMP-dependent protein 0.372 0.056 0.657 3.8e-10
UNIPROTKB|Q5JP05 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 6.0e-11, P = 6.0e-11
 Identities = 25/38 (65%), Positives = 30/38 (78%)

Query:     1 WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPD 38
             WF+GFNWEGLR  TL PPI+P + S TD+SNFD +P D
Sbjct:   230 WFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPED 267


GO:0005524 "ATP binding" evidence=IEA
GO:0001764 "neuron migration" evidence=IEA
GO:0004692 "cGMP-dependent protein kinase activity" evidence=IEA
GO:0005794 "Golgi apparatus" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0016358 "dendrite development" evidence=IEA
GO:0030553 "cGMP binding" evidence=IEA
GO:0030900 "forebrain development" evidence=IEA
WB|WBGene00001173 egl-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1SD02 PRKG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1587390 Prkg1 "protein kinase, cGMP-dependent, type 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9NWY9 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHE0 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SQU3 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1308 prkg1a "protein kinase, cGMP-dependent, type Ia" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:108174 Prkg1 "protein kinase, cGMP-dependent, type I" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P00516 PRKG1 "cGMP-dependent protein kinase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P00516KGP1_BOVIN2, ., 7, ., 1, 1, ., 1, 20.63630.53920.0819yesN/A
Q03042KGP1_DROME2, ., 7, ., 1, 1, ., 1, 20.50900.52940.0703yesN/A
O76360EGL4_CAEEL2, ., 7, ., 1, 1, ., 1, 20.63630.52940.0692yesN/A
O77676KGP1_RABIT2, ., 7, ., 1, 1, ., 1, 20.63630.53920.0819yesN/A
P0C605KGP1_MOUSE2, ., 7, ., 1, 1, ., 1, 20.63630.53920.0819yesN/A
Q13976KGP1_HUMAN2, ., 7, ., 1, 1, ., 1, 20.63630.53920.0819yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 6e-11
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 2e-09
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-09
cd05580290 cd05580, STKc_PKA, Catalytic domain of the Protein 5e-09
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 7e-09
smart0013364 smart00133, S_TK_X, Extension to Ser/Thr-type prot 2e-08
cd05612291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 4e-08
smart0013364 smart00133, S_TK_X, Extension to Ser/Thr-type prot 8e-08
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 2e-07
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 5e-07
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 7e-07
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 3e-06
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 5e-06
cd05597331 cd05597, STKc_DMPK_like, Catalytic domain of Myoto 5e-06
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 8e-06
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 8e-06
cd05589324 cd05589, STKc_PKN, Catalytic domain of the Protein 1e-05
cd05593328 cd05593, STKc_PKB_gamma, Catalytic domain of the P 2e-05
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 2e-05
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 2e-05
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 3e-05
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 3e-05
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 4e-05
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 4e-05
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 4e-05
cd05571323 cd05571, STKc_PKB, Catalytic domain of the Protein 5e-05
cd05590320 cd05590, STKc_nPKC_eta, Catalytic domain of the Pr 5e-05
cd05591321 cd05591, STKc_nPKC_epsilon, Catalytic domain of th 5e-05
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 5e-05
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 6e-05
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 6e-05
cd05595323 cd05595, STKc_PKB_beta, Catalytic domain of the Pr 8e-05
cd05614332 cd05614, STKc_MSK2_N, N-terminal catalytic domain 9e-05
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 1e-04
cd05587324 cd05587, STKc_cPKC, Catalytic domain of the Protei 2e-04
PTZ00263329 PTZ00263, PTZ00263, protein kinase A catalytic sub 2e-04
cd05594325 cd05594, STKc_PKB_alpha, Catalytic domain of the P 3e-04
cd05570318 cd05570, STKc_PKC, Catalytic domain of the Protein 4e-04
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 4e-04
cd05619316 cd05619, STKc_nPKC_theta, Catalytic domain of the 4e-04
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 4e-04
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 4e-04
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 4e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 5e-04
cd05620316 cd05620, STKc_nPKC_delta, Catalytic domain of the 5e-04
cd05596370 cd05596, STKc_ROCK, Catalytic domain of the Protei 0.001
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 0.001
cd05624331 cd05624, STKc_MRCK_beta, Catalytic domain of the P 0.001
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 0.001
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 0.002
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 0.002
cd05584323 cd05584, STKc_p70S6K, Catalytic domain of the Prot 0.003
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 0.003
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 0.003
cd05615323 cd05615, STKc_cPKC_alpha, Catalytic domain of the 0.003
cd05621370 cd05621, STKc_ROCK2, Catalytic domain of the Prote 0.003
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 0.004
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 0.004
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
 Score = 57.0 bits (138), Expect = 6e-11
 Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)

Query: 49  WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTG 97
           +F G +WE +R R    PI+P+++S TD+SNFD++       P      
Sbjct: 298 FFKGVDWEHIRERP--APIIPELKSITDTSNFDDFEEIDLDVPTSPGPP 344


Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplication. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. This subfamily also contains fungal NDR-like kinases. Length = 364

>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 102
KOG0614|consensus732 99.73
KOG0695|consensus593 99.24
KOG0694|consensus694 99.17
KOG0605|consensus550 99.17
KOG0690|consensus516 98.96
KOG0696|consensus683 98.92
KOG0616|consensus355 98.8
KOG0608|consensus1034 98.77
smart0013364 S_TK_X Extension to Ser/Thr-type protein kinases. 98.76
KOG0694|consensus694 98.67
KOG0598|consensus357 98.62
smart0013364 S_TK_X Extension to Ser/Thr-type protein kinases. 98.56
KOG0616|consensus355 98.44
KOG0612|consensus 1317 98.42
KOG0690|consensus516 98.34
KOG0614|consensus732 98.13
KOG0598|consensus357 98.08
KOG0605|consensus550 98.02
KOG0696|consensus683 97.89
KOG0986|consensus591 97.67
KOG0695|consensus593 97.65
KOG0612|consensus 1317 97.64
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 97.49
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 97.47
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 97.1
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 97.06
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 97.05
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 96.94
KOG0608|consensus1034 96.92
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 96.84
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 96.82
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 96.77
KOG0603|consensus 612 96.76
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 96.74
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 96.64
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 96.63
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 96.63
KOG0610|consensus459 96.46
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 96.29
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 96.22
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 96.22
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 96.2
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 96.14
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 96.08
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 95.99
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 95.96
KOG0603|consensus 612 95.77
PTZ00263329 protein kinase A catalytic subunit; Provisional 95.76
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 95.57
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 95.56
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 95.54
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 95.45
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 95.42
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 95.3
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 95.24
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 95.05
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 94.99
KOG0606|consensus 1205 94.97
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 94.81
KOG0986|consensus591 94.76
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 94.62
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 94.61
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 94.46
KOG0592|consensus 604 94.41
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 94.08
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 93.88
cd05623332 STKc_MRCK_alpha Catalytic domain of the Protein Se 93.72
cd05617327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 93.69
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 93.66
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 93.64
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 93.63
KOG0606|consensus1205 93.61
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 93.4
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 93.23
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 93.23
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 93.14
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 93.09
cd05621370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 93.0
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 92.9
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 92.77
KOG0610|consensus459 92.58
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 92.57
cd05614332 STKc_MSK2_N N-terminal catalytic domain of the Pro 92.47
cd05596370 STKc_ROCK Catalytic domain of the Protein Serine/T 92.37
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 92.28
cd05580290 STKc_PKA Catalytic domain of the Protein Serine/Th 92.12
cd05597331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 92.04
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 92.04
cd05627360 STKc_NDR2 Catalytic domain of the Protein Serine/T 91.98
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 91.71
cd05603321 STKc_SGK2 Catalytic domain of the Protein Serine/T 91.59
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 91.58
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 91.3
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 91.21
PTZ00263329 protein kinase A catalytic subunit; Provisional 90.78
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 90.5
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 90.44
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 90.33
cd05622371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 89.83
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 89.53
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 89.27
PF0043348 Pkinase_C: Protein kinase C terminal domain; Inter 88.8
cd05575323 STKc_SGK Catalytic domain of the Protein Serine/Th 88.64
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 88.35
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 87.5
cd05602325 STKc_SGK1 Catalytic domain of the Protein Serine/T 87.46
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 87.46
cd05582318 STKc_RSK_N N-terminal catalytic domain of the Prot 87.29
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 87.2
cd05604325 STKc_SGK3 Catalytic domain of the Protein Serine/T 87.12
cd05583288 STKc_MSK_N N-terminal catalytic domain of the Prot 86.76
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 86.29
cd05632285 STKc_GRK5 Catalytic domain of the Protein Serine/T 85.86
cd05577277 STKc_GRK Catalytic domain of the Protein Serine/Th 85.04
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 84.84
cd05586330 STKc_Sck1_like Catalytic domain of Suppressor of l 84.41
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 84.39
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 83.63
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 83.42
cd05598376 STKc_LATS Catalytic domain of the Protein Serine/T 81.54
cd05629377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 81.39
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 80.92
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 80.42
cd05624331 STKc_MRCK_beta Catalytic domain of the Protein Ser 80.39
>KOG0614|consensus Back     alignment and domain information
Probab=99.73  E-value=1.7e-18  Score=125.69  Aligned_cols=65  Identities=57%  Similarity=1.177  Sum_probs=63.0

Q ss_pred             cchhhcccCCCCCCCCChHHHhcCCCCCCeeccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy17573         38 DQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF  102 (102)
Q Consensus        38 ~~~~~~i~~~~~F~~~dw~~l~~~~~~pp~~p~~~~~~d~~~fd~~~~~~~~~~~~~~~~~~~~~  102 (102)
                      .+|+.+|++|.||.+|||+.|+.+.++||++|.++++.|++|||.|+.+.+.++|+|.||||+||
T Consensus       668 ~~gI~DIkkH~Wf~gfdweglr~~~L~pPi~~~va~ptD~s~Fd~~p~dnd~pppde~SGWD~dF  732 (732)
T KOG0614|consen  668 KGGINDIKKHRWFEGFDWEGLRSRTLPPPIIPSVANPTDVSNFDNFPPDNDEPPPDELSGWDKDF  732 (732)
T ss_pred             cCChHHHHhhhhhhcCChhhhhhccCCCCccccCCCcccchhccCCCcccCCCCchhcccCCCCC
Confidence            47789999999999999999999999999999999999999999999999999999999999998



>KOG0695|consensus Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>smart00133 S_TK_X Extension to Ser/Thr-type protein kinases Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>smart00133 S_TK_X Extension to Ser/Thr-type protein kinases Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>PF00433 Pkinase_C: Protein kinase C terminal domain; InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
1mrv_A339 Crystal Structure Of An Inactive Akt2 Kinase Domain 3e-04
1gzn_A335 Structure Of Pkb Kinase Domain Length = 335 3e-04
1o6k_A336 Structure Of Activated Form Of Pkb Kinase Domain S4 3e-04
3iw4_A360 Crystal Structure Of Pkc Alpha In Complex With Nvp- 6e-04
3e87_A335 Crystal Structures Of The Kinase Domain Of Akt2 In 6e-04
3tku_A433 Mrck Beta In Complex With Fasudil Length = 433 7e-04
3qfv_A415 Mrck Beta In Complex With Tpca-1 Length = 415 7e-04
>pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 Back     alignment and structure

Iteration: 1

Score = 40.0 bits (92), Expect = 3e-04, Method: Composition-based stats. Identities = 20/65 (30%), Positives = 34/65 (52%), Gaps = 1/65 (1%) Query: 1 WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQAIFLSFPCRWFDGFNWEGLRN 60 +F NW+ + + L+PP P++ S+ D+ FD+ Q+I ++ P R +D L Sbjct: 266 FFLSINWQDVVQKKLLPPFKPQVTSEVDTRYFDDEFTAQSITITPPDR-YDSLGLLELDQ 324 Query: 61 RTLIP 65 RT P Sbjct: 325 RTHFP 329
>pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 Back     alignment and structure
>pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 Back     alignment and structure
>pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 Back     alignment and structure
>pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 Back     alignment and structure
>pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 Back     alignment and structure
>pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query102
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 6e-16
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 6e-14
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 3e-12
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 1e-10
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 5e-12
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 5e-12
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 2e-09
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 3e-09
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-08
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-07
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 3e-08
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 6e-08
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 4e-08
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 3e-07
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 6e-08
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 4e-07
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 7e-08
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 3e-07
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 7e-08
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-07
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 8e-08
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 2e-07
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 8e-08
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 9e-08
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 9e-08
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-07
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 3e-07
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 4e-07
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 4e-07
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 4e-07
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 2e-06
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 3e-06
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 2e-05
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 3e-06
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 2e-05
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 6e-05
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 9e-05
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 3e-04
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 3e-04
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
 Score = 70.0 bits (172), Expect = 6e-16
 Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 48  RWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWD-ADF 102
           +WF   +W  +  R +  P +PK +   D+SNFD+Y  ++     ++  G +  +F
Sbjct: 295 KWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF 350


>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 98.74
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 98.62
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 98.52
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 98.47
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 98.4
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 98.37
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 98.34
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 98.33
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 98.33
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 98.32
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 98.31
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 98.28
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 98.12
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 98.1
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 97.94
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 97.93
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 97.9
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 97.89
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 97.82
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 97.78
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 97.76
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 97.71
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 97.67
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.65
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 97.62
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 97.52
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 97.5
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 97.48
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 97.42
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 97.41
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 97.37
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 97.24
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 97.19
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 97.02
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 96.94
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 96.73
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 96.25
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 96.08
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 95.67
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 94.83
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 92.74
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
Probab=98.74  E-value=2.4e-09  Score=75.70  Aligned_cols=55  Identities=20%  Similarity=0.465  Sum_probs=50.1

Q ss_pred             hhhcccCCCCCCCCChHHHhcCCCCCCeeccCCCCCCCCCCCC-CCCCCCCCCCCC
Q psy17573         40 AIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDE-YPPDQDPPPADD   94 (102)
Q Consensus        40 ~~~~i~~~~~F~~~dw~~l~~~~~~pp~~p~~~~~~d~~~fd~-~~~~~~~~~~~~   94 (102)
                      ++.+++.|+||++++|+.+.++++.|||+|.+.+..|++|||. |+++....+|++
T Consensus       312 ~~~ei~~Hpff~~i~w~~l~~~~~~pp~~p~~~~~~d~~~fd~~~~~~~~~~~~~~  367 (396)
T 4dc2_A          312 GFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDD  367 (396)
T ss_dssp             HHHHHHHSTTTTTCCHHHHHTTCSCCSCCCCCCSSTTGGGSCHHHHTSCCCCCCCC
T ss_pred             CHHHHhcCccccCCCHHHHHcCCCCCCCcCCCCCccchhhcChhhccCCCccCCCc
Confidence            5678999999999999999999999999999999999999997 777777777765



>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 102
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 4e-11
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 7e-11
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-10
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 6e-10
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-10
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 5e-10
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-08
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 2e-08
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 3e-08
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 4e-08
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-06
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-06
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 55.6 bits (133), Expect = 4e-11
 Identities = 14/50 (28%), Positives = 26/50 (52%)

Query: 48  RWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTG 97
           +WF   +W  +  R +  P +PK +   D+SNFD+Y  ++     ++  G
Sbjct: 295 KWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCG 344


>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query102
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 98.47
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 98.22
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 98.13
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 97.98
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 97.83
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 97.54
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 97.52
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 97.46
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 97.45
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 97.39
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 96.45
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 91.67
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: cAMP-dependent PK, catalytic subunit
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.47  E-value=9.3e-08  Score=64.94  Aligned_cols=50  Identities=26%  Similarity=0.585  Sum_probs=44.6

Q ss_pred             hhhcccCCCCCCCCChHHHhcCCCCCCeeccCCCCCCCCCCCCCCCCCCC
Q psy17573         40 AIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDP   89 (102)
Q Consensus        40 ~~~~i~~~~~F~~~dw~~l~~~~~~pp~~p~~~~~~d~~~fd~~~~~~~~   89 (102)
                      .+.++..|+||++++|..+.+++++|||+|...+..|++||+++..+...
T Consensus       287 t~~ell~Hp~f~~~~~~~~~~~~~~~p~~p~~~~~~d~s~~~~~~~~~~~  336 (350)
T d1rdqe_         287 GVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR  336 (350)
T ss_dssp             TTHHHHTSGGGTTCCHHHHHTTCSCCSCCCCCCSTTCCTTSCCCCCCCCC
T ss_pred             cHHHHHcCccccCCCHHHHHhcCCCcCccCCCCCcchhhhcCCCCccccc
Confidence            57789999999999999999999999999999999999999987655543



>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure