Psyllid ID: psy17573
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 102 | ||||||
| 321473349 | 685 | hypothetical protein DAPPUDRAFT_194528 [ | 0.539 | 0.080 | 0.745 | 5e-21 | |
| 449662592 | 599 | PREDICTED: cGMP-dependent protein kinase | 0.529 | 0.090 | 0.672 | 2e-17 | |
| 307171913 | 682 | cGMP-dependent protein kinase, isozyme 2 | 0.539 | 0.080 | 0.709 | 2e-17 | |
| 194205910 | 671 | PREDICTED: cGMP-dependent protein kinase | 0.539 | 0.081 | 0.636 | 9e-17 | |
| 344275005 | 671 | PREDICTED: cGMP-dependent protein kinase | 0.539 | 0.081 | 0.636 | 1e-16 | |
| 426252721 | 664 | PREDICTED: cGMP-dependent protein kinase | 0.539 | 0.082 | 0.636 | 1e-16 | |
| 332212184 | 671 | PREDICTED: cGMP-dependent protein kinase | 0.539 | 0.081 | 0.636 | 1e-16 | |
| 27806091 | 671 | cGMP-dependent protein kinase 1 [Bos tau | 0.539 | 0.081 | 0.636 | 1e-16 | |
| 148612818 | 671 | cGMP-dependent protein kinase 1 isoform | 0.539 | 0.081 | 0.636 | 1e-16 | |
| 113205750 | 671 | cGMP-dependent protein kinase 1 [Sus scr | 0.539 | 0.081 | 0.636 | 1e-16 |
| >gi|321473349|gb|EFX84317.1| hypothetical protein DAPPUDRAFT_194528 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 105 bits (261), Expect = 5e-21, Method: Composition-based stats.
Identities = 41/55 (74%), Positives = 47/55 (85%)
Query: 48 RWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF 102
+WFDGFNWEGLRNRTL PPI+P+I+S DSSNFDEYPPD D P DD++GWD DF
Sbjct: 631 KWFDGFNWEGLRNRTLTPPIIPQIKSAMDSSNFDEYPPDMDGLPPDDVSGWDVDF 685
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|449662592|ref|XP_002156911.2| PREDICTED: cGMP-dependent protein kinase 1-like [Hydra magnipapillata] | Back alignment and taxonomy information |
|---|
| >gi|307171913|gb|EFN63550.1| cGMP-dependent protein kinase, isozyme 2 forms cD5/T2 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|194205910|ref|XP_001917720.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 2 [Equus caballus] | Back alignment and taxonomy information |
|---|
| >gi|344275005|ref|XP_003409304.1| PREDICTED: cGMP-dependent protein kinase 1-like isoform 2 [Loxodonta africana] | Back alignment and taxonomy information |
|---|
| >gi|426252721|ref|XP_004020051.1| PREDICTED: cGMP-dependent protein kinase 1 [Ovis aries] | Back alignment and taxonomy information |
|---|
| >gi|332212184|ref|XP_003255198.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 2 [Nomascus leucogenys] | Back alignment and taxonomy information |
|---|
| >gi|27806091|ref|NP_776861.1| cGMP-dependent protein kinase 1 [Bos taurus] gi|125377|sp|P00516.2|KGP1_BOVIN RecName: Full=cGMP-dependent protein kinase 1; Short=cGK 1; Short=cGK1; AltName: Full=cGMP-dependent protein kinase I; Short=cGKI gi|212|emb|CAA34214.1| unnamed protein product [Bos taurus] gi|296472851|tpg|DAA14966.1| TPA: cGMP-dependent protein kinase 1 [Bos taurus] gi|226414|prf||1511094A cGMP dependent protein kinase I alpha | Back alignment and taxonomy information |
|---|
| >gi|148612818|ref|NP_001091982.1| cGMP-dependent protein kinase 1 isoform 1 [Homo sapiens] gi|109089775|ref|XP_001099261.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 1 [Macaca mulatta] gi|114630569|ref|XP_001162783.1| PREDICTED: cGMP-dependent protein kinase 1 isoform 2 [Pan troglodytes] gi|6225588|sp|Q13976.3|KGP1_HUMAN RecName: Full=cGMP-dependent protein kinase 1; Short=cGK 1; Short=cGK1; AltName: Full=cGMP-dependent protein kinase I; Short=cGKI gi|1255602|dbj|BAA08297.1| cGMP-dependent protein kinase type I alpha [Homo sapiens] gi|3063840|emb|CAB07436.1| cGMP-dependent protein kinase type I alpha [Homo sapiens] gi|119574526|gb|EAW54141.1| protein kinase, cGMP-dependent, type I, isoform CRA_b [Homo sapiens] gi|410210994|gb|JAA02716.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] gi|410263736|gb|JAA19834.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] gi|410292180|gb|JAA24690.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] gi|410353187|gb|JAA43197.1| protein kinase, cGMP-dependent, type I [Pan troglodytes] | Back alignment and taxonomy information |
|---|
| >gi|113205750|ref|NP_001038039.1| cGMP-dependent protein kinase 1 [Sus scrofa] gi|73425907|gb|AAZ75707.1| cGMP-dependent protein kinase type I [Sus scrofa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 102 | ||||||
| UNIPROTKB|Q5JP05 | 283 | PRKG1 "cGMP-dependent protein | 0.372 | 0.134 | 0.657 | 6e-11 | |
| WB|WBGene00001173 | 780 | egl-4 [Caenorhabditis elegans | 0.519 | 0.067 | 0.547 | 8.4e-11 | |
| UNIPROTKB|F1SD02 | 459 | PRKG1 "Uncharacterized protein | 0.372 | 0.082 | 0.657 | 2.1e-10 | |
| RGD|1587390 | 459 | Prkg1 "protein kinase, cGMP-de | 0.372 | 0.082 | 0.657 | 2.1e-10 | |
| UNIPROTKB|J9NWY9 | 474 | PRKG1 "Uncharacterized protein | 0.372 | 0.080 | 0.657 | 2.2e-10 | |
| UNIPROTKB|J9JHE0 | 489 | PRKG1 "Uncharacterized protein | 0.372 | 0.077 | 0.657 | 2.3e-10 | |
| UNIPROTKB|Q5SQU3 | 659 | PRKG1 "cGMP-dependent protein | 0.372 | 0.057 | 0.657 | 3.7e-10 | |
| ZFIN|ZDB-GENE-040426-1308 | 667 | prkg1a "protein kinase, cGMP-d | 0.372 | 0.056 | 0.631 | 3.8e-10 | |
| MGI|MGI:108174 | 671 | Prkg1 "protein kinase, cGMP-de | 0.372 | 0.056 | 0.657 | 3.8e-10 | |
| UNIPROTKB|P00516 | 671 | PRKG1 "cGMP-dependent protein | 0.372 | 0.056 | 0.657 | 3.8e-10 |
| UNIPROTKB|Q5JP05 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 155 (59.6 bits), Expect = 6.0e-11, P = 6.0e-11
Identities = 25/38 (65%), Positives = 30/38 (78%)
Query: 1 WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPD 38
WF+GFNWEGLR TL PPI+P + S TD+SNFD +P D
Sbjct: 230 WFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPED 267
|
|
| WB|WBGene00001173 egl-4 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SD02 PRKG1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| RGD|1587390 Prkg1 "protein kinase, cGMP-dependent, type 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9NWY9 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9JHE0 PRKG1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5SQU3 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1308 prkg1a "protein kinase, cGMP-dependent, type Ia" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:108174 Prkg1 "protein kinase, cGMP-dependent, type I" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00516 PRKG1 "cGMP-dependent protein kinase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 102 | |||
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 6e-11 | |
| cd05599 | 364 | cd05599, STKc_NDR_like, Catalytic domain of Nuclea | 2e-09 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 2e-09 | |
| cd05580 | 290 | cd05580, STKc_PKA, Catalytic domain of the Protein | 5e-09 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 7e-09 | |
| smart00133 | 64 | smart00133, S_TK_X, Extension to Ser/Thr-type prot | 2e-08 | |
| cd05612 | 291 | cd05612, STKc_PRKX_like, Catalytic domain of PRKX- | 4e-08 | |
| smart00133 | 64 | smart00133, S_TK_X, Extension to Ser/Thr-type prot | 8e-08 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 2e-07 | |
| cd05573 | 350 | cd05573, STKc_ROCK_NDR_like, Catalytic domain of R | 5e-07 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 7e-07 | |
| cd05593 | 328 | cd05593, STKc_PKB_gamma, Catalytic domain of the P | 3e-06 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 5e-06 | |
| cd05597 | 331 | cd05597, STKc_DMPK_like, Catalytic domain of Myoto | 5e-06 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 8e-06 | |
| cd05592 | 316 | cd05592, STKc_nPKC_theta_delta, Catalytic domain o | 8e-06 | |
| cd05589 | 324 | cd05589, STKc_PKN, Catalytic domain of the Protein | 1e-05 | |
| cd05593 | 328 | cd05593, STKc_PKB_gamma, Catalytic domain of the P | 2e-05 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 2e-05 | |
| cd05595 | 323 | cd05595, STKc_PKB_beta, Catalytic domain of the Pr | 2e-05 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 3e-05 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 3e-05 | |
| cd05592 | 316 | cd05592, STKc_nPKC_theta_delta, Catalytic domain o | 4e-05 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 4e-05 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 4e-05 | |
| cd05571 | 323 | cd05571, STKc_PKB, Catalytic domain of the Protein | 5e-05 | |
| cd05590 | 320 | cd05590, STKc_nPKC_eta, Catalytic domain of the Pr | 5e-05 | |
| cd05591 | 321 | cd05591, STKc_nPKC_epsilon, Catalytic domain of th | 5e-05 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 5e-05 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 6e-05 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 6e-05 | |
| cd05595 | 323 | cd05595, STKc_PKB_beta, Catalytic domain of the Pr | 8e-05 | |
| cd05614 | 332 | cd05614, STKc_MSK2_N, N-terminal catalytic domain | 9e-05 | |
| cd05601 | 330 | cd05601, STKc_CRIK, Catalytic domain of the Protei | 1e-04 | |
| cd05587 | 324 | cd05587, STKc_cPKC, Catalytic domain of the Protei | 2e-04 | |
| PTZ00263 | 329 | PTZ00263, PTZ00263, protein kinase A catalytic sub | 2e-04 | |
| cd05594 | 325 | cd05594, STKc_PKB_alpha, Catalytic domain of the P | 3e-04 | |
| cd05570 | 318 | cd05570, STKc_PKC, Catalytic domain of the Protein | 4e-04 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 4e-04 | |
| cd05619 | 316 | cd05619, STKc_nPKC_theta, Catalytic domain of the | 4e-04 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 4e-04 | |
| cd05585 | 312 | cd05585, STKc_YPK1_like, Catalytic domain of Yeast | 4e-04 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 4e-04 | |
| cd05620 | 316 | cd05620, STKc_nPKC_delta, Catalytic domain of the | 5e-04 | |
| cd05620 | 316 | cd05620, STKc_nPKC_delta, Catalytic domain of the | 5e-04 | |
| cd05596 | 370 | cd05596, STKc_ROCK, Catalytic domain of the Protei | 0.001 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 0.001 | |
| cd05624 | 331 | cd05624, STKc_MRCK_beta, Catalytic domain of the P | 0.001 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 0.001 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 0.002 | |
| cd05628 | 363 | cd05628, STKc_NDR1, Catalytic domain of the Protei | 0.002 | |
| cd05584 | 323 | cd05584, STKc_p70S6K, Catalytic domain of the Prot | 0.003 | |
| cd05600 | 333 | cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun | 0.003 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 0.003 | |
| cd05615 | 323 | cd05615, STKc_cPKC_alpha, Catalytic domain of the | 0.003 | |
| cd05621 | 370 | cd05621, STKc_ROCK2, Catalytic domain of the Prote | 0.003 | |
| cd05627 | 360 | cd05627, STKc_NDR2, Catalytic domain of the Protei | 0.004 | |
| cd05598 | 376 | cd05598, STKc_LATS, Catalytic domain of the Protei | 0.004 |
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
Score = 57.0 bits (138), Expect = 6e-11
Identities = 17/49 (34%), Positives = 27/49 (55%), Gaps = 2/49 (4%)
Query: 49 WFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTG 97
+F G +WE +R R PI+P+++S TD+SNFD++ P
Sbjct: 298 FFKGVDWEHIRERP--APIIPELKSITDTSNFDDFEEIDLDVPTSPGPP 344
|
Serine/Threonine Kinases (STKs), Nuclear Dbf2-Related (NDR) kinase subfamily, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The NDR subfamily is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. NDR kinase contains an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Like many other AGC kinases, NDR kinase requires phosphorylation at two sites, the activation loop (A-loop) and the hydrophobic motif (HM), for activity. NDR kinases regulate mitosis, cell growth, embryonic development, and neurological processes. They are also required for proper centrosome duplication. Higher eukaryotes contain two NDR isoforms, NDR1 and NDR2. This subfamily also contains fungal NDR-like kinases. Length = 364 |
| >gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|214529 smart00133, S_TK_X, Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173688 cd05597, STKc_DMPK_like, Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >gnl|CDD|173680 cd05589, STKc_PKN, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >gnl|CDD|173684 cd05593, STKc_PKB_gamma, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|173662 cd05571, STKc_PKB, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >gnl|CDD|173681 cd05590, STKc_nPKC_eta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >gnl|CDD|173682 cd05591, STKc_nPKC_epsilon, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173686 cd05595, STKc_PKB_beta, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >gnl|CDD|173705 cd05614, STKc_MSK2_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173678 cd05587, STKc_cPKC, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|140289 PTZ00263, PTZ00263, protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173685 cd05594, STKc_PKB_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173661 cd05570, STKc_PKC, Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173709 cd05619, STKc_nPKC_theta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >gnl|CDD|173710 cd05620, STKc_nPKC_delta, Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >gnl|CDD|173687 cd05596, STKc_ROCK, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|173713 cd05624, STKc_MRCK_beta, Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >gnl|CDD|173675 cd05584, STKc_p70S6K, Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173706 cd05615, STKc_cPKC_alpha, Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >gnl|CDD|173711 cd05621, STKc_ROCK2, Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| KOG0614|consensus | 732 | 99.73 | ||
| KOG0695|consensus | 593 | 99.24 | ||
| KOG0694|consensus | 694 | 99.17 | ||
| KOG0605|consensus | 550 | 99.17 | ||
| KOG0690|consensus | 516 | 98.96 | ||
| KOG0696|consensus | 683 | 98.92 | ||
| KOG0616|consensus | 355 | 98.8 | ||
| KOG0608|consensus | 1034 | 98.77 | ||
| smart00133 | 64 | S_TK_X Extension to Ser/Thr-type protein kinases. | 98.76 | |
| KOG0694|consensus | 694 | 98.67 | ||
| KOG0598|consensus | 357 | 98.62 | ||
| smart00133 | 64 | S_TK_X Extension to Ser/Thr-type protein kinases. | 98.56 | |
| KOG0616|consensus | 355 | 98.44 | ||
| KOG0612|consensus | 1317 | 98.42 | ||
| KOG0690|consensus | 516 | 98.34 | ||
| KOG0614|consensus | 732 | 98.13 | ||
| KOG0598|consensus | 357 | 98.08 | ||
| KOG0605|consensus | 550 | 98.02 | ||
| KOG0696|consensus | 683 | 97.89 | ||
| KOG0986|consensus | 591 | 97.67 | ||
| KOG0695|consensus | 593 | 97.65 | ||
| KOG0612|consensus | 1317 | 97.64 | ||
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 97.49 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 97.47 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 97.1 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 97.06 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 97.05 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 96.94 | |
| KOG0608|consensus | 1034 | 96.92 | ||
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 96.84 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 96.82 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 96.77 | |
| KOG0603|consensus | 612 | 96.76 | ||
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 96.74 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 96.64 | |
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 96.63 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 96.63 | |
| KOG0610|consensus | 459 | 96.46 | ||
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 96.29 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 96.22 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 96.22 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 96.2 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 96.14 | |
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 96.08 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 95.99 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 95.96 | |
| KOG0603|consensus | 612 | 95.77 | ||
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 95.76 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 95.57 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 95.56 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 95.54 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 95.45 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 95.42 | |
| cd05631 | 285 | STKc_GRK4 Catalytic domain of the Protein Serine/T | 95.3 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 95.24 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 95.05 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 94.99 | |
| KOG0606|consensus | 1205 | 94.97 | ||
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 94.81 | |
| KOG0986|consensus | 591 | 94.76 | ||
| cd05612 | 291 | STKc_PRKX_like Catalytic domain of PRKX-like Prote | 94.62 | |
| cd05587 | 324 | STKc_cPKC Catalytic domain of the Protein Serine/T | 94.61 | |
| cd05590 | 320 | STKc_nPKC_eta Catalytic domain of the Protein Seri | 94.46 | |
| KOG0592|consensus | 604 | 94.41 | ||
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 94.08 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 93.88 | |
| cd05623 | 332 | STKc_MRCK_alpha Catalytic domain of the Protein Se | 93.72 | |
| cd05617 | 327 | STKc_aPKC_zeta Catalytic domain of the Protein Ser | 93.69 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 93.66 | |
| cd05619 | 316 | STKc_nPKC_theta Catalytic domain of the Protein Se | 93.64 | |
| cd05584 | 323 | STKc_p70S6K Catalytic domain of the Protein Serine | 93.63 | |
| KOG0606|consensus | 1205 | 93.61 | ||
| cd05615 | 323 | STKc_cPKC_alpha Catalytic domain of the Protein Se | 93.4 | |
| cd05616 | 323 | STKc_cPKC_beta Catalytic domain of the Protein Ser | 93.23 | |
| cd05570 | 318 | STKc_PKC Catalytic domain of the Protein Serine/Th | 93.23 | |
| cd05589 | 324 | STKc_PKN Catalytic domain of the Protein Serine/Th | 93.14 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 93.09 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 93.0 | |
| cd05605 | 285 | STKc_GRK4_like Catalytic domain of G protein-coupl | 92.9 | |
| cd05571 | 323 | STKc_PKB Catalytic domain of the Protein Serine/Th | 92.77 | |
| KOG0610|consensus | 459 | 92.58 | ||
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 92.57 | |
| cd05614 | 332 | STKc_MSK2_N N-terminal catalytic domain of the Pro | 92.47 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 92.37 | |
| cd05601 | 330 | STKc_CRIK Catalytic domain of the Protein Serine/T | 92.28 | |
| cd05580 | 290 | STKc_PKA Catalytic domain of the Protein Serine/Th | 92.12 | |
| cd05597 | 331 | STKc_DMPK_like Catalytic domain of Myotonic Dystro | 92.04 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 92.04 | |
| cd05627 | 360 | STKc_NDR2 Catalytic domain of the Protein Serine/T | 91.98 | |
| cd05608 | 280 | STKc_GRK1 Catalytic domain of the Protein Serine/T | 91.71 | |
| cd05603 | 321 | STKc_SGK2 Catalytic domain of the Protein Serine/T | 91.59 | |
| cd05592 | 316 | STKc_nPKC_theta_delta Catalytic domain of the Prot | 91.58 | |
| cd05607 | 277 | STKc_GRK7 Catalytic domain of the Protein Serine/T | 91.3 | |
| cd05630 | 285 | STKc_GRK6 Catalytic domain of the Protein Serine/T | 91.21 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 90.78 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 90.5 | |
| cd05588 | 329 | STKc_aPKC Catalytic domain of the Protein Serine/T | 90.44 | |
| cd05593 | 328 | STKc_PKB_gamma Catalytic domain of the Protein Ser | 90.33 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 89.83 | |
| cd05591 | 321 | STKc_nPKC_epsilon Catalytic domain of the Protein | 89.53 | |
| cd05618 | 329 | STKc_aPKC_iota Catalytic domain of the Protein Ser | 89.27 | |
| PF00433 | 48 | Pkinase_C: Protein kinase C terminal domain; Inter | 88.8 | |
| cd05575 | 323 | STKc_SGK Catalytic domain of the Protein Serine/Th | 88.64 | |
| cd05625 | 382 | STKc_LATS1 Catalytic domain of the Protein Serine/ | 88.35 | |
| cd05585 | 312 | STKc_YPK1_like Catalytic domain of Yeast Protein K | 87.5 | |
| cd05602 | 325 | STKc_SGK1 Catalytic domain of the Protein Serine/T | 87.46 | |
| cd05620 | 316 | STKc_nPKC_delta Catalytic domain of the Protein Se | 87.46 | |
| cd05582 | 318 | STKc_RSK_N N-terminal catalytic domain of the Prot | 87.29 | |
| cd05595 | 323 | STKc_PKB_beta Catalytic domain of the Protein Seri | 87.2 | |
| cd05604 | 325 | STKc_SGK3 Catalytic domain of the Protein Serine/T | 87.12 | |
| cd05583 | 288 | STKc_MSK_N N-terminal catalytic domain of the Prot | 86.76 | |
| cd05599 | 364 | STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel | 86.29 | |
| cd05632 | 285 | STKc_GRK5 Catalytic domain of the Protein Serine/T | 85.86 | |
| cd05577 | 277 | STKc_GRK Catalytic domain of the Protein Serine/Th | 85.04 | |
| cd05594 | 325 | STKc_PKB_alpha Catalytic domain of the Protein Ser | 84.84 | |
| cd05586 | 330 | STKc_Sck1_like Catalytic domain of Suppressor of l | 84.41 | |
| cd05628 | 363 | STKc_NDR1 Catalytic domain of the Protein Serine/T | 84.39 | |
| cd05626 | 381 | STKc_LATS2 Catalytic domain of the Protein Serine/ | 83.63 | |
| cd05573 | 350 | STKc_ROCK_NDR_like Catalytic domain of ROCK- and N | 83.42 | |
| cd05598 | 376 | STKc_LATS Catalytic domain of the Protein Serine/T | 81.54 | |
| cd05629 | 377 | STKc_NDR_like_fungal Catalytic domain of Fungal Nu | 81.39 | |
| cd05600 | 333 | STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- | 80.92 | |
| cd05633 | 279 | STKc_GRK3 Catalytic domain of the Protein Serine/T | 80.42 | |
| cd05624 | 331 | STKc_MRCK_beta Catalytic domain of the Protein Ser | 80.39 |
| >KOG0614|consensus | Back alignment and domain information |
|---|
Probab=99.73 E-value=1.7e-18 Score=125.69 Aligned_cols=65 Identities=57% Similarity=1.177 Sum_probs=63.0
Q ss_pred cchhhcccCCCCCCCCChHHHhcCCCCCCeeccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q psy17573 38 DQAIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWDADF 102 (102)
Q Consensus 38 ~~~~~~i~~~~~F~~~dw~~l~~~~~~pp~~p~~~~~~d~~~fd~~~~~~~~~~~~~~~~~~~~~ 102 (102)
.+|+.+|++|.||.+|||+.|+.+.++||++|.++++.|++|||.|+.+.+.++|+|.||||+||
T Consensus 668 ~~gI~DIkkH~Wf~gfdweglr~~~L~pPi~~~va~ptD~s~Fd~~p~dnd~pppde~SGWD~dF 732 (732)
T KOG0614|consen 668 KGGINDIKKHRWFEGFDWEGLRSRTLPPPIIPSVANPTDVSNFDNFPPDNDEPPPDELSGWDKDF 732 (732)
T ss_pred cCChHHHHhhhhhhcCChhhhhhccCCCCccccCCCcccchhccCCCcccCCCCchhcccCCCCC
Confidence 47789999999999999999999999999999999999999999999999999999999999998
|
|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >smart00133 S_TK_X Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >KOG0694|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >smart00133 S_TK_X Extension to Ser/Thr-type protein kinases | Back alignment and domain information |
|---|
| >KOG0616|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >KOG0614|consensus | Back alignment and domain information |
|---|
| >KOG0598|consensus | Back alignment and domain information |
|---|
| >KOG0605|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >KOG0695|consensus | Back alignment and domain information |
|---|
| >KOG0612|consensus | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >KOG0608|consensus | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >KOG0603|consensus | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >KOG0986|consensus | Back alignment and domain information |
|---|
| >cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta | Back alignment and domain information |
|---|
| >KOG0592|consensus | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha | Back alignment and domain information |
|---|
| >cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta | Back alignment and domain information |
|---|
| >cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >KOG0606|consensus | Back alignment and domain information |
|---|
| >cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha | Back alignment and domain information |
|---|
| >cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta | Back alignment and domain information |
|---|
| >cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C | Back alignment and domain information |
|---|
| >cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B | Back alignment and domain information |
|---|
| >KOG0610|consensus | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase | Back alignment and domain information |
|---|
| >cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase | Back alignment and domain information |
|---|
| >cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 | Back alignment and domain information |
|---|
| >cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 | Back alignment and domain information |
|---|
| >cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 | Back alignment and domain information |
|---|
| >cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta | Back alignment and domain information |
|---|
| >cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 | Back alignment and domain information |
|---|
| >cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C | Back alignment and domain information |
|---|
| >cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon | Back alignment and domain information |
|---|
| >cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota | Back alignment and domain information |
|---|
| >PF00433 Pkinase_C: Protein kinase C terminal domain; InterPro: IPR017892 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases | Back alignment and domain information |
|---|
| >cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase | Back alignment and domain information |
|---|
| >cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 | Back alignment and domain information |
|---|
| >cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 | Back alignment and domain information |
|---|
| >cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta | Back alignment and domain information |
|---|
| >cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase | Back alignment and domain information |
|---|
| >cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta | Back alignment and domain information |
|---|
| >cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 | Back alignment and domain information |
|---|
| >cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase | Back alignment and domain information |
|---|
| >cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 | Back alignment and domain information |
|---|
| >cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase | Back alignment and domain information |
|---|
| >cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha | Back alignment and domain information |
|---|
| >cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 | Back alignment and domain information |
|---|
| >cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 | Back alignment and domain information |
|---|
| >cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor | Back alignment and domain information |
|---|
| >cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases | Back alignment and domain information |
|---|
| >cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 | Back alignment and domain information |
|---|
| >cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 102 | ||||
| 1mrv_A | 339 | Crystal Structure Of An Inactive Akt2 Kinase Domain | 3e-04 | ||
| 1gzn_A | 335 | Structure Of Pkb Kinase Domain Length = 335 | 3e-04 | ||
| 1o6k_A | 336 | Structure Of Activated Form Of Pkb Kinase Domain S4 | 3e-04 | ||
| 3iw4_A | 360 | Crystal Structure Of Pkc Alpha In Complex With Nvp- | 6e-04 | ||
| 3e87_A | 335 | Crystal Structures Of The Kinase Domain Of Akt2 In | 6e-04 | ||
| 3tku_A | 433 | Mrck Beta In Complex With Fasudil Length = 433 | 7e-04 | ||
| 3qfv_A | 415 | Mrck Beta In Complex With Tpca-1 Length = 415 | 7e-04 |
| >pdb|1MRV|A Chain A, Crystal Structure Of An Inactive Akt2 Kinase Domain Length = 339 | Back alignment and structure |
|
| >pdb|1GZN|A Chain A, Structure Of Pkb Kinase Domain Length = 335 | Back alignment and structure |
| >pdb|1O6K|A Chain A, Structure Of Activated Form Of Pkb Kinase Domain S474d With Gsk3 Peptide And Amp-Pnp Length = 336 | Back alignment and structure |
| >pdb|3IW4|A Chain A, Crystal Structure Of Pkc Alpha In Complex With Nvp-Aeb071 Length = 360 | Back alignment and structure |
| >pdb|3E87|A Chain A, Crystal Structures Of The Kinase Domain Of Akt2 In Complex With Atp- Competitive Inhibitors Length = 335 | Back alignment and structure |
| >pdb|3TKU|A Chain A, Mrck Beta In Complex With Fasudil Length = 433 | Back alignment and structure |
| >pdb|3QFV|A Chain A, Mrck Beta In Complex With Tpca-1 Length = 415 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 102 | |||
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 6e-16 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 6e-14 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 3e-12 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 1e-10 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 5e-12 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 5e-12 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 2e-09 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 3e-09 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 2e-08 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 2e-07 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 3e-08 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 6e-08 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 4e-08 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 3e-07 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 6e-08 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 4e-07 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 7e-08 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 3e-07 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 7e-08 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 1e-07 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 8e-08 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 2e-07 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 8e-08 | |
| 3g51_A | 325 | Ribosomal protein S6 kinase alpha-3; N-terminal ki | 9e-08 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 9e-08 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 1e-07 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 3e-07 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 4e-07 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 4e-07 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 4e-07 | |
| 3pvu_A | 695 | Beta-adrenergic receptor kinase 1; transferase, se | 2e-06 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 3e-06 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 2e-05 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 3e-06 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 2e-05 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 6e-05 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 9e-05 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 3e-04 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 3e-04 |
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
Score = 70.0 bits (172), Expect = 6e-16
Identities = 15/56 (26%), Positives = 29/56 (51%), Gaps = 1/56 (1%)
Query: 48 RWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTGWD-ADF 102
+WF +W + R + P +PK + D+SNFD+Y ++ ++ G + +F
Sbjct: 295 KWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF 350
|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 | Back alignment and structure |
|---|
| >3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 98.74 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 98.62 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 98.52 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 98.47 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 98.4 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 98.37 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 98.34 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 98.33 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 98.33 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 98.32 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 98.31 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 98.28 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 98.12 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 98.1 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 97.94 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 97.93 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 97.9 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 97.89 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 97.82 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 97.78 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 97.76 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 97.71 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 97.67 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 97.65 | |
| 1o6l_A | 337 | RAC-beta serine/threonine protein kinase; protein | 97.62 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 97.52 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 97.5 | |
| 1fot_A | 318 | TPK1 delta, CAMP-dependent protein kinase type 1; | 97.48 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 97.42 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 97.41 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 97.37 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 97.24 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 97.19 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 97.02 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 96.94 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 96.73 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 96.25 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 96.08 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 95.67 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 94.83 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 92.74 |
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
Probab=98.74 E-value=2.4e-09 Score=75.70 Aligned_cols=55 Identities=20% Similarity=0.465 Sum_probs=50.1
Q ss_pred hhhcccCCCCCCCCChHHHhcCCCCCCeeccCCCCCCCCCCCC-CCCCCCCCCCCC
Q psy17573 40 AIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDE-YPPDQDPPPADD 94 (102)
Q Consensus 40 ~~~~i~~~~~F~~~dw~~l~~~~~~pp~~p~~~~~~d~~~fd~-~~~~~~~~~~~~ 94 (102)
++.+++.|+||++++|+.+.++++.|||+|.+.+..|++|||. |+++....+|++
T Consensus 312 ~~~ei~~Hpff~~i~w~~l~~~~~~pp~~p~~~~~~d~~~fd~~~~~~~~~~~~~~ 367 (396)
T 4dc2_A 312 GFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEPVQLTPDD 367 (396)
T ss_dssp HHHHHHHSTTTTTCCHHHHHTTCSCCSCCCCCCSSTTGGGSCHHHHTSCCCCCCCC
T ss_pred CHHHHhcCccccCCCHHHHHcCCCCCCCcCCCCCccchhhcChhhccCCCccCCCc
Confidence 5678999999999999999999999999999999999999997 777777777765
|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 102 | ||||
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 4e-11 | |
| d1rdqe_ | 350 | d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni | 7e-11 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 2e-10 | |
| d1xjda_ | 320 | d.144.1.7 (A:) Protein kinase C, theta type {Human | 6e-10 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 5e-10 | |
| d1o6la_ | 337 | d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap | 5e-10 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 1e-08 | |
| d1fota_ | 316 | d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni | 2e-08 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 3e-08 | |
| d1omwa3 | 364 | d.144.1.7 (A:186-549) G-protein coupled receptor k | 4e-08 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 4e-06 | |
| d1vzoa_ | 322 | d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 | 4e-06 |
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: cAMP-dependent PK, catalytic subunit species: Mouse (Mus musculus) [TaxId: 10090]
Score = 55.6 bits (133), Expect = 4e-11
Identities = 14/50 (28%), Positives = 26/50 (52%)
Query: 48 RWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDPPPADDLTG 97
+WF +W + R + P +PK + D+SNFD+Y ++ ++ G
Sbjct: 295 KWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCG 344
|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 102 | |||
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 98.47 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 98.22 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 98.13 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 97.98 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 97.83 | |
| d1xjda_ | 320 | Protein kinase C, theta type {Human (Homo sapiens) | 97.54 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 97.52 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 97.46 | |
| d1fota_ | 316 | cAMP-dependent PK, catalytic subunit {Baker's yeas | 97.45 | |
| d1o6la_ | 337 | Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 | 97.39 | |
| d1omwa3 | 364 | G-protein coupled receptor kinase 2 {Cow (Bos taur | 96.45 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 91.67 |
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Protein kinase-like (PK-like) superfamily: Protein kinase-like (PK-like) family: Protein kinases, catalytic subunit domain: cAMP-dependent PK, catalytic subunit species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.47 E-value=9.3e-08 Score=64.94 Aligned_cols=50 Identities=26% Similarity=0.585 Sum_probs=44.6
Q ss_pred hhhcccCCCCCCCCChHHHhcCCCCCCeeccCCCCCCCCCCCCCCCCCCC
Q psy17573 40 AIFLSFPCRWFDGFNWEGLRNRTLIPPILPKIRSQTDSSNFDEYPPDQDP 89 (102)
Q Consensus 40 ~~~~i~~~~~F~~~dw~~l~~~~~~pp~~p~~~~~~d~~~fd~~~~~~~~ 89 (102)
.+.++..|+||++++|..+.+++++|||+|...+..|++||+++..+...
T Consensus 287 t~~ell~Hp~f~~~~~~~~~~~~~~~p~~p~~~~~~d~s~~~~~~~~~~~ 336 (350)
T d1rdqe_ 287 GVNDIKNHKWFATTDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIR 336 (350)
T ss_dssp TTHHHHTSGGGTTCCHHHHHTTCSCCSCCCCCCSTTCCTTSCCCCCCCCC
T ss_pred cHHHHHcCccccCCCHHHHHhcCCCcCccCCCCCcchhhhcCCCCccccc
Confidence 57789999999999999999999999999999999999999987655543
|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|