Psyllid ID: psy1764

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------50
MGQSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGVQCQPCKKTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQMAVTCANIQCQPGQTCLTDLRNGSPRCQTCSYPPSCPHRHQGPLPPMLCGSNHVTYPSWCEMKADECQQRIVIETKYSGPCHSQELFLFEETWR
ccccccccEEEcccccccccccccccccccEEEcccccccEEEEEEEccccccccccccccccccccccEEEEcccccEEccccccccccccccccccccccccccccccccHHHHcccccEEEEcccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccEEEccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccEEccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEccccccccccccccccccccccccccccccccccccccccccccEEcccccEEcccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccEEEEEcccccccccccccccccc
cccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHcEEccccccccccccccccEcccccEEEEcccccEEEccccccccccccccccEcccccccccHHHHHHHHHHccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccEcccccccccHHHHHHHHHHccccEEEEEccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccHHHHHHHcccccEEEEEccccccccccccccccccccccccccccHHHHHHHHccccccEEEEEcccccccccccccccccEEEEcccccEEcccccccccccccccccccccccccccHcHHHHHHHcccccEEEEEcccccccccccccccccccEEEEccccccccccccccccccccccccccccccEcccccccccHHHHHHHHHHccccEEEEEccccccccccccccccc
mgqsgrctellsekvgreeCCKEANglgaawskedlepgTMFFWRVlgggvqcqpckktcenidcgegkkcaikkgypkcicapdckqrgrhmrnpvcgsdgrnykTVCRLRKRacrknevisvdyfgtcqtgscdrvtcpsgkfcildqnliphcnrcirhcvtpssdthqvcgtdgvtyeSACHLREAACRrgksipiayrghckpgscdrvtcpsgkfcildqnliphcnrcirhcvtpssdthqvcgtdgvtyeSACHLREAACRrgksipiayrghckltesSIKTFWGvwsgtdgvtyeSACHLREAACRrgksipiayrghckqtcenidcgegkkcaikkgypkcicapdckqrgrhmrnpvcgsdgrnykTVCRLRKRACRKNEVISVDYFGTCqmavtcaniqcqpgqtcltdlrngsprcqtcsyppscphrhqgplppmlcgsnhvtypswcemkadECQQRIVIetkysgpchsqelflfeetwr
mgqsgrctellsekvgreeCCKEANGlgaawskedLEPGTMFFWRVLGGGVQCQPCKKTCenidcgegkkcaikkgypkCICApdckqrgrhmrnpvcgsdgrnykTVCRLRKracrknevisvdyfgtcqtgsCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCENIDCGEGKKCAIKKGYPKCICapdckqrgrhmrnpvcgsdgrnykTVCRLRKRACRKNEVISVDYFGTCQMAVTCANIQCQPGQTCLTDLRNGSPRCQTCSYPPSCPHRHQGPLPPMLCGSNHVTYPSWCEMKADECQQRIVIETkysgpchsqelflfeetwr
MGQSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGVQCQPCKKTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQMAVTCANIQCQPGQTCLTDLRNGSPRCQTCSYPPSCPHRHQGPLPPMLCGSNHVTYPSWCEMKADECQQRIVIETKYSGPCHSQELFLFEETWR
******************ECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGVQCQPCKKTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQMAVTCANIQCQPGQTCLTDLRNGSPRCQTCSY***********LPPMLCGSNHVTYPSWCEMKADECQQRIVIETKYSGPCHSQELFLFE****
****GRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGVQCQPCKKTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCE**********AIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQMAV*****QCQ*GQTCLTDLRNGSPRCQTCSYPPSCPHRHQGPLPPMLCGSNHVTYPSWCEMKADECQQRIVIETKYSGPCHSQELFLFEETWR
*********LLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGVQCQPCKKTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQMAVTCANIQCQPGQTCLTDLRNGSPRCQTCSYPPSCPHRHQGPLPPMLCGSNHVTYPSWCEMKADECQQRIVIETKYSGPCHSQELFLFEETWR
****GRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGVQCQPCKKTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQMAVTCANIQCQPGQTCLTDLRNGSPRCQTCSYPPSCPHRHQGPLPPMLCGSNHVTYPSWCEMKADECQQRIVIETKYSGPCHSQE*********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGQSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGVQCQPCKKTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKPGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESSIKTFWGVWSGTDGVTYESACHLREAACRRGKSIPIAYRGHCKQTCENIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQMAVTCANIQCQPGQTCLTDLRNGSPRCQTCSYPPSCPHRHQGPLPPMLCGSNHVTYPSWCEMKADECQQRIVIETKYSGPCHSQELFLFEETWR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query498 2.2.26 [Sep-21-2011]
P47931344 Follistatin OS=Mus muscul yes N/A 0.554 0.802 0.417 1e-53
P21674344 Follistatin OS=Rattus nor yes N/A 0.554 0.802 0.417 2e-53
P19883344 Follistatin OS=Homo sapie yes N/A 0.554 0.802 0.414 4e-53
P50291344 Follistatin OS=Bos taurus yes N/A 0.552 0.799 0.416 6e-53
P10669344 Follistatin OS=Sus scrofa yes N/A 0.552 0.799 0.412 9e-53
O62650344 Follistatin OS=Equus caba yes N/A 0.552 0.799 0.409 2e-52
P31514337 Follistatin (Fragment) OS N/A N/A 0.552 0.816 0.412 2e-52
A5YT95344 Follistatin OS=Bubalus bu N/A N/A 0.552 0.799 0.412 7e-52
Q9YHV4322 Follistatin-A OS=Danio re yes N/A 0.554 0.857 0.4 3e-51
Q90844343 Follistatin OS=Gallus gal yes N/A 0.556 0.807 0.409 2e-49
>sp|P47931|FST_MOUSE Follistatin OS=Mus musculus GN=Fst PE=2 SV=1 Back     alignment and function desciption
 Score =  211 bits (536), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 119/285 (41%), Positives = 161/285 (56%), Gaps = 9/285 (3%)

Query: 2   GQSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGV-QCQPCKKTC 60
            ++GRC  L   ++ +EECC     L  +W++ED+   T+F W +  GG   C PCK+TC
Sbjct: 37  AKNGRCQVLYKTELSKEECCSTGR-LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETC 95

Query: 61  ENIDCGEGKKCAI-KKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKN 119
           EN+DCG GKKC + KK  P+C+CAPDC       + PVCG DG+ Y+  C L K  C++ 
Sbjct: 96  ENVDCGPGKKCRMNKKNKPRCVCAPDCSNI--TWKGPVCGLDGKTYRNECALLKARCKEQ 153

Query: 120 EVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGV 179
             + V Y G C+  +C  V CP    C++DQ    +C  C R C  PSS    +CG DGV
Sbjct: 154 PELEVQYQGKCKK-TCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGV 212

Query: 180 TYESACHLREAACRRGKSIPIAYRGHC-KPGSCDRVTCPSGKFCILDQNL-IPHCNRCIR 237
           TY SACHLR+A C  G+SI +AY G C K  SC+ + C  GK C+ D  +    C+ C  
Sbjct: 213 TYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDE 272

Query: 238 HCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHC 282
            C    SD   VC +D  TY S C ++EAAC  G  + + + G C
Sbjct: 273 LCPDSKSD-EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316
Binds directly to activin and functions as an activin antagonist. Specific inhibitor of the biosynthesis and secretion of pituitary follicle stimulating hormone (FSH).
Mus musculus (taxid: 10090)
>sp|P21674|FST_RAT Follistatin OS=Rattus norvegicus GN=Fst PE=1 SV=1 Back     alignment and function description
>sp|P19883|FST_HUMAN Follistatin OS=Homo sapiens GN=FST PE=1 SV=2 Back     alignment and function description
>sp|P50291|FST_BOVIN Follistatin OS=Bos taurus GN=FST PE=2 SV=2 Back     alignment and function description
>sp|P10669|FST_PIG Follistatin OS=Sus scrofa GN=FST PE=1 SV=1 Back     alignment and function description
>sp|O62650|FST_HORSE Follistatin OS=Equus caballus GN=FST PE=2 SV=1 Back     alignment and function description
>sp|P31514|FST_SHEEP Follistatin (Fragment) OS=Ovis aries GN=FST PE=2 SV=1 Back     alignment and function description
>sp|A5YT95|FST_BUBBU Follistatin OS=Bubalus bubalis GN=FST PE=2 SV=1 Back     alignment and function description
>sp|Q9YHV4|FSTA_DANRE Follistatin-A OS=Danio rerio GN=fsta PE=2 SV=2 Back     alignment and function description
>sp|Q90844|FST_CHICK Follistatin OS=Gallus gallus GN=FST PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query498
328718643396 PREDICTED: follistatin-like isoform 2 [A 0.590 0.742 0.453 3e-65
328718641362 PREDICTED: follistatin-like isoform 1 [A 0.590 0.812 0.453 3e-65
242015758292 follistatin, putative [Pediculus humanus 0.528 0.900 0.467 5e-64
189238975287 PREDICTED: similar to follistatin [Tribo 0.558 0.968 0.479 3e-63
328702998380 PREDICTED: follistatin-like [Acyrthosiph 0.564 0.739 0.467 5e-63
307185193 899 Putative GPI-anchor transamidase [Campon 0.560 0.310 0.443 4e-62
380011441 898 PREDICTED: uncharacterized protein LOC10 0.642 0.356 0.409 2e-61
328776630 884 PREDICTED: hypothetical protein LOC41105 0.642 0.361 0.409 4e-61
332016536353 Follistatin [Acromyrmex echinatior] 0.564 0.796 0.427 9e-58
443717346290 hypothetical protein CAPTEDRAFT_186626 [ 0.526 0.903 0.434 1e-52
>gi|328718643|ref|XP_003246537.1| PREDICTED: follistatin-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  255 bits (652), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 140/309 (45%), Positives = 199/309 (64%), Gaps = 15/309 (4%)

Query: 1   MGQSGRCTELLSEKVGREECCKEANGLGAAWSKE-DLEPGTMFFWRVLGGGVQCQPCKKT 59
           MG++G C +LL+E++ +E+CCK      +      DL+PG +FFWRVLG GV C  CK +
Sbjct: 79  MGKNGLCKDLLAERLSKEQCCKLGGSSVSTSWSSTDLDPGALFFWRVLGDGVPCAKCKGS 138

Query: 60  CENIDCGEGKKCAIKKGYPKCICAPDCKQR-GRHMRNPVCGSDGRNYKTVCRLRKRACR- 117
           C +++C  GKKC ++ G PKC+C+P+CKQR G  ++ PVCG+DG +YK+ CRL+KR+CR 
Sbjct: 139 CTDVECVTGKKCVMRSGSPKCVCSPNCKQRDGFTVKGPVCGTDGVSYKSHCRLKKRSCRT 198

Query: 118 KNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTD 177
           +++ + VDY G CQ+ SC++VTCP GK+C+ DQNL+PHC +C   C    S +  VCG+D
Sbjct: 199 RDQSLVVDYHGMCQS-SCNKVTCPGGKYCLQDQNLMPHCVKCATFCPPGMSPSRLVCGSD 257

Query: 178 GVTYESACHLREAACRRGKSIPIAYRGHC-KPGSCDRVTCPSGKFCILDQNL-IPHCNRC 235
           G TY+SACHLREAACR GK+IPIAY+G C K  +C  V+C  G+ C++++    P C  C
Sbjct: 258 GRTYQSACHLREAACRMGKAIPIAYKGLCKKSATCATVSCKGGQKCLVEKKTGRPRCVTC 317

Query: 236 IRHCVTPSS-----DTH--QVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCKLTESS 288
              C  P +     DT   +VCG++  TY S C +   AC  G  I     G C+  +  
Sbjct: 318 NLSCPEPETSGKRKDTADGKVCGSNDKTYHSWCQMFMDACATGVVIETKASGPCR--DGE 375

Query: 289 IKTFWGVWS 297
           +  F G W+
Sbjct: 376 MDVFNGNWN 384

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328718641|ref|XP_003246536.1| PREDICTED: follistatin-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242015758|ref|XP_002428514.1| follistatin, putative [Pediculus humanus corporis] gi|212513148|gb|EEB15776.1| follistatin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189238975|ref|XP_001813556.1| PREDICTED: similar to follistatin [Tribolium castaneum] gi|270011191|gb|EFA07639.1| follistatin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328702998|ref|XP_003242063.1| PREDICTED: follistatin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307185193|gb|EFN71330.1| Putative GPI-anchor transamidase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380011441|ref|XP_003689814.1| PREDICTED: uncharacterized protein LOC100867147 [Apis florea] Back     alignment and taxonomy information
>gi|328776630|ref|XP_394531.3| PREDICTED: hypothetical protein LOC411058 [Apis mellifera] Back     alignment and taxonomy information
>gi|332016536|gb|EGI57417.1| Follistatin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|443717346|gb|ELU08470.1| hypothetical protein CAPTEDRAFT_186626 [Capitella teleta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query498
MGI|MGI:95586344 Fst "follistatin" [Mus musculu 0.552 0.799 0.419 1.2e-63
RGD|2633344 Fst "follistatin" [Rattus norv 0.552 0.799 0.419 2e-63
UNIPROTKB|P19883344 FST "Follistatin" [Homo sapien 0.552 0.799 0.415 4.2e-63
UNIPROTKB|P50291344 FST "Follistatin" [Bos taurus 0.550 0.796 0.417 5.4e-63
UNIPROTKB|E1BXU7323 FST "Follistatin" [Gallus gall 0.552 0.851 0.415 6.9e-63
UNIPROTKB|G1K348329 FST "Follistatin" [Gallus gall 0.552 0.835 0.415 6.9e-63
UNIPROTKB|Q90844343 FST "Follistatin" [Gallus gall 0.552 0.801 0.415 6.9e-63
UNIPROTKB|F1SLQ4344 FST "Follistatin" [Sus scrofa 0.550 0.796 0.414 8.8e-63
UNIPROTKB|P10669344 FST "Follistatin" [Sus scrofa 0.550 0.796 0.414 8.8e-63
ZFIN|ZDB-GENE-990714-11322 fsta "follistatin a" [Danio re 0.552 0.854 0.402 2.1e-61
MGI|MGI:95586 Fst "follistatin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 649 (233.5 bits), Expect = 1.2e-63, P = 1.2e-63
 Identities = 119/284 (41%), Positives = 161/284 (56%)

Query:     3 QSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGV-QCQPCKKTCE 61
             ++GRC  L   ++ +EECC     L  +W++ED+   T+F W +  GG   C PCK+TCE
Sbjct:    38 KNGRCQVLYKTELSKEECCSTGR-LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCE 96

Query:    62 NIDCGEGKKCAI-KKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNE 120
             N+DCG GKKC + KK  P+C+CAPDC       + PVCG DG+ Y+  C L K  C++  
Sbjct:    97 NVDCGPGKKCRMNKKNKPRCVCAPDCSNIT--WKGPVCGLDGKTYRNECALLKARCKEQP 154

Query:   121 VISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGVT 180
              + V Y G C+  +C  V CP    C++DQ    +C  C R C  PSS    +CG DGVT
Sbjct:   155 ELEVQYQGKCKK-TCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPSSSEQYLCGNDGVT 213

Query:   181 YESACHLREAACRRGKSIPIAYRGHC-KPGSCDRVTCPSGKFCILDQNL-IPHCNRCIRH 238
             Y SACHLR+A C  G+SI +AY G C K  SC+ + C  GK C+ D  +    C+ C   
Sbjct:   214 YSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCGGGKKCLWDSKVGRGRCSLCDEL 273

Query:   239 CVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHC 282
             C    SD   VC +D  TY S C ++EAAC  G  + + + G C
Sbjct:   274 CPDSKSD-EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 316
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=ISO
GO:0002244 "hematopoietic progenitor cell differentiation" evidence=ISO
GO:0005576 "extracellular region" evidence=IEA
GO:0005634 "nucleus" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0007276 "gamete generation" evidence=IGI
GO:0007389 "pattern specification process" evidence=IMP
GO:0008585 "female gonad development" evidence=IMP
GO:0030509 "BMP signaling pathway" evidence=IGI
GO:0031069 "hair follicle morphogenesis" evidence=IMP
GO:0032926 "negative regulation of activin receptor signaling pathway" evidence=ISO
GO:0042475 "odontogenesis of dentin-containing tooth" evidence=IMP
GO:0043395 "heparan sulfate proteoglycan binding" evidence=ISO
GO:0043616 "keratinocyte proliferation" evidence=IMP
GO:0045596 "negative regulation of cell differentiation" evidence=IGI;IMP
GO:0048185 "activin binding" evidence=ISO
GO:0051798 "positive regulation of hair follicle development" evidence=ISO
RGD|2633 Fst "follistatin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P19883 FST "Follistatin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P50291 FST "Follistatin" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1BXU7 FST "Follistatin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G1K348 FST "Follistatin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q90844 FST "Follistatin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SLQ4 FST "Follistatin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P10669 FST "Follistatin" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990714-11 fsta "follistatin a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query498
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 1e-08
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 1e-08
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 6e-08
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 6e-08
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 2e-06
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 2e-06
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 2e-06
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 7e-06
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 2e-05
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 2e-05
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 8e-05
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 8e-05
pfam0005048 pfam00050, Kazal_1, Kazal-type serine protease inh 1e-04
pfam0005048 pfam00050, Kazal_1, Kazal-type serine protease inh 1e-04
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 5e-04
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 5e-04
cd0132886 cd01328, FSL_SPARC, Follistatin-like SPARC (secret 5e-04
cd0132886 cd01328, FSL_SPARC, Follistatin-like SPARC (secret 5e-04
pfam0764842 pfam07648, Kazal_2, Kazal-type serine protease inh 0.001
smart0028046 smart00280, KAZAL, Kazal type serine protease inhi 0.002
cd0010441 cd00104, KAZAL_FS, Kazal type serine protease inhi 0.002
TIGR00805633 TIGR00805, oat, sodium-independent organic anion t 0.003
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information 
 Score = 50.4 bits (121), Expect = 1e-08
 Identities = 20/40 (50%), Positives = 26/40 (65%)

Query: 167 SSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHC 206
             +   VCG+DGVTY + CHL +AAC  GKSI + + G C
Sbjct: 7   PREYDPVCGSDGVTYSNECHLCKAACESGKSIEVKHDGPC 46

Kazal type serine protease inhibitors and follistatin-like domains. Length = 46
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|200959 pfam00050, Kazal_1, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|200959 pfam00050, Kazal_1, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|238649 cd01328, FSL_SPARC, Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information
>gnl|CDD|238649 cd01328, FSL_SPARC, Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information
>gnl|CDD|191798 pfam07648, Kazal_2, Kazal-type serine protease inhibitor domain Back     alignment and domain information
>gnl|CDD|197624 smart00280, KAZAL, Kazal type serine protease inhibitors Back     alignment and domain information
>gnl|CDD|238052 cd00104, KAZAL_FS, Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>gnl|CDD|233136 TIGR00805, oat, sodium-independent organic anion transporter Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 498
cd0132886 FSL_SPARC Follistatin-like SPARC (secreted protein 99.62
cd0132886 FSL_SPARC Follistatin-like SPARC (secreted protein 99.53
cd0132745 KAZAL_PSTI Kazal-type pancreatic secretory trypsin 99.33
smart0028046 KAZAL Kazal type serine protease inhibitors. Kazal 99.31
cd0132745 KAZAL_PSTI Kazal-type pancreatic secretory trypsin 99.23
smart0028046 KAZAL Kazal type serine protease inhibitors. Kazal 99.22
PF0764842 Kazal_2: Kazal-type serine protease inhibitor doma 99.02
cd0010441 KAZAL_FS Kazal type serine protease inhibitors and 99.0
PF0005048 Kazal_1: Kazal-type serine protease inhibitor doma 98.98
PF0764842 Kazal_2: Kazal-type serine protease inhibitor doma 98.95
PF0005048 Kazal_1: Kazal-type serine protease inhibitor doma 98.92
cd0010441 KAZAL_FS Kazal type serine protease inhibitors and 98.89
KOG4004|consensus259 98.74
KOG4004|consensus259 98.45
KOG4578|consensus421 97.89
KOG3555|consensus434 97.77
KOG4578|consensus 421 97.57
KOG3555|consensus 434 97.11
cd0133054 KAZAL_SLC21 The kazal-type serine protease inhibit 96.63
cd0133054 KAZAL_SLC21 The kazal-type serine protease inhibit 96.6
smart0005769 FIMAC factor I membrane attack complex. 96.4
smart0005769 FIMAC factor I membrane attack complex. 96.27
smart0027426 FOLN Follistatin-N-terminal domain-like. Follistat 96.01
PF0928922 FOLN: Follistatin/Osteonectin-like EGF domain; Int 95.92
KOG3509|consensus 964 94.44
smart0027426 FOLN Follistatin-N-terminal domain-like. Follistat 94.19
KOG3509|consensus 964 94.15
TIGR00805633 oat sodium-independent organic anion transporter. 84.61
TIGR00805633 oat sodium-independent organic anion transporter. 84.42
PF0928922 FOLN: Follistatin/Osteonectin-like EGF domain; Int 81.31
KOG3626|consensus735 80.11
KOG4597|consensus560 80.1
>cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information 
Probab=99.62  E-value=2.7e-16  Score=129.24  Aligned_cols=73  Identities=33%  Similarity=0.884  Sum_probs=63.7

Q ss_pred             cccceeccCCceeEe-ecCCCceeeCchhhhhcccCCCCcccCCCccceeeehhhhhhhccc-----------ceEEEee
Q psy1764          59 TCENIDCGEGKKCAI-KKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKN-----------EVISVDY  126 (498)
Q Consensus        59 ~C~~~~C~~g~~C~~-~~~~~~C~C~~~C~~~~~~~~~PVCGsDG~TY~n~C~l~~~~C~~~-----------~~l~v~~  126 (498)
                      ||+++.|++|++|++ ..++|+|+|.+.|+... ..+.|||||||+||.|+|+|++++|..+           ..|+|.|
T Consensus         1 pC~~v~C~~G~~C~~d~~~~p~CvC~~~Cp~~~-~~~~~VCGsDg~TY~s~C~L~r~~C~~~~~~~~~~~~~~~~l~i~Y   79 (86)
T cd01328           1 PCENHHCGAGKVCEVDDENTPKCVCIDPCPEEV-DDRRKVCTNDNETFDSDCELYRTRCLCKGGKKGCRGPKYQHLHLDY   79 (86)
T ss_pred             CCCCcCCCCCCEeeECCCCCeEEecCCcCCCCC-CCCCceeCCCCCCcccHhHHhhhHhccCCCCcCCCCCccCeEEEEe
Confidence            689999999999999 58999999999999721 2347899999999999999999999732           4799999


Q ss_pred             cccccc
Q psy1764         127 FGTCQT  132 (498)
Q Consensus       127 ~G~C~~  132 (498)
                      .|+|+.
T Consensus        80 ~G~Ck~   85 (86)
T cd01328          80 YGECKE   85 (86)
T ss_pred             eccccC
Confidence            999975

The protein it composed of an N-terminal acidic region, a follistatin (FS) domain and an EF-hand calcium binding domain. The FS domain consists of an N-terminal beta hairpin (FOLN/EGF-like domain) and a small hydrophobic core of alpha/beta structure (Kazal domain) and has five disulfide bonds and a conserved N-glycosylation site. The FSL_SPARC domain is a member of the superfamily of kazal-like proteinase inhibitors and follistatin-like proteins.
>cd01328 FSL_SPARC Follistatin-like SPARC (secreted protein, acidic, and rich in cysteines) domain; SPARC/BM-40/osteonectin is a multifunctional glycoprotein which modulates cellular interaction with the extracellular matrix by its binding to structural matrix proteins such as collagen and vitronectin Back     alignment and domain information
>cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins Back     alignment and domain information
>smart00280 KAZAL Kazal type serine protease inhibitors Back     alignment and domain information
>cd01327 KAZAL_PSTI Kazal-type pancreatic secretory trypsin inhibitors (PSTI) and related proteins, including the second domain of the ovomucoid turkey inhibitor and the C-terminal domain of the esophagus cancer-related gene-2 protein (ECRG-2), are members of the superfamily of kazal-type proteinase inhibitors and follistatin-like proteins Back     alignment and domain information
>smart00280 KAZAL Kazal type serine protease inhibitors Back     alignment and domain information
>PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 Back     alignment and domain information
>cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>PF07648 Kazal_2: Kazal-type serine protease inhibitor domain; InterPro: IPR011497 This domain is usually indicative of serine protease inhibitors that belong to Merops inhibitor families: I1, I2, I17 and I31 Back     alignment and domain information
>PF00050 Kazal_1: Kazal-type serine protease inhibitor domain; InterPro: IPR002350 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>cd00104 KAZAL_FS Kazal type serine protease inhibitors and follistatin-like domains Back     alignment and domain information
>KOG4004|consensus Back     alignment and domain information
>KOG4004|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake Back     alignment and domain information
>cd01330 KAZAL_SLC21 The kazal-type serine protease inhibitor domain has been detected in an extracellular loop region of solute carrier 21 (SLC21) family members (organic anion transporters) , which may regulate the specificity of anion uptake Back     alignment and domain information
>smart00057 FIMAC factor I membrane attack complex Back     alignment and domain information
>smart00057 FIMAC factor I membrane attack complex Back     alignment and domain information
>smart00274 FOLN Follistatin-N-terminal domain-like Back     alignment and domain information
>PF09289 FOLN: Follistatin/Osteonectin-like EGF domain; InterPro: IPR015369 This domain is predominantly found in osteonectin and follistatin Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>smart00274 FOLN Follistatin-N-terminal domain-like Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF09289 FOLN: Follistatin/Osteonectin-like EGF domain; InterPro: IPR015369 This domain is predominantly found in osteonectin and follistatin Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query498
2b0u_C288 The Structure Of The Follistatin:activin Complex Le 4e-54
2b0u_C288 The Structure Of The Follistatin:activin Complex Le 1e-21
2p6a_D315 The Structure Of The Activin:follistatin 315 Comple 4e-54
2p6a_D315 The Structure Of The Activin:follistatin 315 Comple 2e-25
2p6a_D315 The Structure Of The Activin:follistatin 315 Comple 5e-22
3b4v_C237 X-Ray Structure Of Activin In Complex With Fstl3 Le 5e-34
3b4v_C237 X-Ray Structure Of Activin In Complex With Fstl3 Le 9e-20
3b4v_C237 X-Ray Structure Of Activin In Complex With Fstl3 Le 9e-19
3sek_C209 Crystal Structure Of The Myostatin:follistatin-Like 5e-34
3sek_C209 Crystal Structure Of The Myostatin:follistatin-Like 3e-19
3sek_C209 Crystal Structure Of The Myostatin:follistatin-Like 7e-19
2arp_F152 Activin A In Complex With Fs12 Fragment Of Follista 8e-31
2arp_F152 Activin A In Complex With Fs12 Fragment Of Follista 2e-22
2arp_F152 Activin A In Complex With Fs12 Fragment Of Follista 5e-18
1lr7_A74 Crystal Structure Of Fs1, The Heparin-Binding Domai 2e-11
2kcx_A74 Solution Nmr Structure Of Kazal-1 Domain Of Human F 1e-09
1yu6_C185 Crystal Structure Of The Subtilisin Carlsberg:omtky 5e-07
>pdb|2B0U|C Chain C, The Structure Of The Follistatin:activin Complex Length = 288 Back     alignment and structure 
Iteration: 1

 Score =  209 bits (531), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 118/285 (41%), Positives = 161/285 (56%), Gaps = 9/285 (3%)
Query: 2   GQSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGGV-QCQPCKKTC 60
            ++GRC  L   ++ +EECC     L  +W++ED+   T+F W +  GG   C PCK+TC
Sbjct: 8   AKNGRCQVLYKTELSKEECCSTGR-LSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETC 66
Query: 61  ENIDCGEGKKCAI-KKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKN 119
           EN+DCG GKKC + KK  P+C+CAPDC       + PVCG DG+ Y+  C L K  C++ 
Sbjct: 67  ENVDCGPGKKCRMNKKNKPRCVCAPDCSNI--TWKGPVCGLDGKTYRNECALLKARCKEQ 124
Query: 120 EVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDGV 179
             + V Y G C+  +C  V CP    C++DQ    +C  C R C  P+S    +CG DGV
Sbjct: 125 PELEVQYQGRCKK-TCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDGV 183
Query: 180 TYESACHLREAACRRGKSIPIAYRGHC-KPGSCDRVTCPSGKFCILDQNL-IPHCNRCIR 237
           TY SACHLR+A C  G+SI +AY G C K  SC+ + C  GK C+ D  +    C+ C  
Sbjct: 184 TYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDE 243
Query: 238 HCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHC 282
            C    SD   VC +D  TY S C ++EAAC  G  + + + G C
Sbjct: 244 LCPDSKSD-EPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 287
>pdb|2B0U|C Chain C, The Structure Of The Follistatin:activin Complex Length = 288 Back     alignment and structure
>pdb|2P6A|D Chain D, The Structure Of The Activin:follistatin 315 Complex Length = 315 Back     alignment and structure
>pdb|2P6A|D Chain D, The Structure Of The Activin:follistatin 315 Complex Length = 315 Back     alignment and structure
>pdb|2P6A|D Chain D, The Structure Of The Activin:follistatin 315 Complex Length = 315 Back     alignment and structure
>pdb|3B4V|C Chain C, X-Ray Structure Of Activin In Complex With Fstl3 Length = 237 Back     alignment and structure
>pdb|3B4V|C Chain C, X-Ray Structure Of Activin In Complex With Fstl3 Length = 237 Back     alignment and structure
>pdb|3B4V|C Chain C, X-Ray Structure Of Activin In Complex With Fstl3 Length = 237 Back     alignment and structure
>pdb|3SEK|C Chain C, Crystal Structure Of The Myostatin:follistatin-Like 3 Complex Length = 209 Back     alignment and structure
>pdb|3SEK|C Chain C, Crystal Structure Of The Myostatin:follistatin-Like 3 Complex Length = 209 Back     alignment and structure
>pdb|3SEK|C Chain C, Crystal Structure Of The Myostatin:follistatin-Like 3 Complex Length = 209 Back     alignment and structure
>pdb|2ARP|F Chain F, Activin A In Complex With Fs12 Fragment Of Follistatin Length = 152 Back     alignment and structure
>pdb|2ARP|F Chain F, Activin A In Complex With Fs12 Fragment Of Follistatin Length = 152 Back     alignment and structure
>pdb|2ARP|F Chain F, Activin A In Complex With Fs12 Fragment Of Follistatin Length = 152 Back     alignment and structure
>pdb|1LR7|A Chain A, Crystal Structure Of Fs1, The Heparin-Binding Domain Of Follistatin, Complexed With The Heparin Analogue Sucrose Octasulphate (Sos) Length = 74 Back     alignment and structure
>pdb|2KCX|A Chain A, Solution Nmr Structure Of Kazal-1 Domain Of Human Follistatin-Related Protein 3 (Fstl-3). Northeast Structural Genomics Target Hr6186a Length = 74 Back     alignment and structure
>pdb|1YU6|C Chain C, Crystal Structure Of The Subtilisin Carlsberg:omtky3 Complex Length = 185 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query498
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 7e-38
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 4e-26
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 1e-14
3sek_C209 Follistatin-related protein 3; protein-protein com 2e-33
3sek_C209 Follistatin-related protein 3; protein-protein com 1e-20
3sek_C209 Follistatin-related protein 3; protein-protein com 3e-19
3sek_C209 Follistatin-related protein 3; protein-protein com 4e-12
3sek_C209 Follistatin-related protein 3; protein-protein com 8e-12
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 2e-29
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 8e-26
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 2e-22
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 2e-16
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 2e-09
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 7e-25
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 8e-23
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 6e-16
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 9e-14
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 5e-05
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 6e-17
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 4e-11
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 1e-10
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 4e-07
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 3e-06
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 2e-14
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 2e-14
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 2e-12
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 2e-12
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 8e-08
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 2e-12
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 1e-10
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 2e-08
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 9e-07
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 1e-04
1nub_A229 Basement membrane protein BM-40; extracellular mod 2e-12
1nub_A229 Basement membrane protein BM-40; extracellular mod 4e-12
1nub_A229 Basement membrane protein BM-40; extracellular mod 2e-09
1nub_A229 Basement membrane protein BM-40; extracellular mod 1e-07
1nub_A 229 Basement membrane protein BM-40; extracellular mod 2e-06
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 1e-06
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 1e-06
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 9e-06
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 9e-06
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 5e-04
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 4e-06
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 4e-06
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 7e-06
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 9e-05
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 8e-04
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 7e-06
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 7e-06
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 5e-04
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 6e-04
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 6e-04
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 8e-06
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 8e-06
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 6e-04
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 7e-04
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 7e-04
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 9e-06
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 6e-05
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 8e-05
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 8e-04
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 6e-05
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 6e-05
2erw_A56 Serine protease inhibitor infestin; kazal type dom 7e-05
2erw_A56 Serine protease inhibitor infestin; kazal type dom 2e-04
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 1e-04
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 1e-04
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 4e-04
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 4e-04
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
 Score =  139 bits (350), Expect = 7e-38
 Identities = 113/285 (39%), Positives = 155/285 (54%), Gaps = 7/285 (2%)

Query: 1   MGQSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVL-GGGVQCQPCKKT 59
             ++GRC  L   ++ +EECC     L  +W++ED+   T+F W +  GG   C PCK+T
Sbjct: 7   QAKNGRCQVLYKTELSKEECCS-TGRLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKET 65

Query: 60  CENIDCGEGKKCAI-KKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRK 118
           CEN+DCG GKKC + KK  P+C+CAPDC       + PVCG DG+ Y+  C L K  C++
Sbjct: 66  CENVDCGPGKKCRMNKKNKPRCVCAPDCSNITW--KGPVCGLDGKTYRNECALLKARCKE 123

Query: 119 NEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNRCIRHCVTPSSDTHQVCGTDG 178
              + V Y G C+  +C  V CP    C++DQ    +C  C R C  P+S    +CG DG
Sbjct: 124 QPELEVQYQGRCKK-TCRDVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQYLCGNDG 182

Query: 179 VTYESACHLREAACRRGKSIPIAYRGHCKP-GSCDRVTCPSGKFCILDQNLIPHCNRCIR 237
           VTY SACHLR+A C  G+SI +AY G C    SC+ + C  GK C+ D  +         
Sbjct: 183 VTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCD 242

Query: 238 HCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHC 282
                S     VC +D  TY S C ++EAAC  G  + + + G C
Sbjct: 243 ELCPDSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSC 287
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Length = 288 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Length = 209 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Length = 237 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Length = 152 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Length = 185 Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Length = 74 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Length = 103 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Length = 48 Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Length = 55 Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Length = 60 Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Length = 56 Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Length = 56 Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Length = 56 Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Length = 62 Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Length = 62 Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Length = 66 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query498
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 100.0
3sek_C209 Follistatin-related protein 3; protein-protein com 100.0
3hh2_C288 Follistatin; protein-protein complex, TB domain, c 100.0
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 100.0
3b4v_C237 Follistatin-like 3; ligand-inhibitor signalling co 100.0
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 99.97
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 99.97
1yu6_C185 Ovomucoid; protein proteinase inhibitor, protease, 99.96
2arp_F152 Follistatin; cystine knot, disulfide rich, EGF dom 99.95
3sek_C209 Follistatin-related protein 3; protein-protein com 99.95
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 99.86
1tbr_R103 RHODNIIN; complex (serine protease-inhibitor), kaz 99.85
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 99.77
3qtl_D75 Kazal-type serine protease inhibitor SPI-1; serine 99.77
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 99.7
1lr7_A74 Follistatin, FS1; heparin-binding, cystine-rich, s 99.51
1nub_A229 Basement membrane protein BM-40; extracellular mod 99.38
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.24
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 99.21
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.2
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 99.19
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 99.18
1nub_A229 Basement membrane protein BM-40; extracellular mod 99.17
1bus_A57 Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru 99.16
1r0r_I51 Ovomucoid, omtky3; high resolution, serine proteas 99.16
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 98.77
1cgj_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.14
2erw_A56 Serine protease inhibitor infestin; kazal type dom 99.14
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 99.14
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 99.14
1y1b_A48 Elastase inhibitor; non-classical, kazal-type, pro 99.13
2leo_A66 Serine protease inhibitor kazal-type 7; esophageal 98.73
2erw_A56 Serine protease inhibitor infestin; kazal type dom 99.11
1uvg_A78 Serine proteinase inhibitor kazal type 5; trypsin 99.1
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 99.1
1tgs_I56 Pancreatic secretory trypsin inhibitor (kazal type 99.08
2jxd_A62 Serine protease inhibitor kazal-type 2; anti-paral 99.07
1r0r_I51 Ovomucoid, omtky3; high resolution, serine proteas 99.04
2wcy_A155 Complement component C7; immune system, disulfide 99.04
1pce_A60 PEC-60; proteinase inhibitor(kazal type); NMR {Sus 99.03
3pis_D42 Kazal-type serine protease inhibitor SPI-1; typica 98.99
1bus_A57 Proteinase inhibitor IIA; HET: PCA; NMR {Bos tauru 98.99
2wcy_A155 Complement component C7; immune system, disulfide 98.98
2f3c_I55 Thrombin inhibitor infestin; serine protease - inh 98.96
1uvf_A61 Serine proteinase inhibitor kazal type 5; trypsin 98.96
1ldt_L46 LDTI, tryptase inhibitor; complex (hydrolase/inhib 98.92
3pis_D42 Kazal-type serine protease inhibitor SPI-1; typica 98.91
4gi3_C83 Greglin; kazal type inhibitor, hydrolase-hydrolase 98.84
4gi3_C83 Greglin; kazal type inhibitor, hydrolase-hydrolase 98.75
1ldt_L46 LDTI, tryptase inhibitor; complex (hydrolase/inhib 98.68
3tjq_A140 Serine protease HTRA1; hydrolase; 2.00A {Homo sapi 98.61
1h0z_A68 Serine protease inhibitor kazal-type 5, contains h 98.58
3tjq_A140 Serine protease HTRA1; hydrolase; 2.00A {Homo sapi 98.53
1h0z_A68 Serine protease inhibitor kazal-type 5, contains h 98.42
1hdl_A55 HF6478, serine proteinase inhibitor lekti; putativ 97.6
1hdl_A55 HF6478, serine proteinase inhibitor lekti; putativ 97.45
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 94.85
3t5o_A913 Complement component C6; macpf, MAC, membrane atta 93.61
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
Probab=100.00  E-value=3.5e-64  Score=501.72  Aligned_cols=278  Identities=42%  Similarity=0.969  Sum_probs=252.2

Q ss_pred             CCCCCchhhhhhhhhChhHhhhccCCCCcccccCCCCCCcEEEEEeecCC-cccccccCcccceeccCCceeEe-ecCCC
Q psy1764           1 MGQSGRCTELLSEKVGREECCKEANGLGAAWSKEDLEPGTMFFWRVLGGG-VQCQPCKKTCENIDCGEGKKCAI-KKGYP   78 (498)
Q Consensus         1 ~~~~~~c~~~~~~~~~~~~cc~~~~~~~~~~~~~~~~~~~~~~~~~~~~g-~~C~~c~d~C~~~~C~~g~~C~~-~~~~~   78 (498)
                      +++||+|++||+++|||||||++| +++||||+++++.+.||||++|.+| |+|.||||+|+++.|++|++|++ ..++|
T Consensus         7 ~~~~~~c~~~~~~~~~~~~cc~~~-~~~~~~~~~~~~~~~~~~~~~~~~g~~~C~pckd~C~~v~C~~g~~C~~~~~g~~   85 (288)
T 3hh2_C            7 QAKNGRCQVLYKTELSKEECCSTG-RLSTSWTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVDCGPGKKCRMNKKNKP   85 (288)
T ss_dssp             ECTTSCEEEEEESSCCHHHHTCSC-CTTCEEECCCCCHHHHHHHHHHSSSBSSCEESCSSSTTCCCCTTEEEEECTTSCE
T ss_pred             cCCCCceeeeEEcCCCHHHHhccC-CCCceeecccCCchhhhhhhhhcCCCCCCchhcccCCCCcCCCCCEeeECCCCCe
Confidence            489999999999999999999999 9999999999999999999999988 88999999999999999999999 78999


Q ss_pred             ceeeCchhhhhcccCCCCcccCCCccceeeehhhhhhhcccceEEEeeccccccCCCCceecCCCceeeecCCccccccc
Q psy1764          79 KCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTCQTGSCDRVTCPSGKFCILDQNLIPHCNR  158 (498)
Q Consensus        79 ~C~C~~~C~~~~~~~~~PVCGsDG~TY~n~C~l~~~~C~~~~~l~v~~~G~C~~~~C~~~~c~~~~~C~~d~~~~~~C~~  158 (498)
                      +|+|++.|+.  ...+.|||||||+||.|+|+|++++|+.+..|.|+|+|+|.+ +|.++.|+.+..|++|+++.|+|+.
T Consensus        86 ~CvC~~~C~~--~~~~~PVCGsDG~TY~N~C~L~~a~C~~~~~i~v~~~G~C~~-~C~~~~C~~g~~C~~d~~~~~~Cv~  162 (288)
T 3hh2_C           86 RCVCAPDCSN--ITWKGPVCGLDGKTYRNECALLKARCKEQPELEVQYQGRCKK-TCRDVFCPGSSTCVVDQTNNAYCVT  162 (288)
T ss_dssp             EEEECCCCTT--CCCCSCEEETTSCEESSHHHHHHHHHHTCTTCCEEEESSCCB-SSTTCCCSTTCEEEECTTSBEEEEC
T ss_pred             eeeCCccCCC--CCCCCceECCCCCEechhhHHHHHHhccCCceEEEeceeeec-cccCccCCCCCcccccCCCCccccc
Confidence            9999999987  112799999999999999999999999999999999999997 8999999999999999999999998


Q ss_pred             ceecccCCCCCCCcccCCCCceeehhhhhHHHHhhcCCcceeeeccccC-CCCCCeeecCCCceeeccCC-CCccccccc
Q psy1764         159 CIRHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCK-PGSCDRVTCPSGKFCILDQN-LIPHCNRCI  236 (498)
Q Consensus       159 C~~~Cp~~~~~~~PVCGsdG~TY~n~C~l~~a~C~~~~~i~~~~~G~C~-~~~C~~~~C~~~~~C~~d~~-~~~~C~~C~  236 (498)
                      |...||....++.||||+||+||.|+|+|++++|..++.|.++|.|+|. ..+|.++.|++++.|++|.. +.++|..|+
T Consensus       163 C~~~Cp~~~~~~~pVCGsDg~TY~n~C~l~~a~C~~~~~i~v~~~G~C~~~~sC~~~~C~~g~~C~~d~~~g~~~C~~C~  242 (288)
T 3hh2_C          163 CNRICPEPASSEQYLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKCIKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCD  242 (288)
T ss_dssp             CCCCCCC-----CCEEETTSCEESSHHHHHHHHHHHTSCCCEEEESCCCCCSSGGGCCCCTTCEEEEETTTTEEEEECCC
T ss_pred             CCCCCCCccCCCCceECCCCCEEcCHHHHHHHHhcCCCceEEEecCcccccccccccccCCCCcccccccCCCccccCCC
Confidence            9999998655678999999999999999999999999999999999998 45899999999999998854 468886688


Q ss_pred             ccccCCCCCCCccccCCCceecchhhhHHHHhhcCceeeeeeeeeec
Q psy1764         237 RHCVTPSSDTHQVCGTDGVTYESACHLREAACRRGKSIPIAYRGHCK  283 (498)
Q Consensus       237 ~~Cp~~~~~~~PVCGsDG~TY~N~C~l~~~~C~~~~~i~v~~~G~C~  283 (498)
                      ..|| ...++.|||||||+||.|+|+|+.++|..+..|+|+|.|+|.
T Consensus       243 ~~Cp-~~~~~~pVCgsdg~TY~n~C~l~~a~C~~~~~i~~~~~G~C~  288 (288)
T 3hh2_C          243 ELCP-DSKSDEPVCASDNATYASECAMKEAACSSGVLLEVKHSGSCN  288 (288)
T ss_dssp             CCCC------CCEEETTSCEESSHHHHHHHHHHHTBCCCEEEESCCC
T ss_pred             CCCC-CccCCCccCCCCCCEeCCHhHHhHHHhcCCCceEEecCCCCC
Confidence            9999 223699999999999999999999999999999999999983
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>3hh2_C Follistatin; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, CLE PAIR of basic residues, cytokine; HET: CIT; 2.15A {Homo sapiens} PDB: 2b0u_C* 2p6a_D Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>3b4v_C Follistatin-like 3; ligand-inhibitor signalling complex, cleavage on PAIR of BAS residues, glycoprotein, growth factor, hormone, secreted; HET: NAG; 2.48A {Homo sapiens} Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
>1yu6_C Ovomucoid; protein proteinase inhibitor, protease, hydrolase; 1.55A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1z7k_B* Back     alignment and structure
>2arp_F Follistatin; cystine knot, disulfide rich, EGF domain, kazal domain, PROT complex, hormone-growth factor complex; HET: 1PG; 2.00A {Rattus norvegicus} Back     alignment and structure
>3sek_C Follistatin-related protein 3; protein-protein complex, TB domain, cystine knot motif, TGF- fold, disulfide linked dimer, follistatin domain (FSD); HET: NAG; 2.40A {Homo sapiens} PDB: 2kcx_A Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>1tbr_R RHODNIIN; complex (serine protease-inhibitor), kazal-type inhibitor, T complex (serine protease-inhibitor) complex; 2.60A {Rhodnius prolixus} SCOP: g.68.1.1 g.68.1.1 PDB: 1tbq_R Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>3qtl_D Kazal-type serine protease inhibitor SPI-1; serine protease -kazal type serine protease inhibitor comple hydrolase inhibitor; 2.60A {Carcinoscorpius rotundicauda} Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Back     alignment and structure
>1lr7_A Follistatin, FS1; heparin-binding, cystine-rich, sucrose octasulphate, hormone/growth factor complex; HET: SO4; 1.50A {Rattus norvegicus} SCOP: g.3.11.3 g.68.1.1 PDB: 1lr8_A* 1lr9_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Back     alignment and structure
>1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Back     alignment and structure
>1cgj_I Pancreatic secretory trypsin inhibitor (kazal type) variant 4; serine protease/inhibitor complex; 2.30A {Homo sapiens} SCOP: g.68.1.1 Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Back     alignment and structure
>1y1b_A Elastase inhibitor; non-classical, kazal-type, protease inhibitor, CSH motif, hydrolase inhibitor; NMR {Synthetic} PDB: 1y1c_A Back     alignment and structure
>2leo_A Serine protease inhibitor kazal-type 7; esophageal cancer-related gene 2, hydrol inhibitor; NMR {Homo sapiens} Back     alignment and structure
>2erw_A Serine protease inhibitor infestin; kazal type domain, blood clotting, hydrolase inhibitor; 1.40A {Triatoma infestans} SCOP: g.68.1.1 Back     alignment and structure
>1tgs_I Pancreatic secretory trypsin inhibitor (kazal type); complex (proteinase/inhibitor); 1.80A {Sus scrofa} SCOP: g.68.1.1 PDB: 1cgi_I 1hpt_A Back     alignment and structure
>2jxd_A Serine protease inhibitor kazal-type 2; anti-parallel beta sheet, beta-bulge, disulfide bond, alpha helix, pyrrolidone carboxylic acid, secreted; NMR {Homo sapiens} Back     alignment and structure
>1r0r_I Ovomucoid, omtky3; high resolution, serine protease, protein inhibitor, hydrolase; 1.10A {Meleagris gallopavo} SCOP: g.68.1.1 PDB: 1sgr_I 2gkr_I 1cho_I 1omt_A 1omu_A 1ppf_I* 1tur_A 1tus_A 3sgb_I 2ovo_A 4ovo_A 1iy5_A 1cso_I 1ct4_I 2sgf_I 2gkt_I 2gkv_A 2nu0_I 1m8b_A 1m8c_A ... Back     alignment and structure
>2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} Back     alignment and structure
>1pce_A PEC-60; proteinase inhibitor(kazal type); NMR {Sus scrofa} SCOP: g.68.1.1 Back     alignment and structure
>3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} Back     alignment and structure
>1bus_A Proteinase inhibitor IIA; HET: PCA; NMR {Bos taurus} SCOP: g.68.1.1 PDB: 2bus_A* Back     alignment and structure
>2wcy_A Complement component C7; immune system, disulfide bond, immune response, factor I module, FIM, EGF, MAC, FOLN, sushi, fimac, kazal; NMR {Homo sapiens} Back     alignment and structure
>2f3c_I Thrombin inhibitor infestin; serine protease - inhibitor complex, kazal-type domain, hydrolase/hydrolase inhibitor complex; 2.50A {Triatoma infestans} SCOP: g.68.1.1 PDB: 1kma_A Back     alignment and structure
>1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Back     alignment and structure
>3pis_D Kazal-type serine protease inhibitor SPI-1; typical non-classical kazal type inhibitor fold; 2.00A {Carcinoscorpius rotundicauda} Back     alignment and structure
>4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} Back     alignment and structure
>4gi3_C Greglin; kazal type inhibitor, hydrolase-hydrolase inhibitor complex; 1.75A {Schistocerca gregaria} Back     alignment and structure
>1ldt_L LDTI, tryptase inhibitor; complex (hydrolase/inhibitor), hydrolase, inflammation; 1.90A {Hirudo medicinalis} SCOP: g.68.1.1 PDB: 1an1_I 2kmo_A 2kmp_A 2kmq_A 2kmr_A Back     alignment and structure
>3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 Back     alignment and structure
>3tjq_A Serine protease HTRA1; hydrolase; 2.00A {Homo sapiens} Back     alignment and structure
>1h0z_A Serine protease inhibitor kazal-type 5, contains hemofiltrate peptide HF6478, hemofiltrate...; serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 Back     alignment and structure
>1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A Back     alignment and structure
>1hdl_A HF6478, serine proteinase inhibitor lekti; putative serine proteinase inhibitor; NMR {Homo sapiens} SCOP: g.68.1.2 PDB: 1uuc_A Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 498
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 6e-08
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 6e-08
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 5e-06
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 5e-06
d1z7kb162 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Melea 2e-04
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 1e-07
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 1e-07
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 1e-06
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 1e-06
d1lr7a248 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Ra 1e-05
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 1e-07
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 1e-07
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 7e-06
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 7e-06
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 5e-05
d1pcea_60 g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [Ta 6e-05
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 2e-07
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 2e-07
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 3e-05
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 3e-05
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 9e-05
d1hpta_56 g.68.1.1 (A:) Secretory trypsin inhibitor {Human ( 0.001
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 3e-07
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 3e-07
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 5e-05
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 5e-05
d1nuba358 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonec 8e-04
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 4e-07
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 4e-07
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 5e-05
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 5e-05
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 1e-04
d1tgsi_56 g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Su 0.002
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 6e-07
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 2e-06
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 9e-05
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 9e-05
d2f3ci146 g.68.1.1 (I:5-50) Blood-sucking insect-derived try 1e-04
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 8e-07
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 8e-07
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 1e-06
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 4e-06
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 4e-05
d1tbrr252 g.68.1.1 (R:52-103) Blood-sucking insect-derived t 0.002
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 3e-06
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 3e-06
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 7e-05
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 2e-04
d2erwa153 g.68.1.1 (A:4-56) Blood-sucking insect-derived try 2e-04
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 3e-06
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 3e-06
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 1e-05
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 1e-05
d1r0ri_51 g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris 2e-04
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 4e-06
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 4e-06
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 2e-05
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 2e-05
d2busa_57 g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (B 2e-04
d1h0za_68 g.68.1.2 (A:) Serine proteinase inhibitor lekti {H 0.001
d1h0za_68 g.68.1.2 (A:) Serine proteinase inhibitor lekti {H 0.001
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure

class: Small proteins
fold: Kazal-type serine protease inhibitors
superfamily: Kazal-type serine protease inhibitors
family: Ovomucoid domain III-like
domain: Ovomucoid domains
species: Turkey (Meleagris gallopavo) [TaxId: 9103]

 Score = 47.3 bits (112), Expect = 6e-08
 Identities = 16/69 (23%), Positives = 24/69 (34%), Gaps = 8/69 (11%)

Query: 62  NIDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEV 121
            +DC        ++G    +C            NPVCG+DG  Y   C L      +   
Sbjct: 2   PMDCSRYPNTTSEEGKVMILCNKAL--------NPVCGTDGVTYDNECVLCAHNLEQGTS 53

Query: 122 ISVDYFGTC 130
           +   + G C
Sbjct: 54  VGKKHDGEC 62
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 62 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 48 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Length = 60 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Length = 56 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 46 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Length = 52 Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Length = 53 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 51 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Length = 57 Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query498
d1z7kb162 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.49
d1tgsi_56 Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax 99.45
d1lr7a248 Domain of follistatin {Rat (Rattus norvegicus) [Ta 99.44
d1tbrr252 Blood-sucking insect-derived tryptase inhibitor {B 99.43
d1z7kb162 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.42
d1hpta_56 Secretory trypsin inhibitor {Human (Homo sapiens) 99.39
d1lr7a248 Domain of follistatin {Rat (Rattus norvegicus) [Ta 99.37
d2f3ci146 Blood-sucking insect-derived tryptase inhibitor {T 99.37
d1r0ri_51 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.37
d1tgsi_56 Secretory trypsin inhibitor {Pig (Sus scrofa) [Tax 99.36
d1pcea_60 PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} 99.35
d1hpta_56 Secretory trypsin inhibitor {Human (Homo sapiens) 99.34
d2erwa153 Blood-sucking insect-derived tryptase inhibitor {T 99.33
d1tbrr252 Blood-sucking insect-derived tryptase inhibitor {B 99.33
d2busa_57 Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta 99.31
d1nuba358 Domain of BM-40/SPARC/osteonectin {Human (Homo sap 99.31
d2erwa153 Blood-sucking insect-derived tryptase inhibitor {T 99.29
d1r0ri_51 Ovomucoid domains {Turkey (Meleagris gallopavo) [T 99.26
d1nuba358 Domain of BM-40/SPARC/osteonectin {Human (Homo sap 99.24
d2f3ci146 Blood-sucking insect-derived tryptase inhibitor {T 99.23
d1pcea_60 PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} 99.22
d2busa_57 Seminal plasma inhibitor IIa {Cow (Bos taurus) [Ta 99.21
d1ldtl_46 Leech derived tryptase inhibitor (LDTI-C) {Medicin 98.81
d1h0za_68 Serine proteinase inhibitor lekti {Human (Homo sap 98.81
d1h0za_68 Serine proteinase inhibitor lekti {Human (Homo sap 98.73
d1ldtl_46 Leech derived tryptase inhibitor (LDTI-C) {Medicin 98.67
d1hdla_55 Serine proteinase inhibitor lekti {Human (Homo sap 97.68
d1hdla_55 Serine proteinase inhibitor lekti {Human (Homo sap 97.63
d1lr7a126 Domain of follistatin {Rat (Rattus norvegicus) [Ta 97.53
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
class: Small proteins
fold: Kazal-type serine protease inhibitors
superfamily: Kazal-type serine protease inhibitors
family: Ovomucoid domain III-like
domain: Ovomucoid domains
species: Turkey (Meleagris gallopavo) [TaxId: 9103]

Probab=99.49  E-value=2.3e-15  Score=114.02  Aligned_cols=60  Identities=27%  Similarity=0.578  Sum_probs=52.7

Q ss_pred             cccCCCceeeeecCCCccccCcchhcccccCCCCccCCCCCcchhhhhhhhhhhccCceEEeeecccc
Q psy1764         336 IDCGEGKKCAIKKGYPKCICAPDCKQRGRHMRNPVCGSDGRNYKTVCRLRKRACRKNEVISVDYFGTC  403 (498)
Q Consensus       336 ~~C~~g~~C~~~~g~~~C~C~~~C~~~~~~~~~PVCGSDG~TY~N~C~l~~aaC~~~~~i~v~~~G~C  403 (498)
                      ++|.++..|...++...|.|+        ..++|||||||+||+|+|+|+.++|+.+..|+|+|.|+|
T Consensus         3 v~C~~y~~~~~~~~~~~~~Cp--------~~~~PVCGsDG~TY~N~C~l~~~~c~~~~~i~~~~~G~C   62 (62)
T d1z7kb1           3 MDCSRYPNTTSEEGKVMILCN--------KALNPVCGTDGVTYDNECVLCAHNLEQGTSVGKKHDGEC   62 (62)
T ss_dssp             CCGGGSCEEECTTSCEEECEE--------CCCCCEEETTSCEESSHHHHHHHHHHHCCCCCEEESSCC
T ss_pred             ccCCCCCcccccCCceeeECC--------CCCCccCCCCCCCccCHhHHHHHHhccCCCeEEeecCCC
Confidence            568888888877776666665        479999999999999999999999999999999999987
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Back     information, alignment and structure
>d1z7kb1 g.68.1.1 (B:2-63) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lr7a2 g.68.1.1 (A:89-136) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1tgsi_ g.68.1.1 (I:) Secretory trypsin inhibitor {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hpta_ g.68.1.1 (A:) Secretory trypsin inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1tbrr2 g.68.1.1 (R:52-103) Blood-sucking insect-derived tryptase inhibitor {Bug (Rhodnius prolixus), rhodniin [TaxId: 13249]} Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erwa1 g.68.1.1 (A:4-56) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1r0ri_ g.68.1.1 (I:) Ovomucoid domains {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1nuba3 g.68.1.1 (A:78-135) Domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f3ci1 g.68.1.1 (I:5-50) Blood-sucking insect-derived tryptase inhibitor {Triatoma infestans [TaxId: 30076]} Back     information, alignment and structure
>d1pcea_ g.68.1.1 (A:) PEC-60 peptide {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2busa_ g.68.1.1 (A:) Seminal plasma inhibitor IIa {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h0za_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ldtl_ g.68.1.1 (L:) Leech derived tryptase inhibitor (LDTI-C) {Medicinal leech (Hirudo medicinalis) [TaxId: 6421]} Back     information, alignment and structure
>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hdla_ g.68.1.2 (A:) Serine proteinase inhibitor lekti {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lr7a1 g.3.11.3 (A:64-88) Domain of follistatin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure