Psyllid ID: psy17785

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MFNTKDIFSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVTGHSDHRDSTLDDIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTLDF
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccHHHccccHHHHHHHHHHcccccccccccccccccEEEccEEEccccccc
cccHHHHHHHHHHcccccccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccHcHHHHcHHHHHHHHHHHHcccccccEccEccccEEEccEEEcccEEEc
MFNTKDIFSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVtghsdhrdstlddIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIgedfhkkpslselenlkYLDMVIKEslrlyppayvaprratedihigeftipkgtldf
mfntkdifSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVTGHSDHRDSTLDDIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEdfhkkpslselENLKYLDMVIKESLRLYPPAyvaprratedihigeftipkgtldf
MFNTKDIFSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVTGHSDHRDSTLDDIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTLDF
*****DIFSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVTGHSDHRDSTLDDIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTI*******
MFNTKDIFSLFRESIKSVLTQIKCLERFTAF*****************************TLDDIKLA*******EAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTLDF
MFNTKDIFSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVTGHSDHRDSTLDDIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTLDF
MFNTKDIFSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVTGHSDHRDSTLDDIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTLDF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFNTKDIFSLFRESIKSVLTQIKCLERFTAFQSKKTILETVTKMGMVNFFVTGHSDHRDSTLDDIKLADLQEELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTLDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q9VLZ7 511 Probable cytochrome P450 yes N/A 0.866 0.305 0.347 1e-16
Q9W011 510 Probable cytochrome P450 no N/A 0.544 0.192 0.377 3e-15
Q9VS79463 Cytochrome P450 4d8 OS=Dr no N/A 0.672 0.261 0.333 8e-15
Q964T1501 Cytochrome P450 4c21 OS=B N/A N/A 0.633 0.227 0.387 2e-14
O48786 520 Cytochrome P450 734A1 OS= yes N/A 0.538 0.186 0.404 6e-14
Q9VA27 535 Cytochrome P450 4c3 OS=Dr no N/A 0.544 0.183 0.387 8e-14
Q55AJ4 492 Probable cytochrome P450 yes N/A 0.494 0.180 0.434 8e-14
Q9VL92 526 Cytochrome P450 4e3 OS=Dr no N/A 0.544 0.186 0.377 8e-14
Q27589501 Cytochrome P450 4d2 OS=Dr no N/A 0.622 0.223 0.389 9e-14
O46054496 Cytochrome P450 4ae1 OS=D no N/A 0.622 0.225 0.398 4e-13
>sp|Q9VLZ7|C4D21_DROME Probable cytochrome P450 4d21 OS=Drosophila melanogaster GN=Cyp4d21 PE=3 SV=1 Back     alignment and function desciption
 Score = 86.3 bits (212), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 86/164 (52%), Gaps = 8/164 (4%)

Query: 22  IKCLERFT--AFQSKKTILETVTKMGMVNFFVTGHSD---HRDSTLDDIKLADLQEELGE 76
           I  ++ FT    + ++ ILE     G     + G  D       TL DI L    +    
Sbjct: 242 IAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPL 301

Query: 77  AHLD---ELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLS 133
           + +D   E+ +F  AG +T T+  S  +  +S HP+VQ  +Y+EL+S++G D     + +
Sbjct: 302 SDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQT 361

Query: 134 ELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGT 177
           +L  LKYLD VIKE++RL+PP  +  R   ED+ IGE TIP  T
Sbjct: 362 KLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNT 405
May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9W011|C4D20_DROME Probable cytochrome P450 4d20 OS=Drosophila melanogaster GN=Cyp4d20 PE=3 SV=1 Back     alignment and function description
>sp|Q9VS79|CP4D8_DROME Cytochrome P450 4d8 OS=Drosophila melanogaster GN=Cyp4d8 PE=2 SV=2 Back     alignment and function description
>sp|Q964T1|CP4CU_BLAGE Cytochrome P450 4c21 OS=Blattella germanica GN=CYP4C21 PE=2 SV=1 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function description
>sp|Q55AJ4|C516B_DICDI Probable cytochrome P450 516B1 OS=Dictyostelium discoideum GN=cyp516B1 PE=3 SV=1 Back     alignment and function description
>sp|Q9VL92|CP4E3_DROME Cytochrome P450 4e3 OS=Drosophila melanogaster GN=Cyp4e3 PE=2 SV=1 Back     alignment and function description
>sp|Q27589|CP4D2_DROME Cytochrome P450 4d2 OS=Drosophila melanogaster GN=Cyp4d2 PE=2 SV=2 Back     alignment and function description
>sp|O46054|C4AE1_DROME Cytochrome P450 4ae1 OS=Drosophila melanogaster GN=Cyp4ae1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
241599514 402 cytochrome P-450, putative [Ixodes scapu 0.7 0.313 0.437 1e-20
325302892270 TPA_inf: cytochrome P450 CYP4/CYP19/CYP2 0.55 0.366 0.494 1e-18
55775507151 cytochrome P450 CYP4D25 [Anopheles funes 0.538 0.642 0.463 6e-17
156550311 520 PREDICTED: cytochrome P450 4c3 [Nasonia 0.544 0.188 0.444 2e-16
189238163 420 PREDICTED: similar to cytochrome P450 [T 0.727 0.311 0.385 2e-16
270008720 814 hypothetical protein TcasGA2_TC015295 [T 0.727 0.160 0.385 2e-16
427784575 522 Putative cytochrome p450 4v2 [Rhipicepha 0.511 0.176 0.413 3e-16
158291006 505 AGAP002419-PA [Anopheles gambiae str. PE 0.622 0.221 0.389 4e-16
346472425 494 hypothetical protein [Amblyomma maculatu 0.844 0.307 0.335 4e-16
91078618 501 PREDICTED: similar to cytochrome P450 mo 0.544 0.195 0.438 5e-16
>gi|241599514|ref|XP_002404872.1| cytochrome P-450, putative [Ixodes scapularis] gi|215500513|gb|EEC10007.1| cytochrome P-450, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 83/128 (64%), Gaps = 2/128 (1%)

Query: 55  SDHRDSTLDDIKLADLQE-ELGEAHL-DELGLFNIAGIETLTTAFSAVIFLLSMHPEVQA 112
           S+ R S LD +    L++  L E  + DE+    I G +T  TA S  ++LL  +PE+QA
Sbjct: 173 SNKRKSFLDILLRMHLEDGTLTEDQVRDEVATVFIGGFDTTATAASYTLYLLGHYPEIQA 232

Query: 113 KVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFT 172
           KV+ EL  + G+D+ +  +L +++NLKYL+ VIKES+RLYPP  V  R   ED+ +GE+T
Sbjct: 233 KVHRELDEVFGDDWDRPVTLEDMKNLKYLECVIKESMRLYPPVPVVARNIDEDMKVGEYT 292

Query: 173 IPKGTLDF 180
           IP+GT+ F
Sbjct: 293 IPRGTVAF 300

Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|325302892|tpg|DAA34479.1| TPA_inf: cytochrome P450 CYP4/CYP19/CYP26 subfamily [Amblyomma variegatum] Back     alignment and taxonomy information
>gi|55775507|gb|AAV65034.1| cytochrome P450 CYP4D25 [Anopheles funestus] Back     alignment and taxonomy information
>gi|156550311|ref|XP_001603476.1| PREDICTED: cytochrome P450 4c3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|189238163|ref|XP_001814854.1| PREDICTED: similar to cytochrome P450 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270008720|gb|EFA05168.1| hypothetical protein TcasGA2_TC015295 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427784575|gb|JAA57739.1| Putative cytochrome p450 4v2 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|158291006|ref|XP_312527.4| AGAP002419-PA [Anopheles gambiae str. PEST] gi|157018168|gb|EAA44936.4| AGAP002419-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|346472425|gb|AEO36057.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|91078618|ref|XP_967724.1| PREDICTED: similar to cytochrome P450 monooxigenase CYP4H10 [Tribolium castaneum] gi|270004875|gb|EFA01323.1| cytochrome P450 4BR3 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
FB|FBgn0031925 511 Cyp4d21 "Cyp4d21" [Drosophila 0.866 0.305 0.353 6.5e-18
WB|WBGene00010354 495 cyp-31A2 [Caenorhabditis elega 0.838 0.305 0.331 2.5e-16
FB|FBgn0035344 510 Cyp4d20 "Cyp4d20" [Drosophila 0.588 0.207 0.364 1.6e-15
FB|FBgn0015033463 Cyp4d8 "Cytochrome P450-4d8" [ 0.944 0.367 0.313 2.7e-15
WB|WBGene00021200 495 cyp-31A3 [Caenorhabditis elega 0.838 0.305 0.331 1.4e-14
FB|FBgn0011576501 Cyp4d2 "Cytochrome P450-4d2" [ 0.616 0.221 0.403 1.9e-14
TAIR|locus:2010841 511 CYP89A6 ""cytochrome P450, fam 0.661 0.232 0.357 6.8e-14
FB|FBgn0015035 526 Cyp4e3 "Cytochrome P450-4e3" [ 0.544 0.186 0.377 7.2e-14
UNIPROTKB|E1BYW5 530 CYP4V2 "Uncharacterized protei 0.938 0.318 0.318 7.3e-14
FB|FBgn0015032 535 Cyp4c3 "Cytochrome P450-4c3" [ 0.544 0.183 0.387 1.2e-13
FB|FBgn0031925 Cyp4d21 "Cyp4d21" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 225 (84.3 bits), Expect = 6.5e-18, P = 6.5e-18
 Identities = 58/164 (35%), Positives = 89/164 (54%)

Query:    22 IKCLERFT--AFQSKKTILETVTKMGMVNFFVTGHSD---HRDSTLDDIKL-ADLQEE-L 74
             I  ++ FT    + ++ ILE     G     + G  D       TL DI L A +  + L
Sbjct:   242 IAIMQDFTDKVIRERRAILERARADGTYKPLIMGDDDIGGKAKMTLLDILLQATIDNKPL 301

Query:    75 GEAHL-DELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLS 133
              +  + +E+ +F  AG +T T+  S  +  +S HP+VQ  +Y+EL+S++G D     + +
Sbjct:   302 SDVDIREEVDVFIFAGDDTTTSGVSHALHAISRHPKVQECIYEELVSVLGPDPDASVTQT 361

Query:   134 ELENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGT 177
             +L  LKYLD VIKE++RL+PP  +  R   ED+ IGE TIP  T
Sbjct:   362 KLLELKYLDCVIKETMRLHPPVPILGRYIPEDLKIGEITIPGNT 405
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;ISS;NAS
GO:0016020 "membrane" evidence=NAS
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0004497 "monooxygenase activity" evidence=IEA
GO:0007618 "mating" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
WB|WBGene00010354 cyp-31A2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0035344 Cyp4d20 "Cyp4d20" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0015033 Cyp4d8 "Cytochrome P450-4d8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00021200 cyp-31A3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0011576 Cyp4d2 "Cytochrome P450-4d2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2010841 CYP89A6 ""cytochrome P450, family 87, subfamily A, polypeptide 6"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0015035 Cyp4e3 "Cytochrome P450-4e3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BYW5 CYP4V2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
FB|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam00067461 pfam00067, p450, Cytochrome P450 8e-28
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-19
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 9e-17
PLN00168 519 PLN00168, PLN00168, Cytochrome P450; Provisional 6e-15
PLN02738 633 PLN02738, PLN02738, carotene beta-ring hydroxylase 8e-15
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-12
PLN02936 489 PLN02936, PLN02936, epsilon-ring hydroxylase 5e-12
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 2e-11
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 4e-11
PLN02426 502 PLN02426, PLN02426, cytochrome P450, family 94, su 4e-11
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 1e-10
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 6e-10
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 4e-09
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-09
PLN03018 534 PLN03018, PLN03018, homomethionine N-hydroxylase 1e-07
PLN03195 516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 2e-07
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-06
PLN02169 500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 4e-06
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 5e-04
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 5e-04
PLN02971 543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-04
PLN02987 472 PLN02987, PLN02987, Cytochrome P450, family 90, su 0.001
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  107 bits (270), Expect = 8e-28
 Identities = 48/132 (36%), Positives = 74/132 (56%), Gaps = 8/132 (6%)

Query: 52  TGHSDHRDSTLDDIKLADLQEELGEAHLDEL----GLFNIAGIETLTTAFSAVIFLLSMH 107
           +     RD  LD + LA  +E+  +   +EL         AG +T ++  S  ++ L+ H
Sbjct: 233 SAKKSPRD-FLDALLLAKEEEDGSKLTDEELRATVLELFFAGTDTTSSTLSWALYELAKH 291

Query: 108 PEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYPPAYVA-PRRATEDI 166
           PEVQ K+ +E+  +IG    + P+  +L+N+ YLD VIKE+LRL+P   +  PR  T+D 
Sbjct: 292 PEVQEKLREEIDEVIG--DKRSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDT 349

Query: 167 HIGEFTIPKGTL 178
            I  + IPKGTL
Sbjct: 350 VIPGYLIPKGTL 361

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
KOG0156|consensus 489 99.94
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.93
PLN02971 543 tryptophan N-hydroxylase 99.92
PLN02500 490 cytochrome P450 90B1 99.92
KOG0158|consensus 499 99.92
PLN02774463 brassinosteroid-6-oxidase 99.92
PLN02183 516 ferulate 5-hydroxylase 99.91
PLN03234 499 cytochrome P450 83B1; Provisional 99.91
KOG0159|consensus 519 99.91
PLN02290516 cytokinin trans-hydroxylase 99.91
KOG0157|consensus 497 99.91
PLN02426 502 cytochrome P450, family 94, subfamily C protein 99.91
PTZ00404482 cytochrome P450; Provisional 99.91
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.91
PLN02655 466 ent-kaurene oxidase 99.91
PLN00168 519 Cytochrome P450; Provisional 99.9
PLN03112 514 cytochrome P450 family protein; Provisional 99.9
PLN02394 503 trans-cinnamate 4-monooxygenase 99.9
PLN02687 517 flavonoid 3'-monooxygenase 99.9
PLN02966 502 cytochrome P450 83A1 99.9
PLN02196463 abscisic acid 8'-hydroxylase 99.9
PLN02169 500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.89
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.89
PLN03018 534 homomethionine N-hydroxylase 99.89
PLN03195 516 fatty acid omega-hydroxylase; Provisional 99.89
PLN02738 633 carotene beta-ring hydroxylase 99.89
PLN02302490 ent-kaurenoic acid oxidase 99.89
PLN02987 472 Cytochrome P450, family 90, subfamily A 99.89
PLN02936 489 epsilon-ring hydroxylase 99.88
KOG0684|consensus 486 99.87
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.86
PLN02648 480 allene oxide synthase 99.77
>KOG0156|consensus Back     alignment and domain information 
Probab=99.94  E-value=7e-26  Score=185.69  Aligned_cols=105  Identities=37%  Similarity=0.500  Sum_probs=98.4

Q ss_pred             hhHHHHHHHHHHHHhchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhcCCCCCCCCHHHhhcCHHHHHHHHHHhcCCC
Q psy17785         74 LGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYP  153 (180)
Q Consensus        74 ~~~~~~~~~~~l~~ag~~tt~~~~~~~l~~l~~~p~~~~~~~~ei~~~~~~~~~~~~~~~~~~~~p~~~~~i~E~lR~~~  153 (180)
                      +++++.+.+.++++||.|||++++.|++.+|+.||++++|+++|++.+++  .+..++.+++.++||++|+|+|++|++|
T Consensus       283 t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG--~~r~v~e~D~~~lpYL~Avi~E~~Rl~p  360 (489)
T KOG0156|consen  283 TDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVG--KGRLVSESDLPKLPYLKAVIKETLRLHP  360 (489)
T ss_pred             CHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhC--CCCCCChhhhccCHHHHHHHHHHHhcCC
Confidence            56778888999999999999999999999999999999999999999998  4444999999999999999999999999


Q ss_pred             CCC-CCccccCCCceEcCeEeCCCCeeC
Q psy17785        154 PAY-VAPRRATEDIHIGEFTIPKGTLDF  180 (180)
Q Consensus       154 ~~~-~~~r~~~~d~~i~g~~ip~Gt~v~  180 (180)
                      ++| .+||.+++|+.|+||.|||||.|+
T Consensus       361 ~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~  388 (489)
T KOG0156|consen  361 PLPLLLPRETTEDTKIGGYDIPKGTTVL  388 (489)
T ss_pred             CccccccccccCCeeEcCEEcCCCCEEE
Confidence            999 579999999999999999999884

>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>KOG0158|consensus Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
1w0e_A 485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 9e-11
1tqn_A 486 Crystal Structure Of Human Microsomal P450 3a4 Leng 9e-11
3ua1_A 487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 9e-11
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 4e-10
3ruk_A 494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 4e-10
2q9f_A 456 Crystal Structure Of Human Cytochrome P450 46a1 In 2e-09
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 2e-09
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 2e-09
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 3e-09
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 3e-09
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 4e-09
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 5e-09
2hi4_A 495 Crystal Structure Of Human Microsomal P450 1a2 In C 3e-08
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 4e-08
2ve3_A 444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 5e-08
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-07
3cbd_A 455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 2e-07
3ld6_A 461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-07
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 5e-07
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 6e-07
2bmh_A 455 Modeling Protein-Substrate Interactions In The Heme 6e-07
1jme_A 455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 6e-07
2uwh_A 458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 6e-07
1bvy_A 458 Complex Of The Heme And Fmn-Binding Domains Of The 6e-07
1p0w_A 455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-07
1p0v_A 455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-07
2hpd_A 471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 6e-07
2x7y_A 455 P450 Bm3 F87a In Complex With Dmso Length = 455 6e-07
1p0x_A 455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-07
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 6e-07
2nnb_A 471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 6e-07
1jpz_A 473 Crystal Structure Of A Complex Of The Heme Domain O 6e-07
3kx3_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 6e-07
3ben_A 470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 6e-07
2ij2_A 470 Atomic Structure Of The Heme Domain Of Flavocytochr 6e-07
3npl_A 470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 6e-07
3kx4_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 6e-07
3hf2_A 482 Crystal Structure Of The I401p Mutant Of Cytochrome 7e-07
3psx_A 487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 7e-07
3kx5_A 470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-06
3m4v_A 482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-06
3czh_A 481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-06
3eqm_A 503 Crystal Structure Of Human Placental Aromatase Cyto 1e-06
3c6g_A 479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 1e-06
4dud_A 471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-06
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 1e-06
1zo4_A 473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-06
4duf_A 471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-06
4duc_A 472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-06
3ekb_A 470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-06
1yqp_A 455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-06
3qi8_B 472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 2e-06
1yqo_A 455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-06
3dgi_A 461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 2e-06
1fah_A 471 Structure Of Cytochrome P450 Length = 471 2e-06
3ekf_A 470 Crystal Structure Of The A264q Heme Domain Of Cytoc 2e-06
1zoa_A 473 Crystal Structure Of A328v Mutant Of The Heme Domai 2e-06
2ij4_A 470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 2e-06
1smi_A 471 A Single Mutation Of P450 Bm3 Induces The Conformat 3e-06
3ekd_A 470 Crystal Structure Of The A264m Heme Domain Of Cytoc 3e-06
2ij3_A 470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 3e-06
3dbg_A 467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 5e-06
3pm0_A 507 Structural Characterization Of The Complex Between 5e-06
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 5e-06
3qm4_A 479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 6e-06
2f9q_A 479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 8e-06
1po5_A 476 Structure Of Mammalian Cytochrome P450 2b4 Length = 2e-05
1suo_A 476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 2e-05
3tk3_A 476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-05
2q6n_A 478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 2e-05
3qz1_A 496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 2e-05
4dub_A 472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 2e-05
4h1n_A 479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 2e-05
4dua_A 471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 2e-05
3ibd_A 476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 3e-05
4dtw_B 469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 6e-05
4du2_B 470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 9e-05
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 9e-05
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 1e-04
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure 
Iteration: 1

 Score = 63.2 bits (152), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 32/95 (33%), Positives = 56/95 (58%), Gaps = 2/95 (2%)
Query: 84  LFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDM 143
           +F  AG ET ++  S +++ L+ HP+VQ K+ +E+ +++       P+   +  ++YLDM
Sbjct: 279 IFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNK--APPTYDTVLQMEYLDM 336
Query: 144 VIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTL 178
           V+ E+LRL+P A    R   +D+ I    IPKG +
Sbjct: 337 VVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVV 371
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 7e-34
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-33
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 5e-33
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 6e-32
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-31
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 2e-30
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 3e-30
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 1e-29
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-28
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 2e-26
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 3e-25
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 5e-25
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 6e-25
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 3e-24
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 8e-24
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 8e-23
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-22
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 6e-21
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 7e-20
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 1e-19
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 4e-19
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 9e-19
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 9e-19
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 1e-18
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-18
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-18
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 9e-18
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 1e-17
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-17
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 6e-09
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 1e-08
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 2e-08
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 7e-08
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 8e-08
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 8e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 2e-07
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 2e-07
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 2e-07
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 3e-07
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 3e-07
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 5e-07
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 5e-07
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 8e-07
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 9e-07
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 1e-06
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 2e-06
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 2e-06
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 2e-06
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 2e-06
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 2e-06
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 2e-06
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 2e-06
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 2e-06
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 3e-06
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 3e-06
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 3e-06
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 4e-06
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 4e-06
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 6e-06
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 7e-06
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 8e-06
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 9e-06
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 9e-06
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 2e-05
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 2e-05
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 2e-05
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 2e-05
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 3e-05
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 3e-05
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 4e-05
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 4e-05
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 4e-05
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 5e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 6e-05
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 9e-05
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 1e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  123 bits (311), Expect = 7e-34
 Identities = 35/98 (35%), Positives = 49/98 (50%), Gaps = 2/98 (2%)

Query: 80  DELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLK 139
           D    F IAG ET     +  +  LS  PE+ A++  E+  +IG    +     +L  L+
Sbjct: 246 DNFVTFFIAGHETSANHLAFTVMELSRQPEIVARLQAEVDEVIGSK--RYLDFEDLGRLQ 303

Query: 140 YLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGT 177
           YL  V+KESLRLYPPA+   R   E+  I    +P  T
Sbjct: 304 YLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRVPGNT 341
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 99.93
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.93
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.93
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.93
3nxu_A 485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.93
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.93
3mdm_A 456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.92
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.92
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.92
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.92
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.92
3ld6_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.92
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 99.92
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.92
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.92
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.92
2ve3_A 444 Putative cytochrome P450 120; oxidoreductase, mono 99.92
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.91
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 99.91
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.91
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 99.91
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.91
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.89
3v8d_A 491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.87
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.87
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 99.87
3dsk_A 495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.85
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.85
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.84
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.84
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.84
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.84
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.83
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.83
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.83
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.83
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.83
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.83
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.83
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.83
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.83
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.83
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.83
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.82
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.82
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.82
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.82
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.82
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.82
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.82
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.82
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.82
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.82
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.82
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.82
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.82
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.82
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.81
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.81
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.81
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.81
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.81
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.81
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.81
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.81
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.81
3a4g_A 411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.81
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.81
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.8
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.8
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.79
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.79
1izo_A 417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.79
3awm_A 415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.77
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.76
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.66
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.66
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
Probab=99.93  E-value=3.7e-25  Score=179.92  Aligned_cols=116  Identities=25%  Similarity=0.415  Sum_probs=104.1

Q ss_pred             chhhHHHhHH--HhhHHHHHHHHHHHHhchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhcCCCCCCCCHHHhhcCHH
Q psy17785         63 DDIKLADLQE--ELGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKY  140 (180)
Q Consensus        63 ~d~~~~~~~~--~~~~~~~~~~~~l~~ag~~tt~~~~~~~l~~l~~~p~~~~~~~~ei~~~~~~~~~~~~~~~~~~~~p~  140 (180)
                      .|.+...+..  .+++++.+++.++++||+|||+++++|++++|+.||++++++++|++++++  +...++.+++.++||
T Consensus       267 ~d~l~~ll~~~~l~~~ei~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~v~~--~~~~~~~~~l~~lpy  344 (482)
T 3k9v_A          267 ADFLCDIYQQDHLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQAQRRLLQEVQSVLP--DNQTPRAEDLRNMPY  344 (482)
T ss_dssp             SCHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHSC--TTCCCCGGGGGGCHH
T ss_pred             hHHHHHHHhccCCCHHHHHHHHHHHHHhhhhhHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhC--CCCCCCHHHHhhCHH
Confidence            4555444433  366789999999999999999999999999999999999999999999987  445789999999999


Q ss_pred             HHHHHHHHhcCCCCCCCCccccCCCceEcCeEeCCCCeeC
Q psy17785        141 LDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKGTLDF  180 (180)
Q Consensus       141 ~~~~i~E~lR~~~~~~~~~r~~~~d~~i~g~~ip~Gt~v~  180 (180)
                      +++||+|++|++|++|.++|.+.+|++++||.|||||.|+
T Consensus       345 l~avi~E~lRl~p~~~~~~r~~~~d~~~~g~~ip~Gt~v~  384 (482)
T 3k9v_A          345 LKACLKESMRLTPSVPFTTRTLDKPTVLGEYALPKGTVLT  384 (482)
T ss_dssp             HHHHHHHHHHHSCSCCEEEEECSSCEEETTEEECTTCEEE
T ss_pred             HHHHHHHHhhcCCCCcCcccccCCceeeCCEEECCCCEEE
Confidence            9999999999999999889999999999999999999984
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 7e-11
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 1e-08
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 57.8 bits (138), Expect = 7e-11
 Identities = 31/101 (30%), Positives = 55/101 (54%), Gaps = 2/101 (1%)

Query: 76  EAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSEL 135
              + +  +F  AG ET ++  S +++ L+ HP+VQ K+ +E+ +++            +
Sbjct: 266 LELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYD--TV 323

Query: 136 ENLKYLDMVIKESLRLYPPAYVAPRRATEDIHIGEFTIPKG 176
             ++YLDMV+ E+LRL+P A    R   +D+ I    IPKG
Sbjct: 324 LQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKG 364
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d2ciba1 445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.9
d3czha1 463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 99.9
d1tqna_ 472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 99.9
d1r9oa_ 467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.88
d1po5a_ 465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.87
d2ij2a1 453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.85
d1izoa_ 411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.84
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.77
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.72
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.6
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.59
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.56
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.55
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.53
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.53
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.51
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.47
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.45
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.36
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.3
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.21
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Cytochrome p450 14 alpha-sterol demethylase (cyp51)
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=99.90  E-value=7.5e-24  Score=168.82  Aligned_cols=105  Identities=27%  Similarity=0.295  Sum_probs=98.7

Q ss_pred             hhHHHHHHHHHHHHhchHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHhhcCCCCCCCCHHHhhcCHHHHHHHHHHhcCCC
Q psy17785         74 LGEAHLDELGLFNIAGIETLTTAFSAVIFLLSMHPEVQAKVYDELISIIGEDFHKKPSLSELENLKYLDMVIKESLRLYP  153 (180)
Q Consensus        74 ~~~~~~~~~~~l~~ag~~tt~~~~~~~l~~l~~~p~~~~~~~~ei~~~~~~~~~~~~~~~~~~~~p~~~~~i~E~lR~~~  153 (180)
                      +++++.++++.+++||++||+.+++|++++|+.||++++++++|++.+++  .+..++.+++.++||++++++|++|++|
T Consensus       238 s~~ei~~~~~~ll~ag~~tt~~~l~~~l~~L~~~p~~~~~lr~Ei~~~~~--~~~~~~~~~l~~lp~L~a~i~E~lRl~p  315 (445)
T d2ciba1         238 SADEITGMFISMMFAGHHTSSGTASWTLIELMRHRDAYAAVIDELDELYG--DGRSVSFHALRQIPQLENVLKETLRLHP  315 (445)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHGG--GCCCHHHHTTSCCHHHHHHHHHHHHHSC
T ss_pred             Ccchhhhhhhhhhhhccccchhhccccccccccccccccccccccccccc--ccccchhhhcccchhhcccccccccccc
Confidence            56789999999999999999999999999999999999999999999987  4556788899999999999999999999


Q ss_pred             CCCCCccccCCCceEcCeEeCCCCeeC
Q psy17785        154 PAYVAPRRATEDIHIGEFTIPKGTLDF  180 (180)
Q Consensus       154 ~~~~~~r~~~~d~~i~g~~ip~Gt~v~  180 (180)
                      +++...|.+++|+.++|+.|||||.|+
T Consensus       316 ~~~~~~~~~~~~~~~~~~~ip~g~~v~  342 (445)
T d2ciba1         316 PLIILMRVAKGEFEVQGHRIHEGDLVA  342 (445)
T ss_dssp             SCCCEEEEECSCEEETTEEECTTCEEE
T ss_pred             ccceeccccccccccceeecccccccc
Confidence            999888999999999999999999984
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure