Psyllid ID: psy17835
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 702 | 2.2.26 [Sep-21-2011] | |||||||
| P26045 | 913 | Tyrosine-protein phosphat | yes | N/A | 0.925 | 0.711 | 0.334 | 1e-113 | |
| A2ALK8 | 913 | Tyrosine-protein phosphat | yes | N/A | 0.928 | 0.714 | 0.324 | 1e-110 | |
| P29074 | 926 | Tyrosine-protein phosphat | no | N/A | 0.343 | 0.260 | 0.492 | 2e-68 | |
| Q9WU22 | 926 | Tyrosine-protein phosphat | no | N/A | 0.347 | 0.263 | 0.487 | 4e-68 | |
| P28191 | 1026 | Tyrosine-protein phosphat | yes | N/A | 0.403 | 0.275 | 0.428 | 1e-67 | |
| O43491 | 1005 | Band 4.1-like protein 2 O | no | N/A | 0.334 | 0.233 | 0.460 | 2e-60 | |
| Q9Z2H5 | 879 | Band 4.1-like protein 1 O | no | N/A | 0.334 | 0.267 | 0.451 | 5e-60 | |
| Q9H4G0 | 881 | Band 4.1-like protein 1 O | no | N/A | 0.334 | 0.266 | 0.451 | 7e-60 | |
| Q9WTP0 | 879 | Band 4.1-like protein 1 O | no | N/A | 0.334 | 0.267 | 0.448 | 2e-59 | |
| P11171 | 864 | Protein 4.1 OS=Homo sapie | no | N/A | 0.337 | 0.274 | 0.438 | 1e-58 |
| >sp|P26045|PTN3_HUMAN Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens GN=PTPN3 PE=1 SV=2 | Back alignment and function desciption |
|---|
Score = 408 bits (1049), Expect = e-113, Method: Compositional matrix adjust.
Identities = 265/792 (33%), Positives = 393/792 (49%), Gaps = 142/792 (17%)
Query: 3 FYFRVKFYVSDPSKLQEEYTRYHFYLQIRKDILAHRLILAPSTACLLASYTVQCNTYISE 62
+FRV+F++ DP+ LQ+E TR+ ++LQ++ DI RL ++A +LASY VQ
Sbjct: 103 LHFRVRFFIPDPNTLQQEQTRHLYFLQLKMDICEGRLTCPLNSAVVLASYAVQ------- 155
Query: 63 NFLSLEIMADTKLVWFSISAELGDYHPDEHKPGYLSGLSLVPGQTEEMELKIEELHKLHK 122
+ GDY+ H PGYLS +P Q E+ K+E LH+ H
Sbjct: 156 -------------------SHFGDYNSSIHHPGYLSDSHFIPDQNEDFLTKVESLHEQHS 196
Query: 123 GQSPADAEYNYLEHAKRCEMYGVSVHGAKDSQDRDIQLGVTANGLVIFHAGARLNLLSWV 182
G ++AE Y+ A+ + YGV +H +D + D+ +G+ + G+ ++ + WV
Sbjct: 197 GLKQSEAESCYINIARTLDFYGVELHSGRDLHNLDLMIGIASAGVAVYRKYICTSFYPWV 256
Query: 183 KIVKISFKRKQFFVQLKREPSENYDTLLGFNMTTYRSCKNLWKSCVEHHTFFRLHSPRRS 242
I+KISFKRK+FF+ +++ +E+ + ++ FNM YRSCKNLWKSCVEHHTFF+ +
Sbjct: 257 NILKISFKRKKFFIHQRQKQAESREHIVAFNMLNYRSCKNLWKSCVEHHTFFQ------A 310
Query: 243 RKFLPPPLSLGSKFFSSG--RTEYQTYQQARRSVVLINGCDVSGMHHEQVVNIIRTSRDT 300
+K LP ++ S++++ G T+ Q + V+ G V + +++ +
Sbjct: 311 KKLLPQEKNVLSQYWTMGSRNTKKSVNNQYCKKVI---GGMVWNPAMRRSLSVEHLETKS 367
Query: 301 HGELVLTVRPNGKS---RSTQRSIQISSDDNAKSSRSLRYDNK---VTSLGSREPKRAWD 354
+ PN +S R R + SS DN + + + + T GS P+ +
Sbjct: 368 LPSRSPPITPNWRSPRLRHEIRKPRHSSADNLANEMTYITETEDVFYTYKGSLAPQDSDS 427
Query: 355 ------PPHPSDDEGGFLDKPPPGSAKLEEGEEAGPAIRTTEPGPAAILPARTTLNFVDD 408
PH L + P + L + + + + PG + P +DD
Sbjct: 428 EVSQNRSPHQES-----LSENNPAQSYLTQKSSSSVSPSSNAPGSCS--PDGVDQQLLDD 480
Query: 409 ------------------DVEEDLEEGLVLIRIAPDEQGRFGFNVKGGADLGMPILVVR- 449
D ++ + LVLIRI PDE G+FGFN+KGG D MP++V R
Sbjct: 481 FHRVTKGGSTEDASQYYCDKNDNGDSYLVLIRITPDEDGKFGFNLKGGVDQKMPLVVSRI 540
Query: 450 -----------------------------------------GRRRGGRGAPLPIRTRV-- 466
R R L IR R
Sbjct: 541 NPESPADTCIPKLNEGDQIVLINGRDISEHTHDQVVMFIKASRESHSRELALVIRRRAVR 600
Query: 467 ----FTSRGGLNARQCRGPVPVDAPVGGWTGEWAL------------VAQFERLYRKKPG 510
F S LN P+ P GG T E ++ + QFE+LYRKKPG
Sbjct: 601 SFADFKSEDELNQLFPEAIFPM-CPEGGDTLEGSMAQLKKGLESGTVLIQFEQLYRKKPG 659
Query: 511 LSMLHANKQENVIKNRYRDISPYDATRVVLHEAPDGDYINANTVAMEIPGSGIVNRYIAT 570
L++ A +N+ KNRY+D+ PYD TRV+L + DYINA+ V MEIP + +VN+YIAT
Sbjct: 660 LAITFAKLPQNLDKNRYKDVLPYDTTRVLLQ--GNEDYINASYVNMEIPAANLVNKYIAT 717
Query: 571 QGPLASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPSLGETLELSGGRFNISCA 630
QGPL T FW ++ + +L+VM+TTL ERGRTKCH+YWP + ++ G F+I C
Sbjct: 718 QGPLPHTCAQFWQVVWDQKLSLIVMLTTLTERGRTKCHQYWPDPPDV--MNHGGFHIQCQ 775
Query: 631 KEEADPSGSFVFREFVLRDSQTGEKRDVTQMQYLAWPDHGVPDDVNRFLAFTRQVRHERA 690
E D + ++V RE ++ ++QTGE+ VT +QY+AWPDHGVPDD + FL F VR R
Sbjct: 776 SE--DCTIAYVSREMLVTNTQTGEEHTVTHLQYVAWPDHGVPDDSSDFLEFVNYVRSLRV 833
Query: 691 GMVEPAIVHCSA 702
EP +VHCSA
Sbjct: 834 DS-EPVLVHCSA 844
|
May act at junctions between the membrane and the cytoskeleton. Possesses tyrosine phosphatase activity. Homo sapiens (taxid: 9606) EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 4EC: 8 |
| >sp|A2ALK8|PTN3_MOUSE Tyrosine-protein phosphatase non-receptor type 3 OS=Mus musculus GN=Ptpn3 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|P29074|PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens GN=PTPN4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9WU22|PTN4_MOUSE Tyrosine-protein phosphatase non-receptor type 4 OS=Mus musculus GN=Ptpn4 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P28191|PTP1_CAEEL Tyrosine-protein phosphatase 1 OS=Caenorhabditis elegans GN=ptp-1 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|O43491|E41L2_HUMAN Band 4.1-like protein 2 OS=Homo sapiens GN=EPB41L2 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9Z2H5|E41L1_MOUSE Band 4.1-like protein 1 OS=Mus musculus GN=Epb41l1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9H4G0|E41L1_HUMAN Band 4.1-like protein 1 OS=Homo sapiens GN=EPB41L1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q9WTP0|E41L1_RAT Band 4.1-like protein 1 OS=Rattus norvegicus GN=Epb41l1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|P11171|41_HUMAN Protein 4.1 OS=Homo sapiens GN=EPB41 PE=1 SV=4 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 702 | ||||||
| 332025788 | 925 | Tyrosine-protein phosphatase non-recepto | 0.896 | 0.68 | 0.491 | 0.0 | |
| 328790400 | 895 | PREDICTED: tyrosine-protein phosphatase | 0.897 | 0.703 | 0.498 | 0.0 | |
| 307176574 | 954 | Tyrosine-protein phosphatase non-recepto | 0.897 | 0.660 | 0.487 | 0.0 | |
| 380019251 | 897 | PREDICTED: tyrosine-protein phosphatase | 0.897 | 0.702 | 0.498 | 0.0 | |
| 340715628 | 896 | PREDICTED: tyrosine-protein phosphatase | 0.897 | 0.703 | 0.493 | 0.0 | |
| 307205386 | 896 | Tyrosine-protein phosphatase non-recepto | 0.914 | 0.716 | 0.482 | 0.0 | |
| 350417946 | 896 | PREDICTED: tyrosine-protein phosphatase | 0.914 | 0.716 | 0.483 | 0.0 | |
| 383855270 | 896 | PREDICTED: tyrosine-protein phosphatase | 0.914 | 0.716 | 0.485 | 0.0 | |
| 270011334 | 887 | hypothetical protein TcasGA2_TC005339 [T | 0.914 | 0.723 | 0.456 | 1e-166 | |
| 157134147 | 1048 | protein-tyrosine phosphatase, non-recept | 0.888 | 0.595 | 0.443 | 1e-159 |
| >gi|332025788|gb|EGI65945.1| Tyrosine-protein phosphatase non-receptor type 4 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 692 bits (1785), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 388/789 (49%), Positives = 470/789 (59%), Gaps = 160/789 (20%)
Query: 1 GNFYFRVKFYVSDPSKLQEEYTRYHFYLQIRKDILAHRLILAPSTACLLASYTVQCNTYI 60
G+F+FRVKFYVSDPSKLQEEYTRY FYLQIR+DIL +L L PSTACL+ASYTVQ
Sbjct: 139 GHFFFRVKFYVSDPSKLQEEYTRYQFYLQIRRDILQGKLQLPPSTACLIASYTVQ----- 193
Query: 61 SENFLSLEIMADTKLVWFSISAELGDYHPDEHKPGYLSGLSLVPGQTEEMELKIEELHKL 120
+ELGDYHP+EH PGYLS L L+PGQTEEME KI ELHKL
Sbjct: 194 ---------------------SELGDYHPEEHGPGYLSQLQLIPGQTEEMEKKISELHKL 232
Query: 121 HKGQSPADAEYNYLEHAKRCEMYGVSVHGAKDSQDRDIQLGVTANGLVIFHAGARLNLLS 180
HKGQ PADAE+N+L+HAKR +MYGV +H A+DS +++IQLGVT+ GLV+F G ++N+ S
Sbjct: 233 HKGQLPADAEFNFLDHAKRLDMYGVELHKARDSTNKEIQLGVTSIGLVVFQNGIKINVFS 292
Query: 181 WVKIVKISFKRKQFFVQLKREPSENYDTLLGFNMTTYRSCKNLWKSCVEHHTFFRLHSPR 240
W KIVKISFKRKQFF+QL+RE SENYDTLLGFNM TYRS KNLWK+CVEHHTFFRLHSP+
Sbjct: 293 WSKIVKISFKRKQFFIQLRREQSENYDTLLGFNMQTYRSSKNLWKACVEHHTFFRLHSPK 352
Query: 241 -RSRKFLPPPLSLGSKFFSSGRTEYQTYQ----QARRSVVLINGCDVSGMHHEQVVNIIR 295
R ++F PL+L S+F SGRTE+QT + +AR I H ++
Sbjct: 353 MRPKRF---PLTLSSRFTYSGRTEFQTVEDGKHRARVERTFIRSPSKKIAHTIATASVT- 408
Query: 296 TSRDTHGELVLTVRPNGKSRSTQRSIQISSDDNAKSSRSLRYDNKVTSLGSREPKRAWDP 355
D G+L + RP SRS YDNKV SLG+REP++AW
Sbjct: 409 ---DDKGKLAIPGRP---------------------SRS--YDNKVQSLGAREPRQAWGE 442
Query: 356 PHPSDDEGGFLDKPPPGSAKLEEGEEAGPAIRTTEPGPAAILPARTTLNFVDDDVEED-- 413
+PSDDEGGFL + G PA+ ++ DDD +
Sbjct: 443 GNPSDDEGGFLSLREEITGSYTRGGAFSPAL------------GSRVFSYADDDTTAERN 490
Query: 414 ------------------LEEGLVLIRIAPDEQGRFGFNVKGGADLGMPI---------- 445
LE+GLV I + PDEQGRFGFNVKGG DL MPI
Sbjct: 491 IYDLPDYSEPTSSPAPQILEDGLVTISLTPDEQGRFGFNVKGGLDLDMPILVSRVAPNTP 550
Query: 446 --------------------------------LVVRGRRRGGRGAPLPIR-TRVFTSRGG 472
L+ + R RG L +R ++ + G
Sbjct: 551 ADRCYPKLNEGDQVVYINGIDVSGLLHERVVNLIRQSRDRGSGELTLTVRPNALYNALAG 610
Query: 473 LNARQCRGP----VPVDAP---------------VGGWTGEWALVAQFERLYRKKPGLSM 513
+ P VP DAP + AL+AQ+E+LYRK P L+
Sbjct: 611 TDETSEEEPPYRYVP-DAPHAAIGSDALAQSMLLLADGLASGALIAQYEQLYRKNPELTS 669
Query: 514 LHANKQENVIKNRYRDISPYDATRVVLHEAPDGDYINANTVAMEIPGSGIVNRYIATQGP 573
L + K EN KNRYRDISPYD TRV+L + +GDYINAN V MEIPGSGI+NRYIATQGP
Sbjct: 670 LESKKPENQSKNRYRDISPYDVTRVILMRSANGDYINANYVNMEIPGSGIINRYIATQGP 729
Query: 574 LASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPSLGETLELSGGRFNISCAKEE 633
L+STV DFW M++EAGSTLVVM+TTLVERGR KCH+YWP+ ETL L + E
Sbjct: 730 LSSTVADFWQMVLEAGSTLVVMLTTLVERGRAKCHQYWPAYNETLTLRNLTLTSTAENIE 789
Query: 634 ADPSGSFVFREFVLRDSQTGEKRDVTQMQYLAWPDHGVPDDVNRFLAFTRQVRHERAGMV 693
+F+FREF+LRD TGE+RD+T MQY +WPDHGVP D +F FT +VR R G+V
Sbjct: 790 ----DTFIFREFILRDVNTGEERDITHMQYCSWPDHGVPSDWRQFTMFTERVRAARTGIV 845
Query: 694 EPAIVHCSA 702
EPA+VHCSA
Sbjct: 846 EPAVVHCSA 854
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|328790400|ref|XP_623968.3| PREDICTED: tyrosine-protein phosphatase non-receptor type 4 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307176574|gb|EFN66061.1| Tyrosine-protein phosphatase non-receptor type 4 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|380019251|ref|XP_003693524.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 4 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340715628|ref|XP_003396312.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 4-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307205386|gb|EFN83727.1| Tyrosine-protein phosphatase non-receptor type 4 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350417946|ref|XP_003491658.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 4-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383855270|ref|XP_003703138.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 4 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|270011334|gb|EFA07782.1| hypothetical protein TcasGA2_TC005339 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|157134147|ref|XP_001663169.1| protein-tyrosine phosphatase, non-receptor type nt5 [Aedes aegypti] gi|108881421|gb|EAT45646.1| AAEL003108-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 702 | ||||||
| FB|FBgn0261985 | 973 | Ptpmeg "Ptpmeg" [Drosophila me | 0.531 | 0.383 | 0.405 | 6.6e-143 | |
| UNIPROTKB|F1RXW4 | 895 | PTPN4 "Uncharacterized protein | 0.284 | 0.223 | 0.548 | 5.1e-139 | |
| UNIPROTKB|E1BWF6 | 931 | PTPN4 "Uncharacterized protein | 0.284 | 0.214 | 0.567 | 1e-136 | |
| UNIPROTKB|F1PAF5 | 926 | PTPN4 "Uncharacterized protein | 0.284 | 0.215 | 0.543 | 5.3e-135 | |
| UNIPROTKB|P29074 | 926 | PTPN4 "Tyrosine-protein phosph | 0.284 | 0.215 | 0.543 | 8.6e-135 | |
| ZFIN|ZDB-GENE-030616-449 | 928 | ptpn4a "protein tyrosine phosp | 0.284 | 0.215 | 0.558 | 6.5e-134 | |
| ZFIN|ZDB-GENE-030131-6259 | 934 | ptpn4b "protein tyrosine phosp | 0.282 | 0.211 | 0.539 | 2.3e-128 | |
| UNIPROTKB|E1BJR7 | 804 | PTPN4 "Uncharacterized protein | 0.284 | 0.248 | 0.548 | 1.2e-127 | |
| UNIPROTKB|G3V6B9 | 926 | Ptpn4 "Protein tyrosine phosph | 0.284 | 0.215 | 0.548 | 8e-120 | |
| MGI|MGI:1099792 | 926 | Ptpn4 "protein tyrosine phosph | 0.284 | 0.215 | 0.558 | 1.5e-118 |
| FB|FBgn0261985 Ptpmeg "Ptpmeg" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 658 (236.7 bits), Expect = 6.6e-143, Sum P(4) = 6.6e-143
Identities = 165/407 (40%), Positives = 226/407 (55%)
Query: 60 ISENFL--SLEIMADTK--LVWFSISAELGDYHPDEHKPGYLSGLSLVPGQTEEMELKIE 115
I N L L ++T+ L +++ +ELGD++ EH+PGYLSG+ L+ QT E E K+
Sbjct: 140 IKRNILLGKLPCSSNTQCLLASYTVQSELGDFNALEHQPGYLSGMQLLCDQTTEAERKVG 199
Query: 116 ELHKLHKGQSPADAEYNYLEHAKRCEMYGVSVHGAKDSQDRDIQLGVTANGLVIFHAGAR 175
ELHKLH+GQ PADAEYNYLE Y A DS +++QLGV+A GL++F R
Sbjct: 200 ELHKLHRGQLPADAEYNYLEPTLSDWSYTGLTCTATDSNGKELQLGVSAVGLLVFQHSLR 259
Query: 176 LNLLSWVKIVKISFKRKQFFVQLKREPSENYDTLLGFNMTTYRSCKNLWKSCVEHHTFFR 235
+N SW K+VK+SFKRK FF+QL+REPSENYDTLLGF M++++ K LWKSCVEHH+FFR
Sbjct: 260 VNTFSWSKMVKVSFKRKDFFIQLRREPSENYDTLLGFGMSSHKHAKALWKSCVEHHSFFR 319
Query: 236 LHSPRRSRKFLPPPLSLGSKFFSSGRTEYQTYQQARRS----VVLINGCDVSGMHHEQVV 291
L P R +FL +SLGSKF+ SGRTE Q Q++++ V + + V
Sbjct: 320 LKRPHRLSRFLN--ISLGSKFYYSGRTELQAVQESKQRGRIHKVFVRSPSKRLLGAAGGV 377
Query: 292 NIIRTSRDT----H-GELVLTVRPNGKXXXXXXXXXXXXXXNAKSSRSLRYDNKVTSLGS 346
+S T H G NGK K+SR +DNKVTS +
Sbjct: 378 GTSGSSGGTPMQQHSGSESANSHNNGKPAGAGTILTIT-----KTSRP--HDNKVTSKEA 430
Query: 347 RE-PKRAWDPPHPSDD---EGGFLDKPPPGSAKLEEGEEAG--PAIRTTEPGPAAILPAR 400
P++AW+ D + GF+++ + + E + PA + + P +LP
Sbjct: 431 DSMPRKAWEQQSDEYDIQLDVGFIEQC---TRRFESASPSPMPPAYSSGQHSPI-LLP-- 484
Query: 401 TTLNFXXXXXXXXXXXXXXXIRIAPDEQGRFGFNVKGGADLGMPILV 447
TT+ IR+ DEQGR+GFNVKGG DL +P+ V
Sbjct: 485 TTIADAVGHQQPESGSDLITIRLQADEQGRYGFNVKGGVDLSLPVQV 531
|
|
| UNIPROTKB|F1RXW4 PTPN4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BWF6 PTPN4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PAF5 PTPN4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P29074 PTPN4 "Tyrosine-protein phosphatase non-receptor type 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030616-449 ptpn4a "protein tyrosine phosphatase, non-receptor type 4, a" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-6259 ptpn4b "protein tyrosine phosphatase, non-receptor type 4, b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BJR7 PTPN4 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6B9 Ptpn4 "Protein tyrosine phosphatase, non-receptor type 4, isoform CRA_a" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1099792 Ptpn4 "protein tyrosine phosphatase, non-receptor type 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| P26045 | PTN3_HUMAN | 3, ., 1, ., 3, ., 4, 8 | 0.3345 | 0.9259 | 0.7119 | yes | N/A |
| A2ALK8 | PTN3_MOUSE | 3, ., 1, ., 3, ., 4, 8 | 0.3240 | 0.9287 | 0.7141 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.1.3 | LOW CONFIDENCE prediction! |
| 3rd Layer | 3.1.3.48 | 0.824 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 702 | |||
| smart00194 | 259 | smart00194, PTPc, Protein tyrosine phosphatase, ca | 9e-70 | |
| cd00047 | 231 | cd00047, PTPc, Protein tyrosine phosphatases (PTP) | 1e-69 | |
| cd13189 | 123 | cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine | 3e-68 | |
| pfam00102 | 233 | pfam00102, Y_phosphatase, Protein-tyrosine phospha | 6e-66 | |
| cd13184 | 113 | cd13184, FERM_C_4_1_family, Protein 4 | 2e-47 | |
| cd13193 | 122 | cd13193, FERM_C_FARP1-like, FERM, RhoGEF and pleck | 2e-37 | |
| pfam09380 | 90 | pfam09380, FERM_C, FERM C-terminal PH-like domain | 3e-35 | |
| cd13186 | 111 | cd13186, FERM_C_NBL4_NBL5, Novel band 4 | 4e-32 | |
| COG5599 | 302 | COG5599, PTP2, Protein tyrosine phosphatase [Signa | 4e-30 | |
| smart00295 | 201 | smart00295, B41, Band 4 | 6e-30 | |
| PHA02742 | 303 | PHA02742, PHA02742, protein tyrosine phosphatase; | 4e-28 | |
| PHA02738 | 320 | PHA02738, PHA02738, hypothetical protein; Provisio | 2e-27 | |
| pfam00373 | 113 | pfam00373, FERM_M, FERM central domain | 4e-26 | |
| PHA02746 | 323 | PHA02746, PHA02746, protein tyrosine phosphatase; | 4e-23 | |
| PHA02747 | 312 | PHA02747, PHA02747, protein tyrosine phosphatase; | 1e-21 | |
| cd13192 | 105 | cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containin | 7e-21 | |
| cd00836 | 91 | cd00836, FERM_C-lobe, FERM domain C-lobe | 4e-17 | |
| cd13188 | 111 | cd13188, FERM_C_PTPN14_PTPN21, Protein tyrosine ph | 5e-13 | |
| cd13187 | 124 | cd13187, FERM_C_PTPH13, Protein tyrosine phosphata | 9e-12 | |
| cd13195 | 131 | cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligas | 5e-11 | |
| smart00404 | 105 | smart00404, PTPc_motif, Protein tyrosine phosphata | 1e-09 | |
| smart00012 | 105 | smart00012, PTPc_DSPc, Protein tyrosine phosphatas | 1e-09 | |
| PHA02740 | 298 | PHA02740, PHA02740, protein tyrosine phosphatase; | 1e-07 | |
| cd13194 | 97 | cd13194, FERM_C_ERM, ERM family FERM domain C-lobe | 4e-05 | |
| cd00992 | 82 | cd00992, PDZ_signaling, PDZ domain found in a vari | 5e-05 |
| >gnl|CDD|214550 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
Score = 228 bits (583), Expect = 9e-70
Identities = 86/209 (41%), Positives = 108/209 (51%), Gaps = 10/209 (4%)
Query: 497 LVAQFERLYRKKPG-LSMLHANKQENVIKNRYRDISPYDATRVVLH--EAPDGDYINANT 553
L +FE+L R KP S A EN KNRY+D+ PYD TRV L DYINA+
Sbjct: 2 LEEEFEKLDRLKPDDESCTVAAFPENRDKNRYKDVLPYDHTRVKLKPPPGEGSDYINASY 61
Query: 554 VAMEIPGSGIVNRYIATQGPLASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPS 613
I G YIATQGPL STV DFW M+ E T++VM+T LVE+GR KC +YWP
Sbjct: 62 ----IDGPNGPKAYIATQGPLPSTVEDFWRMVWEQKVTVIVMLTELVEKGREKCAQYWPD 117
Query: 614 LGETLELSGGRFNISCAKEEADPSGSFVFREFVLRDSQTGEKRDVTQMQYLAWPDHGVPD 673
L+ G ++ E + R + ++ E R VT Y WPDHGVP+
Sbjct: 118 EEGE-PLTYGDITVTLKSVEKVD--DYTIRTLEVTNTGCSETRTVTHYHYTNWPDHGVPE 174
Query: 674 DVNRFLAFTRQVRHERAGMVEPAIVHCSA 702
L R VR ++ P +VHCSA
Sbjct: 175 SPESILDLIRAVRKSQSTSTGPIVVHCSA 203
|
Length = 259 |
| >gnl|CDD|238006 cd00047, PTPc, Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >gnl|CDD|241343 cd13189, FERM_C_PTPN4_PTPN3_like, Protein tyrosine phosphatase non-receptor proteins 3 and 4 (PTPN4 and PTPN3) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|215717 pfam00102, Y_phosphatase, Protein-tyrosine phosphatase | Back alignment and domain information |
|---|
| >gnl|CDD|241338 cd13184, FERM_C_4_1_family, Protein 4 | Back alignment and domain information |
|---|
| >gnl|CDD|241347 cd13193, FERM_C_FARP1-like, FERM, RhoGEF and pleckstrin domain-containing protein 1 and related proteins FERM domain | Back alignment and domain information |
|---|
| >gnl|CDD|220216 pfam09380, FERM_C, FERM C-terminal PH-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|241340 cd13186, FERM_C_NBL4_NBL5, Novel band 4 | Back alignment and domain information |
|---|
| >gnl|CDD|227886 COG5599, PTP2, Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|214604 smart00295, B41, Band 4 | Back alignment and domain information |
|---|
| >gnl|CDD|165109 PHA02742, PHA02742, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222923 PHA02738, PHA02738, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215882 pfam00373, FERM_M, FERM central domain | Back alignment and domain information |
|---|
| >gnl|CDD|165113 PHA02746, PHA02746, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241346 cd13192, FERM_C_FRMD3_FRMD5, FERM domain-containing protein 3 and 5 FERM (FRMD3 and 5) domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|241233 cd00836, FERM_C-lobe, FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|241342 cd13188, FERM_C_PTPN14_PTPN21, Protein tyrosine phosphatase non-receptor proteins 14 and 21 (PTPN14 and 21) FERM domain | Back alignment and domain information |
|---|
| >gnl|CDD|241341 cd13187, FERM_C_PTPH13, Protein tyrosine phosphatase non-receptor 13 (PTPH13) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|241349 cd13195, FERM_C_MYLIP_IDOL, The E3 ubiquitin ligase myosin regulatory light chain-interacting protein (MYLIP; also called inducible degrader of the LDL receptor, IDOL) FERM domain C-lobe | Back alignment and domain information |
|---|
| >gnl|CDD|214649 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >gnl|CDD|214469 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >gnl|CDD|165107 PHA02740, PHA02740, protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|241348 cd13194, FERM_C_ERM, ERM family FERM domain C-lobe/F3 | Back alignment and domain information |
|---|
| >gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 702 | |||
| KOG0792|consensus | 1144 | 100.0 | ||
| KOG3530|consensus | 616 | 100.0 | ||
| KOG3527|consensus | 975 | 100.0 | ||
| PHA02742 | 303 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02747 | 312 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02740 | 298 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02746 | 323 | protein tyrosine phosphatase; Provisional | 100.0 | |
| PHA02738 | 320 | hypothetical protein; Provisional | 100.0 | |
| KOG0790|consensus | 600 | 100.0 | ||
| smart00194 | 258 | PTPc Protein tyrosine phosphatase, catalytic domai | 100.0 | |
| KOG4228|consensus | 1087 | 100.0 | ||
| KOG0793|consensus | 1004 | 100.0 | ||
| cd00047 | 231 | PTPc Protein tyrosine phosphatases (PTP) catalyze | 100.0 | |
| KOG0791|consensus | 374 | 100.0 | ||
| PF00102 | 235 | Y_phosphatase: Protein-tyrosine phosphatase; Inter | 100.0 | |
| COG5599 | 302 | PTP2 Protein tyrosine phosphatase [Signal transduc | 100.0 | |
| KOG3531|consensus | 1036 | 100.0 | ||
| KOG4228|consensus | 1087 | 100.0 | ||
| PRK15375 | 535 | pathogenicity island 1 effector protein StpP; Prov | 100.0 | |
| KOG0789|consensus | 415 | 100.0 | ||
| KOG3529|consensus | 596 | 99.95 | ||
| cd00836 | 92 | FERM_C FERM_C domain. The FERM_C domain is the thi | 99.91 | |
| PF00373 | 126 | FERM_M: FERM central domain; InterPro: IPR019748 T | 99.86 | |
| PF09380 | 90 | FERM_C: FERM C-terminal PH-like domain; InterPro: | 99.8 | |
| smart00295 | 207 | B41 Band 4.1 homologues. Also known as ezrin/radix | 99.79 | |
| KOG4371|consensus | 1332 | 99.74 | ||
| KOG4261|consensus | 1003 | 99.24 | ||
| KOG0248|consensus | 936 | 99.08 | ||
| KOG4371|consensus | 1332 | 98.9 | ||
| KOG3531|consensus | 1036 | 98.59 | ||
| smart00012 | 105 | PTPc_DSPc Protein tyrosine phosphatase, catalytic | 98.45 | |
| smart00404 | 105 | PTPc_motif Protein tyrosine phosphatase, catalytic | 98.45 | |
| PF08736 | 47 | FA: FERM adjacent (FA); InterPro: IPR014847 This r | 97.98 | |
| KOG3552|consensus | 1298 | 97.76 | ||
| PTZ00242 | 166 | protein tyrosine phosphatase; Provisional | 97.56 | |
| KOG3527|consensus | 975 | 97.14 | ||
| KOG4257|consensus | 974 | 96.91 | ||
| KOG3727|consensus | 664 | 96.62 | ||
| cd00435 | 85 | ACBP Acyl CoA binding protein (ACBP) binds thiol e | 95.94 | |
| PTZ00393 | 241 | protein tyrosine phosphatase; Provisional | 95.85 | |
| PF00887 | 87 | ACBP: Acyl CoA binding protein; InterPro: IPR00058 | 95.3 | |
| cd00127 | 139 | DSPc Dual specificity phosphatases (DSP); Ser/Thr | 93.14 | |
| KOG3550|consensus | 207 | 91.67 | ||
| PTZ00458 | 90 | acyl CoA binding protein; Provisional | 91.21 | |
| KOG3784|consensus | 407 | 90.6 | ||
| COG4281 | 87 | ACB Acyl-CoA-binding protein [Lipid metabolism] | 90.18 | |
| KOG3549|consensus | 505 | 83.99 | ||
| KOG2836|consensus | 173 | 83.15 |
| >KOG0792|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-116 Score=1003.87 Aligned_cols=659 Identities=41% Similarity=0.601 Sum_probs=503.0
Q ss_pred CcEEEEEEEeeCCCCCccchHHHHHHHHHHHHHHHcCccccCHHHHHHHhhhhhhcccccchhhhhhhhhhccccccccc
Q psy17835 1 GNFYFRVKFYVSDPSKLQEEYTRYHFYLQIRKDILAHRLILAPSTACLLASYTVQCNTYISENFLSLEIMADTKLVWFSI 80 (702)
Q Consensus 1 ~~l~FrVKFyv~~p~~L~~e~tR~l~yLQlr~dil~grl~c~~~~a~~Laal~lQ~~~~~~~~~~~~~~~~~~~~~~~~~ 80 (702)
|.|+|||||||+||+.|+||.|||+||||+|+||++|||+|+.++|++||+|++|
T Consensus 96 p~l~frV~fyV~~p~~LqeE~TRyqyylQvK~di~eGrl~Ct~~qailLA~yavQ------------------------- 150 (1144)
T KOG0792|consen 96 PLLHFRVKFYVPDPSGLQEEATRYQYYLQVKKDILEGRLPCTLNQAILLASYAVQ------------------------- 150 (1144)
T ss_pred ceEEEEEEEEecChhHHHHHHHHHHHHHHHHHHHhccccCCchHHHHHHHHhhhh-------------------------
Confidence 5799999999999999999999999999999999999999999999999999999
Q ss_pred ccccCCCCCCCCCCC--CCCCCcCCCCCcH----HHHHHHHHHHHHhcCCCHHHHHHHHHHHhhcccCCCceEEeeecCC
Q psy17835 81 SAELGDYHPDEHKPG--YLSGLSLVPGQTE----EMELKIEELHKLHKGQSPADAEYNYLEHAKRCEMYGVSVHGAKDSQ 154 (702)
Q Consensus 81 ~ae~GDy~~~~~~~~--yl~~~~~~P~~~~----~~~~~I~~~Hk~~~G~t~~eAe~~yL~~a~~L~~YGv~~f~~kd~~ 154 (702)
||+|||+..++... |+..+.+.+.+.+ +++++|+++|++|+|++++|||++||++|++|++||+++|.+||..
T Consensus 151 -ae~gdy~~~~s~~~l~~~~~~p~~~~~~~n~~~e~~~kVa~lhQ~h~G~~~~eAE~~yi~~~~rlegyG~e~~~akD~~ 229 (1144)
T KOG0792|consen 151 -AEFGDYNQKQSQDGLEYLSVFPQCTLQDENVLEEFEQKVAELHQQHRGLLPAEAETNYINEAKRLEGYGEEFHRAKDLH 229 (1144)
T ss_pred -hhhcchhhhcCCccchhccccccccccchhhHHHHHHHHHHHHHHhcccCccHHHHHHHHHHHhhccccceecccccCC
Confidence 99999998777665 6666666666766 9999999999999999999999999999999999999999999999
Q ss_pred CCceEEeecCCcEEEee-CCeeeeeeccccccceEEeccEEEEEEccCCCCCCcceEEEEecChHHHHHHHHHHhhcccc
Q psy17835 155 DRDIQLGVTANGLVIFH-AGARLNLLSWVKIVKISFKRKQFFVQLKREPSENYDTLLGFNMTTYRSCKNLWKSCVEHHTF 233 (702)
Q Consensus 155 ~~~i~LGV~~~GI~v~~-~~~~~~~f~W~~I~klsf~~k~F~I~~~~~~~~~~~~~~~F~~~~~~~ak~Lw~~~ve~H~F 233 (702)
|.+|.|||+..||.|++ ++.+.+.|+|.+|.+++|+++.|.|+++++..+..++.+.|.|.+.+.||+|||+|+++|+|
T Consensus 230 g~~i~lGi~~~Gi~V~~~~g~~~~~~~W~di~~is~~ks~~~le~~~~~~~~r~t~~~F~~~~~~~ak~lwk~cv~~H~F 309 (1144)
T KOG0792|consen 230 GNDINLGIARVGILVPGQNGRQSVKFPWGDIIKISFKKSTFGLEQRNKDSESRETLLGFNMLDARTAKYLWKLCVEHHKF 309 (1144)
T ss_pred CcceeeeeeeceeEeeccCccccceechhhhhhhhcchhhhhhhhhhccccchhhhheeeecccchhHHHHHHHHHHhhH
Confidence 99999999999999998 67778899999999999999999999999888888999999999999999999999999999
Q ss_pred ccccCCCcCCCCC-----CCCCCCCCcccccccchHHHHHHHHhhhee-ccccCCCCC---ccceeeeecccccCCCCcc
Q psy17835 234 FRLHSPRRSRKFL-----PPPLSLGSKFFSSGRTEYQTYQQARRSVVL-INGCDVSGM---HHEQVVNIIRTSRDTHGEL 304 (702)
Q Consensus 234 fr~~~~~~~~~~~-----~~~~~~gs~f~y~grT~~q~~~~~~r~~~~-~~g~~~~~~---~~~~~~~~~~~s~~~~~~~ 304 (702)
||+.++...+... ...++.++.|++.++++.+..+..+++... ..|+.-..+ ..+....++++|.| .
T Consensus 310 fr~~~~~~lp~~~~~~~~~~~~~~ss~~~~~~y~~~~~~~~~~~~hys~~~~s~qd~l~~~~~~~s~~~~~tsld----~ 385 (1144)
T KOG0792|consen 310 FRLKKPCVLPSSSKSPIRRVQSSRSSLPEMQDYSEPQCKEPSRRDHYSESHGSGQDDLFTANANSSNSTSSTSLD----N 385 (1144)
T ss_pred hhccccccCCcccCCCcccccccccccccccccccccccchhhcccccccccccchhhhcccccccccccchhhh----h
Confidence 9999864433311 125677888999999998877765554432 112111111 11222223333333 2
Q ss_pred ceeecCCCcccccccccccc----------------CCCCC---CC--------cc------c--------------ccc
Q psy17835 305 VLTVRPNGKSRSTQRSIQIS----------------SDDNA---KS--------SR------S--------------LRY 337 (702)
Q Consensus 305 ~~~~~~~~~~~~~~~~~~~~----------------~~~~~---~~--------~~------~--------------~~~ 337 (702)
..+...+ +.+++.+|..++ +++.+ +| +| + ..+
T Consensus 386 m~gq~~s-~~~~s~~s~~s~~~~~~~~qa~~~~~n~~~~~~~~m~pdy~pa~~~sp~~~~~yr~~~~~~~~~~i~~~~~q 464 (1144)
T KOG0792|consen 386 MNGQAQS-GHVASLGSKNSLNCMRTYLQAVPNSKNFEDSGSDAMRPDYAPAPRYSPQSPLAYRPTVMKQLIRGIPHPDRQ 464 (1144)
T ss_pred hhccccc-ccccccCccccccccccccccCCCCCccccccccccCcccccccccccccccccCchhhHHhhhcCcchhhc
Confidence 2222212 344433332221 00000 00 11 1 112
Q ss_pred CCccccCCCCC---------------------CCCCC------CCCCCC------CC-----------------------
Q psy17835 338 DNKVTSLGSRE---------------------PKRAW------DPPHPS------DD----------------------- 361 (702)
Q Consensus 338 ~~~~~~~~~~~---------------------~~~~~------~~~~~~------~~----------------------- 361 (702)
.+|.+++++.. +.+++ .+++|. +.
T Consensus 465 ~~s~~~ln~~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~~p~~~~Pi~~~~~~~~~~~~~~~~~~~~ss 544 (1144)
T KOG0792|consen 465 SNSKRLLNDGGNHAESLPLEIREEHGYPGPAVPKGNQSLYVHDVSRSPAKSPGPRSPIKVNVSDPELMNHQLQNLNRASS 544 (1144)
T ss_pred cccccccccccccccccchhhhhcccCCCccccccccceecccccCCCCCCCCCCCCccccccchhhhcccchhhccccc
Confidence 25666666411 11111 011221 00
Q ss_pred ----CCCCCC-CCCCCCcc------cc--------------------cCccCCCCCcccCC----------------C--
Q psy17835 362 ----EGGFLD-KPPPGSAK------LE--------------------EGEEAGPAIRTTEP----------------G-- 392 (702)
Q Consensus 362 ----~~~~~~-~p~~~~~~------~~--------------------~~~~~~~~~~~~~~----------------~-- 392 (702)
...+++ +|++.|++ +. -.++| +++.++.. +
T Consensus 545 ~~~~~~~~r~~~~~~~P~~ags~PDl~r~~~~sg~s~~~~~~~~~~sv~t~q-~ds~~~a~~~~~~~~~~~ie~~~mS~~ 623 (1144)
T KOG0792|consen 545 KTVRLVIFRPPPPYPRPRSAGSLPDLTRHKYKSGSSPDLVTDGVYQSVQTSQ-EDSMPVAAQELTLQKLNSIEVVNMSPG 623 (1144)
T ss_pred ccccceeecCCCCCCCCCCCCCCcchhhhhcccCCCcccccccccccccccC-CCcchhhhhhhhhccccceeeeccchh
Confidence 002222 33333322 10 01222 11111100 0
Q ss_pred ---------------------CCCc----CCcccccc----------c--------------cccCcccccCCCEEEEEc
Q psy17835 393 ---------------------PAAI----LPARTTLN----------F--------------VDDDVEEDLEEGLVLIRI 423 (702)
Q Consensus 393 ---------------------~~~~----~~~~~~~~----------~--------------~~~~~~~~~~~~~~~~~~ 423 (702)
.|.+ .+..++.+ + ..+.++.-.+..++.|++
T Consensus 624 ~e~~~~~~~als~v~~~ts~~lpp~~~~q~~~p~s~~~~~~~~~~~~~~~at~l~ss~~a~~~e~~~~~S~~~~~v~ir~ 703 (1144)
T KOG0792|consen 624 LETLIEKNRALSAVPKATSRGLPPSVRSQVSGPHSTPGNGSYGSKSPFSDATMLGSSSEAVEEEEINEESSKPQLVPIRA 703 (1144)
T ss_pred hhhhhhccchhhhcCcccccCCCCCcccccCCCCCCCCccccccccccccccCCCCccccccccccccccCCCcceeecc
Confidence 0000 00001111 0 011222222355999999
Q ss_pred CCCC-------CCCCccccCCCCCCC-----CceEEEeee-------------cCC--CCCcc--------ccc------
Q psy17835 424 APDE-------QGRFGFNVKGGADLG-----MPILVVRGR-------------RRG--GRGAP--------LPI------ 462 (702)
Q Consensus 424 ~~~~-------~g~~~f~~~g~~~~~-----~~~~vs~~~-------------~~~--~~~~p--------~~i------ 462 (702)
+||+ .|+||||+|||.||. +|++|+||+ |++ |+|.| ++|
T Consensus 704 ~pd~~~~~~~~~g~~g~~~~g~~dq~~~~~~~p~a~sRv~~~~p~~~~~~~~~p~s~~d~~~P~~~e~dq~~~ingr~~~ 783 (1144)
T KOG0792|consen 704 RPDESYLAEDPPGRFGFNLKGGLDQLQNLLNEPVAVSRVAGPGPLKMNGKLSEPESTADDCTPRLNEGDQVTSINGRDVS 783 (1144)
T ss_pred CCcccccccCCCccccccccchhhhhhccccccHHHHhhcccccchhcccccCCCCCccccccCCCcccceeeecccccc
Confidence 9999 999999999999999 999999999 887 89999 234
Q ss_pred ---ccceeeccCCcccccccCCC-------------------------------CCCCC-----CCCC------------
Q psy17835 463 ---RTRVFTSRGGLNARQCRGPV-------------------------------PVDAP-----VGGW------------ 491 (702)
Q Consensus 463 ---~~~~~~~~~~~~i~~~~~~~-------------------------------p~~~~-----~~~~------------ 491 (702)
|+++| +||++.++++ |++.. +++.
T Consensus 784 ~~~~~~~v-----s~irs~r~~~~s~e~~l~~~~~~~~~~~~~e~~~~~~~~l~~~~la~~~~~~~~~~~~~r~~~dks~ 858 (1144)
T KOG0792|consen 784 ESEHDQVV-----SLIRSPRENITSGELMLTGRPNAPRERLKAEDSDEPLSQLVPESLAVDSVVEELDSGATRASLDKSC 858 (1144)
T ss_pred cccccchH-----HHHhhhhhccccccccccCCccccchhhhccccCCchhhhCCccccccCccccCcccccccchhhHH
Confidence 99999 9999999831 11100 1111
Q ss_pred ------cchHHHHHHHHHHhccCCCCccccccccccccCCCCCCCCcCCCceeeccCCCC--CCceEeeeecccCCCCCc
Q psy17835 492 ------TGEWALVAQFERLYRKKPGLSMLHANKQENVIKNRYRDISPYDATRVVLHEAPD--GDYINANTVAMEIPGSGI 563 (702)
Q Consensus 492 ------~g~~~l~~EFe~L~~~~~~~~~~~a~~~~N~~KNRy~dIlPyD~tRV~L~~~~~--~dYINAsyI~~~i~g~~~ 563 (702)
+.+++++.|||+|+++++++.+++|++++|..||||+||+|||.|||.|.+..+ ..|||||+|. ||-.+.
T Consensus 859 ~~L~~~L~~g~v~~efE~i~rkkp~~~~~~a~lpeN~~KNRyrdvlPYD~tRV~L~~~~~~nagYINAS~i~--ipvgg~ 936 (1144)
T KOG0792|consen 859 IILAQGLEDGMVFTEFEQIYRKKPGMACSIARLPENAPKNRYRDVLPYDDTRVELQPSKDNNAGYINASHIE--IPVGGI 936 (1144)
T ss_pred HHHHhhhhcCchHHHHHHHhhhCCCceeeeccccccccccccCCcCCCcCceeeeccCCCCCcccccceeeE--eeecce
Confidence 147889999999999999999999999999999999999999999999998643 4899999987 555567
Q ss_pred ccceeeecCCCccchhhhhHHhhhccceeEEEEeeeeecCccccccccCCC-CCeeEecCceEEEEEeeeeecCCCCEEE
Q psy17835 564 VNRYIATQGPLASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPSL-GETLELSGGRFNISCAKEEADPSGSFVF 642 (702)
Q Consensus 564 ~~~yIaTQ~Pl~~T~~DFWrMVwe~~v~~IVMLt~~~E~g~~kC~qYWP~~-g~~~~~g~g~~~V~~~~~~~~~~~~y~~ 642 (702)
.+.||||||||++||.|||+||||+++.+|||||+..|+|+.||+||||.. .++++||. |.|+|..+..... |++
T Consensus 937 e~~YIA~QGPLp~T~~DFWQMVWEQ~~~lIvMlT~e~EggR~KchqYWPr~~~~t~~ygr--f~v~~~~~~~t~~--y~t 1012 (1144)
T KOG0792|consen 937 ENRYIACQGPLPHTCTDFWQMVWEQGSTLIVMLTTEVEGGRVKCHQYWPRLGHETMEYGR--FQVTCVFEQQTTC--YVT 1012 (1144)
T ss_pred eEEEEEecCCCcchHHHHHHHHHhcCceEEEEEeehhhcCeeccccccCCCCccceeccc--eEEEEEEeccccc--EEE
Confidence 899999999999999999999999999999999999999999999999987 67888988 9999999877766 999
Q ss_pred EEEEEEECCCCceEEEEEEEECCCCCCCCCCChHHHHHHHHHHHHHcCCCCCcEEEEcCC
Q psy17835 643 REFVLRDSQTGEKRDVTQMQYLAWPDHGVPDDVNRFLAFTRQVRHERAGMVEPAIVHCSA 702 (702)
Q Consensus 643 R~L~I~~~~~~~~r~Vth~qy~~WPd~gvP~~~~~~L~fl~~Vr~~~~~~~~PIVVHCSA 702 (702)
|+|+|.+..++++|+|||+||++|||||+|+++.+||+|+++|+..+.+.+.||||||||
T Consensus 1013 r~m~l~~~~t~eeR~V~hLQYtaWPDHg~P~D~~~FL~FleevrsvR~~t~pPilvHCSA 1072 (1144)
T KOG0792|consen 1013 REMTLKDLQTREERTVWHLQYTAWPDHGVPDDPNDFLDFLEEVRSVRRGTNPPILVHCSA 1072 (1144)
T ss_pred EeEEEeeccCCceeeeeeeeecccccCCCCCChHHHHHHHHHHHHHhccCCCCeEEEccC
Confidence 999999999999999999999999999999999999999999999998878899999998
|
|
| >KOG3530|consensus | Back alignment and domain information |
|---|
| >KOG3527|consensus | Back alignment and domain information |
|---|
| >PHA02742 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02747 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02740 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02746 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PHA02738 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >smart00194 PTPc Protein tyrosine phosphatase, catalytic domain | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG0793|consensus | Back alignment and domain information |
|---|
| >cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways | Back alignment and domain information |
|---|
| >KOG0791|consensus | Back alignment and domain information |
|---|
| >PF00102 Y_phosphatase: Protein-tyrosine phosphatase; InterPro: IPR000242 Protein tyrosine (pTyr) phosphorylation is a common post-translational modification which can create novel recognition motifs for protein interactions and cellular localisation, affect protein stability, and regulate enzyme activity | Back alignment and domain information |
|---|
| >COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PRK15375 pathogenicity island 1 effector protein StpP; Provisional | Back alignment and domain information |
|---|
| >KOG0789|consensus | Back alignment and domain information |
|---|
| >KOG3529|consensus | Back alignment and domain information |
|---|
| >cd00836 FERM_C FERM_C domain | Back alignment and domain information |
|---|
| >PF00373 FERM_M: FERM central domain; InterPro: IPR019748 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >PF09380 FERM_C: FERM C-terminal PH-like domain; InterPro: IPR018980 The FERM domain (F for 4 | Back alignment and domain information |
|---|
| >smart00295 B41 Band 4 | Back alignment and domain information |
|---|
| >KOG4371|consensus | Back alignment and domain information |
|---|
| >KOG4261|consensus | Back alignment and domain information |
|---|
| >KOG0248|consensus | Back alignment and domain information |
|---|
| >KOG4371|consensus | Back alignment and domain information |
|---|
| >KOG3531|consensus | Back alignment and domain information |
|---|
| >smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity | Back alignment and domain information |
|---|
| >smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif | Back alignment and domain information |
|---|
| >PF08736 FA: FERM adjacent (FA); InterPro: IPR014847 This region is found adjacent to Band 4 | Back alignment and domain information |
|---|
| >KOG3552|consensus | Back alignment and domain information |
|---|
| >PTZ00242 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG3527|consensus | Back alignment and domain information |
|---|
| >KOG4257|consensus | Back alignment and domain information |
|---|
| >KOG3727|consensus | Back alignment and domain information |
|---|
| >cd00435 ACBP Acyl CoA binding protein (ACBP) binds thiol esters of long fatty acids and coenzyme A in a one-to-one binding mode with high specificity and affinity | Back alignment and domain information |
|---|
| >PTZ00393 protein tyrosine phosphatase; Provisional | Back alignment and domain information |
|---|
| >PF00887 ACBP: Acyl CoA binding protein; InterPro: IPR000582 Acyl-CoA-binding protein (ACBP) is a small (10 Kd) protein that binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters [] | Back alignment and domain information |
|---|
| >cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases | Back alignment and domain information |
|---|
| >KOG3550|consensus | Back alignment and domain information |
|---|
| >PTZ00458 acyl CoA binding protein; Provisional | Back alignment and domain information |
|---|
| >KOG3784|consensus | Back alignment and domain information |
|---|
| >COG4281 ACB Acyl-CoA-binding protein [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
| >KOG2836|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 702 | ||||
| 2i75_A | 320 | Crystal Structure Of Human Protein Tyrosine Phospha | 3e-62 | ||
| 2b49_A | 287 | Crystal Structure Of The Catalytic Domain Of Protei | 6e-56 | ||
| 1gg3_A | 279 | Crystal Structure Of The Protein 4.1r Membrane Bind | 1e-52 | ||
| 3qij_A | 296 | Primitive-Monoclinic Crystal Structure Of The Ferm | 1e-52 | ||
| 3bin_A | 283 | Structure Of The Dal-1 And Tslc1 (372-383) Complex | 6e-52 | ||
| 2he7_A | 283 | Ferm Domain Of Epb41l3 (Dal-1) Length = 283 | 6e-52 | ||
| 2c7s_A | 313 | Crystal Structure Of Human Protein Tyrosine Phospha | 1e-35 | ||
| 1wch_A | 315 | Crystal Structure Of Ptpl1 Human Tyrosine Phosphata | 5e-34 | ||
| 2shp_A | 525 | Tyrosine Phosphatase Shp-2 Length = 525 | 6e-34 | ||
| 3b7o_A | 316 | Crystal Structure Of The Human Tyrosine Phosphatase | 8e-34 | ||
| 3o5x_A | 276 | Crystal Structure Of The Oncogenic Tyrosine Phospha | 1e-33 | ||
| 2nv5_A | 299 | Crystal Structure Of A C-Terminal Phosphatase Domai | 2e-33 | ||
| 1lar_A | 575 | Crystal Structure Of The Tandem Phosphatase Domains | 2e-33 | ||
| 2fh7_A | 595 | Crystal Structure Of The Phosphatase Domains Of Hum | 4e-33 | ||
| 2pi7_A | 312 | Structure Of The Catalytic Domain Of The Chick Reti | 8e-33 | ||
| 3sr9_A | 583 | Crystal Structure Of Mouse Ptpsigma Length = 583 | 1e-32 | ||
| 1rpm_A | 278 | Human Receptor Protein Tyrosine Phosphatase Mu, Dom | 3e-31 | ||
| 2qep_A | 304 | Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2be | 4e-31 | ||
| 2ooq_A | 286 | Crystal Structure Of The Human Receptor Phosphatase | 4e-31 | ||
| 2fjm_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 2e-30 | ||
| 1bzj_A | 297 | Human Ptp1b Complexed With Tpicooh Length = 297 | 2e-30 | ||
| 1bzc_A | 321 | Human Ptp1b Catalytic Domain Complexed With Tpi Len | 2e-30 | ||
| 2cma_A | 327 | Structural Basis For Inhibition Of Protein Tyrosine | 2e-30 | ||
| 1nl9_A | 321 | Potent, Selective Protein Tyrosine Phosphatase 1b I | 2e-30 | ||
| 2azr_A | 299 | Crystal Structure Of Ptp1b With Bicyclic Thiophene | 2e-30 | ||
| 2nt7_A | 299 | Crystal Structure Of Ptp1b-inhibitor Complex Length | 2e-30 | ||
| 1bzh_A | 298 | Cyclic Peptide Inhibitor Of Human Ptp1b Length = 29 | 2e-30 | ||
| 1g7g_A | 298 | Human Ptp1b Catalytic Domain Complexes With Pnu1793 | 2e-30 | ||
| 2cm2_A | 304 | Structure Of Protein Tyrosine Phosphatase 1b (P2121 | 2e-30 | ||
| 3sme_A | 300 | Structure Of Ptp1b Inactivated By H2o2BICARBONATE L | 2e-30 | ||
| 1g7f_A | 298 | Human Ptp1b Catalytic Domain Complexed With Pnu1774 | 2e-30 | ||
| 1lqf_A | 295 | Structure Of Ptp1b In Complex With A Peptidic Bisph | 2e-30 | ||
| 3cwe_A | 290 | Ptp1b In Complex With A Phosphonic Acid Inhibitor L | 2e-30 | ||
| 2f6f_A | 302 | The Structure Of The S295f Mutant Of Human Ptp1b Le | 2e-30 | ||
| 1q6j_A | 310 | The Structure Of Phosphotyrosine Phosphatase 1b In | 2e-30 | ||
| 3qcl_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 2e-30 | ||
| 2i1y_A | 301 | Crystal Structure Of The Phosphatase Domain Of Huma | 2e-30 | ||
| 1l8g_A | 321 | Crystal Structure Of Ptp1b Complexed With 7-(1,1-di | 2e-30 | ||
| 4i8n_A | 354 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-30 | ||
| 1ecv_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 2e-30 | ||
| 2oc3_A | 303 | Crystal Structure Of The Catalytic Domain Of Human | 3e-30 | ||
| 2h02_A | 313 | Structural Studies Of Protein Tyrosine Phosphatase | 3e-30 | ||
| 2ahs_A | 295 | Crystal Structure Of The Catalytic Domain Of Human | 4e-30 | ||
| 2h4v_A | 320 | Crystal Structure Of The Human Tyrosine Receptor Ph | 6e-30 | ||
| 2pbn_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 6e-30 | ||
| 3qcb_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 6e-30 | ||
| 3qcm_A | 310 | Human Receptor Protein Tyrosine Phosphatase Gamma, | 7e-30 | ||
| 1nwl_A | 298 | Crystal Structure Of The Ptp1b Complexed With Sp734 | 7e-30 | ||
| 2nlk_A | 627 | Crystal Structure Of D1 And D2 Catalytic Domains Of | 7e-30 | ||
| 3i36_A | 342 | Crystal Structure Of Rat Protein Tyrosine Phosphata | 7e-30 | ||
| 2gjt_A | 295 | Crystal Structure Of The Human Receptor Phosphatase | 9e-30 | ||
| 2g59_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 9e-30 | ||
| 1gwz_A | 299 | Crystal Structure Of The Catalytic Domain Of The Pr | 1e-29 | ||
| 2b3o_A | 532 | Crystal Structure Of Human Tyrosine Phosphatase Shp | 1e-29 | ||
| 4gs0_A | 308 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 1e-29 | ||
| 2h03_A | 291 | Structural Studies Of Protein Tyrosine Phosphatase | 1e-29 | ||
| 2qcj_A | 313 | Native Structure Of Lyp Length = 313 | 1e-29 | ||
| 3h2x_A | 302 | Crystal Structure Of The Human Lymphoid Tyrosine Ph | 2e-29 | ||
| 2p6x_A | 309 | Crystal Structure Of Human Tyrosine Phosphatase Ptp | 2e-29 | ||
| 3qkp_A | 321 | Protein Tyrosine Phosphatase 1b - Apo W179f Mutant | 2e-29 | ||
| 1een_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 3e-29 | ||
| 1aax_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 3e-29 | ||
| 1g1f_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 3e-29 | ||
| 1i57_A | 310 | Crystal Structure Of Apo Human Ptp1b (C215s) Mutant | 3e-29 | ||
| 1a5y_A | 330 | Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate | 4e-29 | ||
| 1oeo_X | 321 | Ptp1b With The Catalytic Cysteine Oxidized To Sulfo | 4e-29 | ||
| 1ptv_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 4e-29 | ||
| 3eu0_A | 327 | Crystal Structure Of The S-Nitrosylated Cys215 Of P | 4e-29 | ||
| 1ptu_A | 321 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 4e-29 | ||
| 3a5k_A | 304 | Crystal Structure Of Protein-Tyrosine Phosphatase 1 | 4e-29 | ||
| 3zv2_A | 320 | Human Protein-Tyrosine Phosphatase 1b C215a, S216a | 5e-29 | ||
| 1pa1_A | 310 | Crystal Structure Of The C215d Mutant Of Protein Ty | 6e-29 | ||
| 1gfy_A | 298 | Residue 259 Is A Key Determinant Of Substrate Speci | 7e-29 | ||
| 1c86_A | 298 | Crystal Structure Of Protein Tyrosine Phosphatase 1 | 8e-29 | ||
| 3ps5_A | 595 | Crystal Structure Of The Full-Length Human Protein | 1e-28 | ||
| 2bzl_A | 325 | Crystal Structure Of The Human Protein Tyrosine Pho | 2e-28 | ||
| 1fpr_A | 284 | Crystal Structure Of The Complex Formed Between The | 2e-28 | ||
| 4gry_A | 288 | Crystal Structure Of Shp1 Catalytic Domain With Jak | 2e-28 | ||
| 2nz6_A | 316 | Crystal Structure Of The Ptprj Inactivating Mutant | 3e-28 | ||
| 3olr_A | 313 | Ptpn22 In Complex With Consensus Phospho-Tyrosine P | 3e-28 | ||
| 2hy3_A | 313 | Crystal Structure Of The Human Tyrosine Receptor Ph | 3e-28 | ||
| 1l8k_A | 314 | T Cell Protein-Tyrosine Phosphatase Structure Lengt | 6e-28 | ||
| 2cfv_A | 316 | Crystal Structure Of Human Protein Tyrosine Phospha | 7e-28 | ||
| 3brh_A | 310 | Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To | 3e-27 | ||
| 2jjd_A | 599 | Protein Tyrosine Phosphatase, Receptor Type, E Isof | 6e-27 | ||
| 1yfo_A | 302 | Receptor Protein Tyrosine Phosphatase Alpha, Domain | 1e-26 | ||
| 3s3e_A | 307 | Crystal Structure Of The Catalytic Domain Of Ptp10d | 1e-25 | ||
| 1ygr_A | 610 | Crystal Structure Of The Tandem Phosphatase Domain | 4e-25 | ||
| 1p15_A | 253 | Crystal Structure Of The D2 Domain Of Rptpa Length | 4e-24 | ||
| 2gp0_A | 309 | Heptp Catalytic Domain (Residues 44-339), S225d Mut | 5e-24 | ||
| 2a3k_A | 296 | Crystal Structure Of The Human Protein Tyrosine Pho | 2e-23 | ||
| 1zc0_A | 309 | Crystal Structure Of Human Hematopoietic Tyrosine P | 2e-23 | ||
| 3o4s_A | 308 | Crystal Structure Of Heptp With A Closed Wpd Loop A | 3e-23 | ||
| 2pa5_A | 314 | Crystal Structure Of Human Protein Tyrosine Phospha | 5e-23 | ||
| 3d42_A | 308 | Crystal Structure Of Heptp In Complex With A Monoph | 6e-23 | ||
| 2qdc_A | 309 | Crystal Structure Of The Heptp Catalytic Domain D23 | 2e-22 | ||
| 2hvl_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 4e-22 | ||
| 2qdm_A | 309 | Crystal Structure Of The Heptp Catalytic Domain C27 | 3e-21 | ||
| 2emt_A | 322 | Crystal Structure Analysis Of The Radixin Ferm Doma | 4e-21 | ||
| 2zpy_A | 312 | Crystal Structure Of The Mouse Radxin Ferm Domain C | 5e-21 | ||
| 1j19_A | 317 | Crystal Structure Of The Radxin Ferm Domain Complex | 6e-21 | ||
| 2d10_A | 312 | Crystal Structure Of The Radixin Ferm Domain Comple | 6e-21 | ||
| 2d2q_A | 310 | Crystal Structure Of The Dimerized Radixin Ferm Dom | 6e-21 | ||
| 1gc6_A | 297 | Crystal Structure Of The Radixin Ferm Domain Comple | 7e-21 | ||
| 1h4r_A | 314 | Crystal Structure Of The Ferm Domain Of Merlin, The | 8e-21 | ||
| 1h4r_B | 314 | Crystal Structure Of The Ferm Domain Of Merlin, The | 9e-21 | ||
| 3u8z_A | 300 | Human Merlin Ferm Domain Length = 300 | 9e-21 | ||
| 1isn_A | 323 | Crystal Structure Of Merlin Ferm Domain Length = 32 | 2e-20 | ||
| 1sgh_A | 297 | Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptid | 2e-20 | ||
| 1e5w_A | 346 | Structure Of Isolated Ferm Domain And First Long He | 2e-20 | ||
| 1ni2_A | 296 | Structure Of The Active Ferm Domain Of Ezrin Length | 3e-20 | ||
| 4az1_A | 302 | Crystal Structure Of The Trypanosoma Cruzi Protein | 9e-20 | ||
| 2rq1_A | 109 | Solution Structure Of The 4.1r Ferm Alpha Lobe Doma | 2e-19 | ||
| 1ef1_A | 294 | Crystal Structure Of The Moesin Ferm DomainTAIL DOM | 2e-19 | ||
| 2a8b_A | 283 | Crystal Structure Of The Catalytic Domain Of Human | 3e-19 | ||
| 1jln_A | 297 | Crystal Structure Of The Catalytic Domain Of Protei | 4e-19 | ||
| 2bij_A | 305 | Crystal Structure Of The Human Protein Tyrosine Pho | 1e-18 | ||
| 2i1j_A | 575 | Moesin From Spodoptera Frugiperda At 2.1 Angstroms | 6e-18 | ||
| 2cjz_A | 305 | Crystal Structure Of The C472s Mutant Of Human Prot | 2e-17 | ||
| 2bv5_A | 282 | Crystal Structure Of The Human Protein Tyrosine Pho | 3e-17 | ||
| 3m4u_A | 306 | Crystal Structure Of Trypanosoma Brucei Protein Tyr | 2e-15 | ||
| 2vph_A | 100 | Crystal Structure Of The Human Protein Tyrosine Pho | 8e-05 | ||
| 2cs5_A | 119 | Solution Structure Of Pdz Domain Of Protein Tyrosin | 1e-04 | ||
| 3nfk_A | 107 | Crystal Structure Of The Ptpn4 Pdz Domain Complexed | 1e-04 |
| >pdb|2I75|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase N4 (Ptpn4) Length = 320 | Back alignment and structure |
|
| >pdb|2B49|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 3 Length = 287 | Back alignment and structure |
| >pdb|1GG3|A Chain A, Crystal Structure Of The Protein 4.1r Membrane Binding Domain Length = 279 | Back alignment and structure |
| >pdb|3QIJ|A Chain A, Primitive-Monoclinic Crystal Structure Of The Ferm Domain Of Protein 4.1r Length = 296 | Back alignment and structure |
| >pdb|3BIN|A Chain A, Structure Of The Dal-1 And Tslc1 (372-383) Complex Length = 283 | Back alignment and structure |
| >pdb|2HE7|A Chain A, Ferm Domain Of Epb41l3 (Dal-1) Length = 283 | Back alignment and structure |
| >pdb|2C7S|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Kappa At 1.95a Resolution Length = 313 | Back alignment and structure |
| >pdb|1WCH|A Chain A, Crystal Structure Of Ptpl1 Human Tyrosine Phosphatase Mutated In Colorectal Cancer - Evidence For A Second Phosphotyrosine Substrate Recognition Pocket Length = 315 | Back alignment and structure |
| >pdb|2SHP|A Chain A, Tyrosine Phosphatase Shp-2 Length = 525 | Back alignment and structure |
| >pdb|3B7O|A Chain A, Crystal Structure Of The Human Tyrosine Phosphatase Shp2 (Ptpn11) With An Accessible Active Site Length = 316 | Back alignment and structure |
| >pdb|3O5X|A Chain A, Crystal Structure Of The Oncogenic Tyrosine Phosphatase Shp2 Complexed With A Salicylic Acid-Based Small Molecule Inhibitor Length = 276 | Back alignment and structure |
| >pdb|2NV5|A Chain A, Crystal Structure Of A C-Terminal Phosphatase Domain Of Rattus Norvegicus Ortholog Of Human Protein Tyrosine Phosphatase, Receptor Type, D (Ptprd) Length = 299 | Back alignment and structure |
| >pdb|1LAR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domains Of Rptp Lar Length = 575 | Back alignment and structure |
| >pdb|2FH7|A Chain A, Crystal Structure Of The Phosphatase Domains Of Human Ptp Sigma Length = 595 | Back alignment and structure |
| >pdb|2PI7|A Chain A, Structure Of The Catalytic Domain Of The Chick Retinal Neurite Inhibitor-Receptor Protein Tyrosine Phosphatase Cryp-2CPTPRO Length = 312 | Back alignment and structure |
| >pdb|3SR9|A Chain A, Crystal Structure Of Mouse Ptpsigma Length = 583 | Back alignment and structure |
| >pdb|1RPM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Mu, Domain 1 Length = 278 | Back alignment and structure |
| >pdb|2QEP|A Chain A, Crystal Structure Of The D1 Domain Of Ptprn2 (Ia2beta) Length = 304 | Back alignment and structure |
| >pdb|2OOQ|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptprt Length = 286 | Back alignment and structure |
| >pdb|2FJM|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh Length = 297 | Back alignment and structure |
| >pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi Length = 321 | Back alignment and structure |
| >pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate Mimetics Length = 327 | Back alignment and structure |
| >pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor Compound 12 Using A Linked-Fragment Strategy Length = 321 | Back alignment and structure |
| >pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor Length = 299 | Back alignment and structure |
| >pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex Length = 299 | Back alignment and structure |
| >pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b Length = 298 | Back alignment and structure |
| >pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326 Length = 298 | Back alignment and structure |
| >pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121) Length = 304 | Back alignment and structure |
| >pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE Length = 300 | Back alignment and structure |
| >pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496 Length = 298 | Back alignment and structure |
| >pdb|1LQF|A Chain A, Structure Of Ptp1b In Complex With A Peptidic Bisphosphonate Inhibitor Length = 295 | Back alignment and structure |
| >pdb|3CWE|A Chain A, Ptp1b In Complex With A Phosphonic Acid Inhibitor Length = 290 | Back alignment and structure |
| >pdb|2F6F|A Chain A, The Structure Of The S295f Mutant Of Human Ptp1b Length = 302 | Back alignment and structure |
| >pdb|1Q6J|A Chain A, The Structure Of Phosphotyrosine Phosphatase 1b In Complex With Compound 2 Length = 310 | Back alignment and structure |
| >pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- Yl)benzoic Acid Length = 310 | Back alignment and structure |
| >pdb|2I1Y|A Chain A, Crystal Structure Of The Phosphatase Domain Of Human Ptp Ia-2 Length = 301 | Back alignment and structure |
| >pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid Length = 321 | Back alignment and structure |
| >pdb|4I8N|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b In Complex With An Inhibitor [(4-{(2s)-2-(1,3-Benzoxazol-2-Yl)-2-[(4-Fluorophenyl) Sulfamoyl]ethyl}phenyl)amino](Oxo)acetic Acid Length = 354 | Back alignment and structure |
| >pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid Length = 298 | Back alignment and structure |
| >pdb|2OC3|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Protein Tyrosine Phosphatase Non-Receptor Type 18 Length = 303 | Back alignment and structure |
| >pdb|2H02|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 313 | Back alignment and structure |
| >pdb|2AHS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Receptor Phosphatase Beta Length = 295 | Back alignment and structure |
| >pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase Gamma Length = 320 | Back alignment and structure |
| >pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma Length = 313 | Back alignment and structure |
| >pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, Apo Length = 310 | Back alignment and structure |
| >pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- (Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic Acid Length = 310 | Back alignment and structure |
| >pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, A Ptyr Mimetic Length = 298 | Back alignment and structure |
| >pdb|2NLK|A Chain A, Crystal Structure Of D1 And D2 Catalytic Domains Of Human Protein Tyrosine Phosphatase Gamma (D1+d2 Ptprg) Length = 627 | Back alignment and structure |
| >pdb|3I36|A Chain A, Crystal Structure Of Rat Protein Tyrosine Phosphatase Eta Catalytic Domain Length = 342 | Back alignment and structure |
| >pdb|2GJT|A Chain A, Crystal Structure Of The Human Receptor Phosphatase Ptpro Length = 295 | Back alignment and structure |
| >pdb|2G59|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase From Homo Sapiens Length = 297 | Back alignment and structure |
| >pdb|1GWZ|A Chain A, Crystal Structure Of The Catalytic Domain Of The Protein Tyrosine Phosphatase Shp-1 Length = 299 | Back alignment and structure |
| >pdb|2B3O|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Shp-1 Length = 532 | Back alignment and structure |
| >pdb|4GS0|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 308 | Back alignment and structure |
| >pdb|2H03|A Chain A, Structural Studies Of Protein Tyrosine Phosphatase Beta Catalytic Domain In Complex With Inhibitors Length = 291 | Back alignment and structure |
| >pdb|2QCJ|A Chain A, Native Structure Of Lyp Length = 313 | Back alignment and structure |
| >pdb|3H2X|A Chain A, Crystal Structure Of The Human Lymphoid Tyrosine Phosphatase Catalytic Domain Length = 302 | Back alignment and structure |
| >pdb|2P6X|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase Ptpn22 Length = 309 | Back alignment and structure |
| >pdb|3QKP|A Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f Mutant With Open Wpd-Loop Length = 321 | Back alignment and structure |
| >pdb|1EEN|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Acetyl-D-A-D-Bpa-Ptyr-L-I-P-Q-Q-G Length = 321 | Back alignment and structure |
| >pdb|1AAX|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Two Bis(Para-Phosphophenyl)methane (Bppm) Molecules Length = 321 | Back alignment and structure |
| >pdb|1G1F|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With A Tri-Phosphorylated Peptide (Rdi(Ptr) Etd(Ptr)(Ptr)rk) From The Insulin Receptor Kinase Length = 298 | Back alignment and structure |
| >pdb|1I57|A Chain A, Crystal Structure Of Apo Human Ptp1b (C215s) Mutant Length = 310 | Back alignment and structure |
| >pdb|1A5Y|A Chain A, Protein Tyrosine Phosphatase 1b Cysteinyl-Phosphate Intermediate Length = 330 | Back alignment and structure |
| >pdb|1OEO|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To Sulfonic Acid Length = 321 | Back alignment and structure |
| >pdb|1PTV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine Length = 321 | Back alignment and structure |
| >pdb|3EU0|A Chain A, Crystal Structure Of The S-Nitrosylated Cys215 Of Ptp1b Length = 327 | Back alignment and structure |
| >pdb|1PTU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b Complexed With Phosphotyrosine-Containing Hexa-Peptide (Dadepyl-Nh2) Length = 321 | Back alignment and structure |
| >pdb|3A5K|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b Length = 304 | Back alignment and structure |
| >pdb|3ZV2|A Chain A, Human Protein-Tyrosine Phosphatase 1b C215a, S216a Mutant Length = 320 | Back alignment and structure |
| >pdb|1PA1|A Chain A, Crystal Structure Of The C215d Mutant Of Protein Tyrosine Phosphatase 1b Length = 310 | Back alignment and structure |
| >pdb|1GFY|A Chain A, Residue 259 Is A Key Determinant Of Substrate Specificity Of Protein-Tyrosine Phosphatase 1b And Alpha Length = 298 | Back alignment and structure |
| >pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b (R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- Thieno[2,3-C]pyran-3-Carboxylic Acid Length = 298 | Back alignment and structure |
| >pdb|3PS5|A Chain A, Crystal Structure Of The Full-Length Human Protein Tyrosine Phosphatase Shp-1 Length = 595 | Back alignment and structure |
| >pdb|2BZL|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase N14 At 1.65 A Resolution Length = 325 | Back alignment and structure |
| >pdb|1FPR|A Chain A, Crystal Structure Of The Complex Formed Between The Catalytic Domain Of Shp-1 And An In Vitro Peptide Substrate Py469 Derived From Shps-1 Length = 284 | Back alignment and structure |
| >pdb|4GRY|A Chain A, Crystal Structure Of Shp1 Catalytic Domain With Jak1 Activation Loop Peptide Length = 288 | Back alignment and structure |
| >pdb|2NZ6|A Chain A, Crystal Structure Of The Ptprj Inactivating Mutant C1239s Length = 316 | Back alignment and structure |
| >pdb|3OLR|A Chain A, Ptpn22 In Complex With Consensus Phospho-Tyrosine Peptide 1 Length = 313 | Back alignment and structure |
| >pdb|2HY3|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate Gamma In Complex With Vanadate Length = 313 | Back alignment and structure |
| >pdb|1L8K|A Chain A, T Cell Protein-Tyrosine Phosphatase Structure Length = 314 | Back alignment and structure |
| >pdb|2CFV|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Receptor Type J Length = 316 | Back alignment and structure |
| >pdb|3BRH|A Chain A, Protein Tyrosine Phosphatase Ptpn-22 (Lyp) Bound To The Mono-Phosphorylated Lck Active Site Peptide Length = 310 | Back alignment and structure |
| >pdb|2JJD|A Chain A, Protein Tyrosine Phosphatase, Receptor Type, E Isoform Length = 599 | Back alignment and structure |
| >pdb|1YFO|A Chain A, Receptor Protein Tyrosine Phosphatase Alpha, Domain 1 From Mouse Length = 302 | Back alignment and structure |
| >pdb|3S3E|A Chain A, Crystal Structure Of The Catalytic Domain Of Ptp10d From Drosophila Melanogaster Length = 307 | Back alignment and structure |
| >pdb|1YGR|A Chain A, Crystal Structure Of The Tandem Phosphatase Domain Of Rptp Cd45 Length = 610 | Back alignment and structure |
| >pdb|1P15|A Chain A, Crystal Structure Of The D2 Domain Of Rptpa Length = 253 | Back alignment and structure |
| >pdb|2GP0|A Chain A, Heptp Catalytic Domain (Residues 44-339), S225d Mutant Length = 309 | Back alignment and structure |
| >pdb|2A3K|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Ptpn7 (Heptp, Hematopoietic Protein Tyrosine Phosphatase) Length = 296 | Back alignment and structure |
| >pdb|1ZC0|A Chain A, Crystal Structure Of Human Hematopoietic Tyrosine Phosphatase (heptp) Catalytic Domain Length = 309 | Back alignment and structure |
| >pdb|3O4S|A Chain A, Crystal Structure Of Heptp With A Closed Wpd Loop And An Ordered E- Loop Length = 308 | Back alignment and structure |
| >pdb|2PA5|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase Ptpn9 Length = 314 | Back alignment and structure |
| >pdb|3D42|A Chain A, Crystal Structure Of Heptp In Complex With A Monophosphorylated Erk2 Peptide Length = 308 | Back alignment and structure |
| >pdb|2QDC|A Chain A, Crystal Structure Of The Heptp Catalytic Domain D236a Mutant Length = 309 | Back alignment and structure |
| >pdb|2HVL|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270s Mutant Length = 309 | Back alignment and structure |
| >pdb|2QDM|A Chain A, Crystal Structure Of The Heptp Catalytic Domain C270sD236AQ314A Mutant Length = 309 | Back alignment and structure |
| >pdb|2EMT|A Chain A, Crystal Structure Analysis Of The Radixin Ferm Domain Complexed With Adhesion Molecule Psgl-1 Length = 322 | Back alignment and structure |
| >pdb|2ZPY|A Chain A, Crystal Structure Of The Mouse Radxin Ferm Domain Complexed With The Mouse Cd44 Cytoplasmic Peptide Length = 312 | Back alignment and structure |
| >pdb|1J19|A Chain A, Crystal Structure Of The Radxin Ferm Domain Complexed With The Icam-2 Cytoplasmic Peptide Length = 317 | Back alignment and structure |
| >pdb|2D10|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With The Nherf-1 C-Terminal Tail Peptide Length = 312 | Back alignment and structure |
| >pdb|2D2Q|A Chain A, Crystal Structure Of The Dimerized Radixin Ferm Domain Length = 310 | Back alignment and structure |
| >pdb|1GC6|A Chain A, Crystal Structure Of The Radixin Ferm Domain Complexed With Inositol-(1,4,5)-Triphosphate Length = 297 | Back alignment and structure |
| >pdb|1H4R|A Chain A, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 | Back alignment and structure |
| >pdb|1H4R|B Chain B, Crystal Structure Of The Ferm Domain Of Merlin, The Neurofibromatosis 2 Tumor Suppressor Protein Length = 314 | Back alignment and structure |
| >pdb|3U8Z|A Chain A, Human Merlin Ferm Domain Length = 300 | Back alignment and structure |
| >pdb|1ISN|A Chain A, Crystal Structure Of Merlin Ferm Domain Length = 323 | Back alignment and structure |
| >pdb|1SGH|A Chain A, Moesin Ferm Domain Bound To Ebp50 C-Terminal Peptide Length = 297 | Back alignment and structure |
| >pdb|1E5W|A Chain A, Structure Of Isolated Ferm Domain And First Long Helix Of Moesin Length = 346 | Back alignment and structure |
| >pdb|1NI2|A Chain A, Structure Of The Active Ferm Domain Of Ezrin Length = 296 | Back alignment and structure |
| >pdb|4AZ1|A Chain A, Crystal Structure Of The Trypanosoma Cruzi Protein Tyrosine Phosphatase Tcptp1, A Potential Therapeutic Target For Chagas' Disease Length = 302 | Back alignment and structure |
| >pdb|2RQ1|A Chain A, Solution Structure Of The 4.1r Ferm Alpha Lobe Domain Length = 109 | Back alignment and structure |
| >pdb|1EF1|A Chain A, Crystal Structure Of The Moesin Ferm DomainTAIL DOMAIN COMPLEX Length = 294 | Back alignment and structure |
| >pdb|2A8B|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Tyrosine Phosphatase Receptor, Type R Length = 283 | Back alignment and structure |
| >pdb|1JLN|A Chain A, Crystal Structure Of The Catalytic Domain Of Protein Tyrosine Phosphatase Ptp-SlBR7 Length = 297 | Back alignment and structure |
| >pdb|2BIJ|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 (step, Striatum Enriched Enriched Phosphatase) Length = 305 | Back alignment and structure |
| >pdb|2I1J|A Chain A, Moesin From Spodoptera Frugiperda At 2.1 Angstroms Resolution Length = 575 | Back alignment and structure |
| >pdb|2CJZ|A Chain A, Crystal Structure Of The C472s Mutant Of Human Protein Tyrosine Phosphatase Ptpn5 (Step, Striatum Enriched Phosphatase) In Complex With Phosphotyrosine Length = 305 | Back alignment and structure |
| >pdb|2BV5|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase Ptpn5 At 1.8a Resolution Length = 282 | Back alignment and structure |
| >pdb|3M4U|A Chain A, Crystal Structure Of Trypanosoma Brucei Protein Tyrosine Phosphatase Tbptp1 Length = 306 | Back alignment and structure |
| >pdb|2VPH|A Chain A, Crystal Structure Of The Human Protein Tyrosine Phosphatase, Non-Receptor Type 4, Pdz Domain Length = 100 | Back alignment and structure |
| >pdb|2CS5|A Chain A, Solution Structure Of Pdz Domain Of Protein Tyrosine Phosphatase, Non-Receptor Type 4 Length = 119 | Back alignment and structure |
| >pdb|3NFK|A Chain A, Crystal Structure Of The Ptpn4 Pdz Domain Complexed With The C- Terminus Of A Rabies Virus G Protein Length = 107 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} Length = 320 | Back alignment and structure |
|---|
Score = 296 bits (760), Expect = 3e-95
Identities = 110/207 (53%), Positives = 145/207 (70%), Gaps = 6/207 (2%)
Query: 496 ALVAQFERLYRKKPGLSMLHANKQENVIKNRYRDISPYDATRVVLHEAPDGDYINANTVA 555
++ QF++LYRKKPG++M A +N+ KNRYRDISPYDATRV+L + DYINAN +
Sbjct: 46 TVLTQFDQLYRKKPGMTMSCAKLPQNISKNRYRDISPYDATRVILK--GNEDYINANYIN 103
Query: 556 MEIPGSGIVNRYIATQGPLASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPSLG 615
MEIP S I+N+YIA QGPL T DFW M E GS++VVM+TT VERGR KCH+YWP
Sbjct: 104 MEIPSSSIINQYIACQGPLPHTCTDFWQMTWEQGSSMVVMLTTQVERGRVKCHQYWPEPT 163
Query: 616 ETLELSGGRFNISCAKEEADPSGSFVFREFVLRDSQTGEKRDVTQMQYLAWPDHGVPDDV 675
+ G + ++C EE + +++FR+ L + + E R +TQ+QY+AWPDHGVPDD
Sbjct: 164 GSSSY--GCYQVTCHSEEGNT--AYIFRKMTLFNQEKNESRPLTQIQYIAWPDHGVPDDS 219
Query: 676 NRFLAFTRQVRHERAGMVEPAIVHCSA 702
+ FL F VR++RAG EP +VHCSA
Sbjct: 220 SDFLDFVCHVRNKRAGKEEPVVVHCSA 246
|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Length = 287 | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Length = 314 | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... Length = 304 | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Length = 315 | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Length = 325 | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 303 | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Length = 291 | Back alignment and structure |
|---|
| >2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomi structural genomics consortium, SGC; 1.60A {Homo sapiens} Length = 314 | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Length = 295 | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* Length = 307 | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Length = 286 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Length = 301 | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* Length = 309 | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* Length = 316 | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Length = 284 | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Length = 342 | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Length = 302 | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Length = 306 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Length = 610 | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A Length = 320 | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Length = 253 | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Length = 296 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} Length = 599 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Length = 575 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} Length = 627 | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Length = 297 | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A Length = 309 | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Length = 314 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* Length = 305 | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Length = 294 | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Length = 306 | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Length = 575 | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Length = 383 | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Length = 371 | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} Length = 222 | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B Length = 206 | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} Length = 322 | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Length = 555 | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} Length = 392 | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Length = 655 | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A Length = 375 | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} PDB: 3nfl_A 2vph_A Length = 107 | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 | Back alignment and structure |
|---|
| >2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 | Back alignment and structure |
|---|
| >1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 | Back alignment and structure |
|---|
| >3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 | Back alignment and structure |
|---|
| >1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 | Back alignment and structure |
|---|
| >2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 | Back alignment and structure |
|---|
| >2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 | Back alignment and structure |
|---|
| >2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 | Back alignment and structure |
|---|
| >2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 | Back alignment and structure |
|---|
| >1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 | Back alignment and structure |
|---|
| >2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 | Back alignment and structure |
|---|
| >2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Length = 132 | Back alignment and structure |
|---|
| >1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 | Back alignment and structure |
|---|
| >1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 | Back alignment and structure |
|---|
| >3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 | Back alignment and structure |
|---|
| >3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Length = 99 | Back alignment and structure |
|---|
| >2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 | Back alignment and structure |
|---|
| >1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 | Back alignment and structure |
|---|
| >1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Length = 109 | Back alignment and structure |
|---|
| >1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 | Back alignment and structure |
|---|
| >2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Length = 96 | Back alignment and structure |
|---|
| >2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 | Back alignment and structure |
|---|
| >2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Length = 111 | Back alignment and structure |
|---|
| >1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 | Back alignment and structure |
|---|
| >3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} PDB: 3r69_A* Length = 95 | Back alignment and structure |
|---|
| >3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
| >1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Length = 100 | Back alignment and structure |
|---|
| >1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 | Back alignment and structure |
|---|
| >2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 | Back alignment and structure |
|---|
| >3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Length = 107 | Back alignment and structure |
|---|
| >2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 | Back alignment and structure |
|---|
| >1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 | Back alignment and structure |
|---|
| >1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 | Back alignment and structure |
|---|
| >2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 702 | |||
| 4ge6_A | 314 | Tyrosine-protein phosphatase non-receptor type 9; | 100.0 | |
| 2i75_A | 320 | Tyrosine-protein phosphatase non-receptor type 4; | 100.0 | |
| 2b49_A | 287 | Protein tyrosine phosphatase, non-receptor type 3; | 100.0 | |
| 3s3e_A | 307 | Tyrosine-protein phosphatase 10D; differentiation, | 100.0 | |
| 2hc1_A | 291 | Receptor-type tyrosine-protein phosphatase beta; p | 100.0 | |
| 1yfo_A | 302 | D1, receptor protein tyrosine phosphatase alpha; h | 100.0 | |
| 4grz_A | 288 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 2cm2_A | 304 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 2ooq_A | 286 | Receptor-type tyrosine-protein phosphatase T; prot | 100.0 | |
| 3b7o_A | 316 | Tyrosine-protein phosphatase non-receptor type 11; | 100.0 | |
| 1fpr_A | 284 | Protein-tyrosine phosphatase 1C; protein tyrosine | 100.0 | |
| 2bzl_A | 325 | Tyrosine-protein phosphatase, non-receptor type 14 | 100.0 | |
| 2gjt_A | 295 | Receptor-type tyrosine-protein phosphatase PTPro; | 100.0 | |
| 1l8k_A | 314 | T-cell protein-tyrosine phosphatase; hydrolase; 2. | 100.0 | |
| 2i1y_A | 301 | Receptor-type tyrosine-protein phosphatase; recept | 100.0 | |
| 2p6x_A | 309 | Tyrosine-protein phosphatase non-receptor type 22; | 100.0 | |
| 3qij_A | 296 | Protein 4.1; cytoskeleton, structural genomics, st | 100.0 | |
| 3i36_A | 342 | Vascular protein tyrosine phosphatase 1; PTP, hydr | 100.0 | |
| 2h4v_A | 320 | Receptor-type tyrosine-protein phosphatase gamma; | 100.0 | |
| 4i8n_A | 354 | Tyrosine-protein phosphatase non-receptor type 1; | 100.0 | |
| 2oc3_A | 303 | Tyrosine-protein phosphatase non-receptor type 18; | 100.0 | |
| 3m4u_A | 306 | Tyrosine specific protein phosphatase, putative; p | 100.0 | |
| 1wch_A | 315 | Protein tyrosine phosphatase, non-receptor type 13 | 100.0 | |
| 4az1_A | 302 | Tyrosine specific protein phosphatase; hydrolase, | 100.0 | |
| 1p15_A | 253 | Protein-tyrosine phosphatase alpha; transmembrane, | 100.0 | |
| 2cjz_A | 305 | Human protein tyrosine phosphatase PTPN5; protein | 100.0 | |
| 1zc0_A | 309 | Tyrosine-protein phosphatase, non-receptor type 7; | 100.0 | |
| 1jln_A | 297 | STEP-like ptpase, protein tyrosine phosphatase, re | 100.0 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 100.0 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 100.0 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 1lar_A | 575 | Protein (LAR); tyrosine phosphatease, LAR protein, | 100.0 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 1ygr_A | 610 | CD45 protein tyrosine phosphatase; protein tyrosin | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 2jjd_A | 599 | Receptor-type tyrosine-protein phosphatase epsilo; | 100.0 | |
| 1lyv_A | 306 | Protein-tyrosine phosphatase YOPH; toxin, hydrolas | 100.0 | |
| 1g4w_R | 383 | Protein tyrosine phosphatase SPTP; virulence facto | 100.0 | |
| 1ef1_A | 294 | Moesin; membrane, FERM domain, tail domain, membra | 100.0 | |
| 2nlk_A | 627 | Protein tyrosine phosphatase, receptor type, G VA | 100.0 | |
| 1h4r_A | 314 | Merlin; FERM, neurofibromatosis, NF2, structural p | 100.0 | |
| 2i1j_A | 575 | Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, | 100.0 | |
| 1mix_A | 206 | Talin; focal adhesion, integrin binding, FERM doma | 100.0 | |
| 3ivf_A | 371 | Talin-1; FERM domain, cell membrane, cell projecti | 100.0 | |
| 4f7g_A | 222 | Talin-1; alpha-helix bundle, integrin activation, | 99.97 | |
| 4dxa_B | 322 | KREV interaction trapped protein 1; GTPase, FERM, | 99.97 | |
| 3pvl_A | 655 | Myosin VIIA isoform 1; protein complex, novel fold | 99.97 | |
| 2al6_A | 375 | Focal adhesion kinase 1; transferase; 2.35A {Gallu | 99.95 | |
| 3au4_A | 555 | Myosin-X; protein-protein complex, motor protein c | 99.95 | |
| 4eku_A | 392 | Protein-tyrosine kinase 2-beta; proline-rich tyros | 99.89 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 99.81 | |
| 3s4o_A | 167 | Protein tyrosine phosphatase-like protein; structu | 99.64 | |
| 1rxd_A | 159 | Protein tyrosine phosphatase type IVA, member 1; p | 99.25 | |
| 3rz2_A | 189 | Protein tyrosine phosphatase type IVA 1; tyrosine | 99.19 | |
| 2img_A | 151 | Dual specificity protein phosphatase 23; DUSP23, V | 98.26 | |
| 1fpz_A | 212 | Cyclin-dependent kinase inhibitor 3; alpha-beta sa | 97.22 | |
| 2cs5_A | 119 | Tyrosine-protein phosphatase, non-receptor type 4; | 95.59 | |
| 4erc_A | 150 | Dual specificity protein phosphatase 23; alpha bet | 95.35 | |
| 2c46_A | 241 | MRNA capping enzyme; phosphatase, transferase, hyd | 94.87 | |
| 1hbk_A | 89 | ACBP, acyl-COA binding protein; fatty acid metabol | 94.76 | |
| 2q05_A | 195 | Late protein H1, dual specificity protein phosphat | 94.7 | |
| 1d5r_A | 324 | Phosphoinositide phosphotase PTEN; C2 domain, phos | 94.69 | |
| 2cb8_A | 87 | Acyl-COA-binding protein; acyl-coenzyme A binding | 94.53 | |
| 3epy_A | 89 | Acyl-COA-binding domain-containing protein 7; acyl | 94.45 | |
| 3n0a_A | 361 | Tyrosine-protein phosphatase auxilin; phosphatase- | 94.34 | |
| 2cop_A | 109 | Acyl-coenzyme A binding domain containing 6; acyl | 93.96 | |
| 1yn9_A | 169 | BVP, polynucleotide 5'-phosphatase; RNA triphospha | 93.96 | |
| 1st7_A | 86 | ACBP, acyl-COA-binding protein; four helix bundle, | 93.89 | |
| 2cqu_A | 116 | Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA bi | 93.72 | |
| 3cm3_A | 176 | Late protein H1, dual specificity protein phosphat | 93.67 | |
| 2lbb_A | 96 | Acyl COA binding protein; protein binding, structu | 93.54 | |
| 3v0d_A | 339 | Voltage-sensor containing phosphatase; PTP, hydrol | 93.24 | |
| 2wh5_A | 106 | Acyl-COA-binding domain-containing protein 4; alte | 93.12 | |
| 3nfk_A | 107 | Tyrosine-protein phosphatase non-receptor type 4; | 92.51 | |
| 3flv_A | 119 | Acyl-COA-binding domain-containing protein 5; lipi | 92.18 | |
| 2i6j_A | 161 | Ssoptp, sulfolobus solfataricus protein tyrosine p | 92.12 | |
| 3fp5_A | 106 | Acyl-COA binding protein; ACBP, cacao disease, fat | 91.44 | |
| 3rgo_A | 157 | Protein-tyrosine phosphatase mitochondrial 1; phos | 90.5 | |
| 3ezz_A | 144 | Dual specificity protein phosphatase 4; alpha/beta | 89.99 | |
| 1zzw_A | 149 | Dual specificity protein phosphatase 10; MKP, PTP, | 88.76 | |
| 3f81_A | 183 | Dual specificity protein phosphatase 3; hydrolase, | 88.1 | |
| 3mmj_A | 314 | MYO-inositol hexaphosphate phosphohydrolase; phyta | 87.76 | |
| 1ohe_A | 348 | CDC14B, CDC14B2 phosphatase; protein phosphatase, | 86.48 | |
| 2e0t_A | 151 | Dual specificity phosphatase 26; conserved hypothe | 85.67 | |
| 1yz4_A | 160 | DUSP15, dual specificity phosphatase-like 15 isofo | 84.91 | |
| 1qav_A | 90 | Alpha-1 syntrophin (residues 77-171); beta-finger, | 84.4 | |
| 2dc2_A | 103 | GOPC, golgi associated PDZ and coiled-coil motif c | 83.83 | |
| 2wgp_A | 190 | Dual specificity protein phosphatase 14; MKP6, DUS | 83.81 | |
| 1i16_A | 130 | Interleukin 16, LCF; cytokine, lymphocyte chemoatt | 83.42 | |
| 2oud_A | 177 | Dual specificity protein phosphatase 10; A central | 82.61 | |
| 2hcm_A | 164 | Dual specificity protein phosphatase; structural g | 81.35 | |
| 1wf7_A | 103 | Enigma homologue protein; PDZ domain, structural g | 80.24 |
| >4ge6_A Tyrosine-protein phosphatase non-receptor type 9; hydrolase-hydrolase inhibitor complex; HET: B26; 1.40A {Homo sapiens} PDB: 4ge2_A* 4ge5_A* 2pa5_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=4.1e-54 Score=459.77 Aligned_cols=202 Identities=34% Similarity=0.588 Sum_probs=185.6
Q ss_pred chHHHHHHHHHHhccCCCCccccccccccccCCCCCCCCcCCCceeeccCC---CCCCceEeeeecccCCCCCcccceee
Q psy17835 493 GEWALVAQFERLYRKKPGLSMLHANKQENVIKNRYRDISPYDATRVVLHEA---PDGDYINANTVAMEIPGSGIVNRYIA 569 (702)
Q Consensus 493 g~~~l~~EFe~L~~~~~~~~~~~a~~~~N~~KNRy~dIlPyD~tRV~L~~~---~~~dYINAsyI~~~i~g~~~~~~yIa 569 (702)
+..++.+||+.|.+..+..++.+|.+++|+.||||.||+|||+|||+|.+. +++||||||||+ |+...++|||
T Consensus 24 ~~~g~~~Ef~~l~~~~~~~~~~~~~~~~N~~KNRy~dI~pyD~tRV~L~~~~~~~~sdYINAs~I~----g~~~~~~yIa 99 (314)
T 4ge6_A 24 QKQGIYEEYEDIRRENPVGTFHCSMSPGNLEKNRYGDVPCLDQTRVKLTKRSGHTQTDYINASFMD----GYKQKNAYIG 99 (314)
T ss_dssp HHHHHHHHHHHHHHSCCSSCCHHHHSTTTGGGCSCTTCCCCTTTBCCCCCCSSSCCCSCCSEEEEE----ETTEEEEEEE
T ss_pred hhhhHHHHHHHhhCcCCCCcchhccChhhhccCCCCCcCCCcCcEEEccCCCCCCCCceEEeeccc----CCCCCCeEEE
Confidence 456699999999998888899999999999999999999999999999863 347999999998 8888899999
Q ss_pred ecCCCccchhhhhHHhhhccceeEEEEeeeeecCccccccccCC-CCCeeEecCceEEEEEeeeeecCCCCEEEEEEEEE
Q psy17835 570 TQGPLASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPS-LGETLELSGGRFNISCAKEEADPSGSFVFREFVLR 648 (702)
Q Consensus 570 TQ~Pl~~T~~DFWrMVwe~~v~~IVMLt~~~E~g~~kC~qYWP~-~g~~~~~g~g~~~V~~~~~~~~~~~~y~~R~L~I~ 648 (702)
|||||++|+.|||+||||++|.+|||||...|.|+.||++|||. .++...||. |+|++.++..... |+.|+|.++
T Consensus 100 TQgPl~~T~~dFW~MVwe~~~~~IVmLt~~~E~g~~kC~~YwP~~~~~~~~~g~--~~V~~~~~~~~~~--~~~r~l~~~ 175 (314)
T 4ge6_A 100 TQGPLENTYRDFWLMVWEQKVLVIVMTTRFEEGGRRKCGQYWPLEKDSRIRFGF--LTVTNLGVENMNH--YKKTTLEIH 175 (314)
T ss_dssp ECCCCGGGHHHHHHHHHHTTCCEEEECSCSEETTEECCCCCSCCSTTCEEEETT--EEEEEEEEEECSS--EEEEEEEEE
T ss_pred ECCCcHHHHHHHHHHHHhcCCceEEEcccccccceecccccCcCCCCCceeccc--EEEEEEEEEEcCC--ceEEEEeee
Confidence 99999999999999999999999999999999999999999997 466788998 9999999888776 999999999
Q ss_pred ECCCCceEEEEEEEECCCCCCCCCCChHHHHHHHHHHHHHc-------------CCCCCcEEEEcCC
Q psy17835 649 DSQTGEKRDVTQMQYLAWPDHGVPDDVNRFLAFTRQVRHER-------------AGMVEPAIVHCSA 702 (702)
Q Consensus 649 ~~~~~~~r~Vth~qy~~WPd~gvP~~~~~~L~fl~~Vr~~~-------------~~~~~PIVVHCSA 702 (702)
+..+++.|+|+||||++|||+|+|+++.+||+|++.|++.+ ....+||||||||
T Consensus 176 ~~~~~~~r~V~h~~y~~WPd~gvP~~~~~ll~~i~~v~~~~~~~~~~~~~~~~~~~~~~PivVHCSa 242 (314)
T 4ge6_A 176 NTEERQKRQVTHFQFLSWPDYGVPSSAASLIDFLRVVRNQQSLAVSNMGARSKGQCPEPPIVVHCSA 242 (314)
T ss_dssp ETTTTEEEEEEEEEECCSCSSSCCSCSHHHHHHHHHHHHHHHHHHHHSCCC----CCSCCEEEECSS
T ss_pred cccCCcceEEEEEEeCCCCCCCCCCCHHHHHHHHHHHHHHHhhhhccccccccccCCCCCEEEECCC
Confidence 99999999999999999999999999999999999998643 1235799999997
|
| >2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics structural genomics consortium, SGC; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, STRU genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} | Back alignment and structure |
|---|
| >3s3e_A Tyrosine-protein phosphatase 10D; differentiation, neurogenesis, signal transduction, developm protein, hydrolase; 2.40A {Drosophila melanogaster} PDB: 3s3f_A 3s3h_A* 3s3k_A* | Back alignment and structure |
|---|
| >2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A | Back alignment and structure |
|---|
| >1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4grz_A Tyrosine-protein phosphatase non-receptor type 6; phosphatase domain, hydrolase; 1.37A {Homo sapiens} PDB: 4gry_A 4gs0_A* 1gwz_A 1fpr_A* | Back alignment and structure |
|---|
| >2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 3sme_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* ... | Back alignment and structure |
|---|
| >2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural GE structural genomics consortium, SGC, hydrolase; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A | Back alignment and structure |
|---|
| >3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, STR genomics consortium, SGC, deafness; 1.60A {Homo sapiens} PDB: 3jrl_A* 3mow_A* 3o5x_A* | Back alignment and structure |
|---|
| >1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A | Back alignment and structure |
|---|
| >2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genom structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A | Back alignment and structure |
|---|
| >1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, phosph structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A | Back alignment and structure |
|---|
| >2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, struct genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* 3olr_A* 3omh_A* | Back alignment and structure |
|---|
| >3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A | Back alignment and structure |
|---|
| >3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A | Back alignment and structure |
|---|
| >2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural GENO structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 3qcd_A 3qcc_A 3qcb_A 3qce_A* 3qcf_A* 3qcg_A* 3qch_A* 3qci_A* 3qcj_A* 3qck_A* 2pbn_A 2hy3_A 3qcm_A* 3qcl_A* 3qcn_A | Back alignment and structure |
|---|
| >4i8n_A Tyrosine-protein phosphatase non-receptor type 1; PTP1B, hydrolase-hydrolase inhibitor CO; HET: 1CG; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >4az1_A Tyrosine specific protein phosphatase; hydrolase, drug design; 2.18A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 | Back alignment and structure |
|---|
| >2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.70A {Homo sapiens} PDB: 2bij_A 2bv5_A* | Back alignment and structure |
|---|
| >1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3o4s_A 3o4t_A* 3o4u_A* 3d44_A* 3d42_A* 2a3k_A | Back alignment and structure |
|---|
| >1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2jjd_A Receptor-type tyrosine-protein phosphatase epsilo; transmembrane, phosphoprotein, consorti structural, glycoprotein, SGC, PTPRE, membrane genomics; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 2y2f_A* 2ydu_A* 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A | Back alignment and structure |
|---|
| >1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S | Back alignment and structure |
|---|
| >1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A | Back alignment and structure |
|---|
| >2nlk_A Protein tyrosine phosphatase, receptor type, G VA (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1 HPTPG, RPTPG, PTPG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A | Back alignment and structure |
|---|
| >2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A | Back alignment and structure |
|---|
| >1mix_A Talin; focal adhesion, integrin binding, FERM domain, cytoskeleton, structural protein; 1.75A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 PDB: 1miz_B 1mk7_B 1mk9_B 1y19_B 3g9w_A 2hrj_A 2g35_A* 2k00_A 2h7d_A* 2h7e_A* 2kgx_B | Back alignment and structure |
|---|
| >3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A | Back alignment and structure |
|---|
| >4f7g_A Talin-1; alpha-helix bundle, integrin activation, cell adhesion; 2.05A {Mus musculus} | Back alignment and structure |
|---|
| >4dxa_B KREV interaction trapped protein 1; GTPase, FERM, protein-protein interaction, GTP binding, CYTO protein binding; HET: GSP; 1.95A {Homo sapiens} PDB: 3u7d_A | Back alignment and structure |
|---|
| >3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} | Back alignment and structure |
|---|
| >2al6_A Focal adhesion kinase 1; transferase; 2.35A {Gallus gallus} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 2j0m_A* 2aeh_A | Back alignment and structure |
|---|
| >3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A | Back alignment and structure |
|---|
| >4eku_A Protein-tyrosine kinase 2-beta; proline-rich tyrosine kinase 2, FERM domain, transferase; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3s4o_A Protein tyrosine phosphatase-like protein; structural genomics, medical structural genomics of pathogen protozoa, MSGPP, unknown function; HET: MSE EPE; 2.30A {Leishmania major} | Back alignment and structure |
|---|
| >1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A | Back alignment and structure |
|---|
| >3rz2_A Protein tyrosine phosphatase type IVA 1; tyrosine phosphatase, dual specific phosphatase, COMP with peptide, hydrolase; 2.80A {Rattus norvegicus} PDB: 1x24_A 1zcl_A | Back alignment and structure |
|---|
| >2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} | Back alignment and structure |
|---|
| >1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* | Back alignment and structure |
|---|
| >2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 | Back alignment and structure |
|---|
| >4erc_A Dual specificity protein phosphatase 23; alpha beta, phosphatase(hydrolase), hydrolase; 1.15A {Homo sapiens} PDB: 2img_A | Back alignment and structure |
|---|
| >2c46_A MRNA capping enzyme; phosphatase, transferase, hydrolase, mRNA processing, multifunctional enzyme, nucleotidyltransferase; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A | Back alignment and structure |
|---|
| >1hbk_A ACBP, acyl-COA binding protein; fatty acid metabolism; HET: COA MYR; 2.0A {Plasmodium falciparum} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, P protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} | Back alignment and structure |
|---|
| >1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 | Back alignment and structure |
|---|
| >2cb8_A Acyl-COA-binding protein; acyl-coenzyme A binding protein, fatty acid, acetylation, alternative splicing, lipid-binding, transport; HET: MYA; 1.4A {Homo sapiens} PDB: 2fj9_A 1aca_A* 1hb6_A 1hb8_A 1nti_A 1nvl_A* 2abd_A 2fdq_A | Back alignment and structure |
|---|
| >3epy_A Acyl-COA-binding domain-containing protein 7; acyl-COA binding protein, fatty acid, lipid metabolism, structural genomics; HET: COA PLM; 2.00A {Homo sapiens} SCOP: a.11.1.1 | Back alignment and structure |
|---|
| >3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} | Back alignment and structure |
|---|
| >2cop_A Acyl-coenzyme A binding domain containing 6; acyl COA binding protein, COA binding protein, lipid binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} | Back alignment and structure |
|---|
| >1st7_A ACBP, acyl-COA-binding protein; four helix bundle, transport protein; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cqu_A Peroxisomal D3,D2-enoyl-COA isomerase; acyl-COA binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A | Back alignment and structure |
|---|
| >2lbb_A Acyl COA binding protein; protein binding, structural genomi seattle structural genomics center for infectious disease,; NMR {Babesia bovis} | Back alignment and structure |
|---|
| >3v0d_A Voltage-sensor containing phosphatase; PTP, hydrolase; HET: PO4; 1.10A {Ciona intestinalis} PDB: 3v0f_A* 3v0g_A 3v0h_A* 3awf_A 3v0j_A 3awe_A 3awg_A 3v0e_A 3v0i_A | Back alignment and structure |
|---|
| >2wh5_A Acyl-COA-binding domain-containing protein 4; alternative splicing, fatty acid metabolism, lipid transport, lipid binding protein; HET: STE ST9 COA; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A | Back alignment and structure |
|---|
| >3flv_A Acyl-COA-binding domain-containing protein 5; lipid binding, structural genomics, struct genomics consortium, SGC, lipid-binding, membrane; HET: STE COA; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 3ro1_A* 2i6o_A* 2dxp_A* 2i6p_A* | Back alignment and structure |
|---|
| >3fp5_A Acyl-COA binding protein; ACBP, cacao disease, fatty acid metabolism, lipid binding protein; HET: MES; 1.61A {Moniliophthora perniciosa} SCOP: a.11.1.0 | Back alignment and structure |
|---|
| >3rgo_A Protein-tyrosine phosphatase mitochondrial 1; phosphatidylglycerol phosphate (PGP) phosphatase, hydrolase; 1.93A {Mus musculus} PDB: 3rgq_A* | Back alignment and structure |
|---|
| >3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1m3g_A | Back alignment and structure |
|---|
| >1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1vhr_A* 1j4x_A* | Back alignment and structure |
|---|
| >3mmj_A MYO-inositol hexaphosphate phosphohydrolase; phytase, protein tyrosine phosphatase, inositol phosphate, I phosphatase; HET: IHP; 1.60A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 1u24_A 1u25_A* 1u26_A* 3o3l_A* 3moz_A* 2pt0_A 2psz_A 3d1h_A 3d1o_A 3d1q_A 2b4u_A 2b4p_A 2b4o_A | Back alignment and structure |
|---|
| >1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A | Back alignment and structure |
|---|
| >2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA, project on protein structural and functional analyses; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A | Back alignment and structure |
|---|
| >2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specifici phosphatase; 1.88A {Homo sapiens} | Back alignment and structure |
|---|
| >1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 | Back alignment and structure |
|---|
| >2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure INI NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 702 | ||||
| d2f71a1 | 297 | c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Ho | 3e-52 | |
| d1l8ka_ | 273 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 4e-49 | |
| d1lara1 | 317 | c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapie | 2e-47 | |
| d1wcha_ | 308 | c.45.1.2 (A:) Tyrosine-protein phosphatase, non-re | 4e-47 | |
| d2shpa1 | 307 | c.45.1.2 (A:219-525) Tyrosine phosphatase {Human ( | 6e-46 | |
| d1rpma_ | 278 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 3e-45 | |
| d1p15a_ | 245 | c.45.1.2 (A:) Protein-tyrosine phosphatase alpha { | 6e-45 | |
| d1lara2 | 249 | c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapie | 1e-43 | |
| d1g4us2 | 243 | c.45.1.2 (S:297-539) SptP tyrosine phosphatase, ca | 2e-43 | |
| d1fpra_ | 284 | c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sa | 1e-42 | |
| d1yfoa_ | 288 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 3e-42 | |
| d1jlna_ | 297 | c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus mus | 3e-39 | |
| d1lyva_ | 283 | c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, c | 6e-39 | |
| d1gg3a1 | 106 | a.11.2.1 (A:82-187) Erythroid membrane protein 4.1 | 2e-35 | |
| d1h4ra2 | 99 | b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) | 5e-32 | |
| d1gg3a2 | 92 | b.55.1.5 (A:188-279) Erythroid membrane protein 4. | 6e-32 | |
| d1ef1a2 | 99 | b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) | 1e-30 | |
| d1h4ra1 | 111 | a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) | 1e-30 | |
| d1mixa1 | 114 | a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus | 2e-30 | |
| d1ef1a1 | 111 | a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [ | 2e-29 | |
| d2pt0a1 | 313 | c.45.1.4 (A:34-346) Myo-inositol hexaphosphate pho | 7e-20 | |
| d2al6a1 | 123 | a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chic | 1e-14 | |
| d2cs5a1 | 106 | b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no | 3e-07 | |
| d2cs5a1 | 106 | b.36.1.1 (A:8-113) Tyrosine-protein phosphatase no | 4e-06 | |
| d1rxda_ | 152 | c.45.1.1 (A:) Protein tyrosine phosphatase type IV | 6e-07 | |
| d1uf1a_ | 128 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 2e-05 | |
| d1qaua_ | 112 | b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS | 2e-05 | |
| d1kwaa_ | 88 | b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta | 3e-05 | |
| d2f0aa1 | 92 | b.36.1.1 (A:251-342) Segment polarity protein dish | 3e-05 | |
| d1rzxa_ | 98 | b.36.1.1 (A:) GTPase-binding domain of the cell po | 4e-05 | |
| d1rgwa_ | 85 | b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo | 4e-05 | |
| d1n7ea_ | 95 | b.36.1.1 (A:) Glutamate receptor-interacting prote | 6e-05 | |
| d1ueza_ | 101 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 9e-05 | |
| d1uepa_ | 103 | b.36.1.1 (A:) Membrane associated guanylate kinase | 1e-04 | |
| d1x5ra1 | 99 | b.36.1.1 (A:8-106) Glutamate receptor interacting | 2e-04 | |
| d1qava_ | 90 | b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta | 3e-04 | |
| d1vaea_ | 111 | b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [T | 3e-04 | |
| d1tp5a1 | 102 | b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat | 3e-04 | |
| d2fcfa1 | 96 | b.36.1.1 (A:1148-1243) Multiple PDZ domain protein | 3e-04 | |
| d1wi2a_ | 104 | b.36.1.1 (A:) PDZ domain containing protein 11, Pd | 3e-04 | |
| d1i16a_ | 130 | b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) | 4e-04 | |
| d2csja1 | 104 | b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tj | 4e-04 | |
| d1va8a1 | 100 | b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M | 4e-04 | |
| d1ujda_ | 117 | b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human | 5e-04 | |
| d1vb7a_ | 94 | b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus | 5e-04 | |
| d1um1a_ | 110 | b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human | 5e-04 | |
| d2cssa1 | 108 | b.36.1.1 (A:8-115) Regulating synaptic membrane ex | 6e-04 | |
| d2fnea1 | 88 | b.36.1.1 (A:1955-2042) Multiple PDZ domain protein | 6e-04 | |
| d1x45a1 | 85 | b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei | 6e-04 | |
| d1whaa_ | 105 | b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap | 6e-04 | |
| d1wf7a_ | 103 | b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus muscu | 8e-04 | |
| d1v6ba_ | 118 | b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI | 8e-04 | |
| d1ihja_ | 94 | b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga | 0.001 | |
| d1wf8a1 | 94 | b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens | 0.001 | |
| d1ufxa_ | 103 | b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien | 0.001 | |
| d1g9oa_ | 91 | b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, | 0.001 | |
| d1wfva_ | 103 | b.36.1.1 (A:) Membrane associated guanylate kinase | 0.001 | |
| d1v62a_ | 117 | b.36.1.1 (A:) Glutamate receptor interacting prote | 0.001 | |
| d1x5na1 | 101 | b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) | 0.002 | |
| d1wg6a_ | 127 | b.36.1.1 (A:) Partitioning-defective 3-like protei | 0.002 | |
| d1uewa_ | 114 | b.36.1.1 (A:) Membrane associated guanylate kinase | 0.002 | |
| d2f5ya1 | 77 | b.36.1.1 (A:19-95) Regulator of G-protein signalin | 0.003 | |
| d1w9ea1 | 85 | b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapie | 0.003 | |
| d1x6da1 | 107 | b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sap | 0.003 | |
| d1ueqa_ | 123 | b.36.1.1 (A:) Membrane associated guanylate kinase | 0.003 | |
| d1rgra_ | 93 | b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus | 0.004 | |
| d1uita_ | 117 | b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma | 0.004 | |
| d1ozia_ | 99 | b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus muscu | 0.004 |
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: Tyrosine phosphatase species: Human (Homo sapiens), 1B [TaxId: 9606]
Score = 180 bits (458), Expect = 3e-52
Identities = 68/205 (33%), Positives = 98/205 (47%), Gaps = 6/205 (2%)
Query: 496 ALVAQFERLYRKKPGLSMLHANKQENVIKNRYRDISPYDATRVVLHEAPDGDYINANTVA 555
+ A ++ + + A +N +NRYRD+SP+D +R+ LH+ D DYINA+
Sbjct: 14 SWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQ-EDNDYINASL-- 70
Query: 556 MEIPGSGIVNRYIATQGPLASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPSLG 615
I YI TQGPL +T G FW M+ E S VVM+ ++E+G KC +YWP
Sbjct: 71 --IKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKE 128
Query: 616 ETLELSGGRFNISCAKEEADPSGSFVFREFVLRDSQTGEKRDVTQMQYLAWPDHGVPDDV 675
E E+ N+ D + R+ L + T E R++ Y WPD GVP+
Sbjct: 129 EK-EMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESP 187
Query: 676 NRFLAFTRQVRHERAGMVEPAIVHC 700
FL F +VR + E V
Sbjct: 188 ASFLNFLFKVRESGSLSPEHGPVVV 212
|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} Length = 273 | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 317 | Back information, alignment and structure |
|---|
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} Length = 308 | Back information, alignment and structure |
|---|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} Length = 307 | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} Length = 278 | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 245 | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} Length = 249 | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} Length = 243 | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} Length = 288 | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} Length = 297 | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} Length = 283 | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} Length = 313 | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 123 | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} Length = 152 | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 112 | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 92 | Back information, alignment and structure |
|---|
| >d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 | Back information, alignment and structure |
|---|
| >d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 | Back information, alignment and structure |
|---|
| >d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 102 | Back information, alignment and structure |
|---|
| >d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 | Back information, alignment and structure |
|---|
| >d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 | Back information, alignment and structure |
|---|
| >d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Length = 110 | Back information, alignment and structure |
|---|
| >d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 | Back information, alignment and structure |
|---|
| >d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 85 | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 | Back information, alignment and structure |
|---|
| >d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 702 | |||
| d1wcha_ | 308 | Tyrosine-protein phosphatase, non-receptor type 13 | 100.0 | |
| d2shpa1 | 307 | Tyrosine phosphatase {Human (Homo sapiens), shp-2 | 100.0 | |
| d1l8ka_ | 273 | Tyrosine phosphatase {Human (Homo sapiens), T-cell | 100.0 | |
| d2f71a1 | 297 | Tyrosine phosphatase {Human (Homo sapiens), 1B [Ta | 100.0 | |
| d1fpra_ | 284 | Tyrosine phosphatase {Human (Homo sapiens), shp-1 | 100.0 | |
| d1lara1 | 317 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1p15a_ | 245 | Protein-tyrosine phosphatase alpha {Mouse (Mus mus | 100.0 | |
| d1rpma_ | 278 | Tyrosine phosphatase {Human (Homo sapiens), mu [Ta | 100.0 | |
| d1yfoa_ | 288 | Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: | 100.0 | |
| d1jlna_ | 297 | Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl | 100.0 | |
| d1lara2 | 249 | RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1lyva_ | 283 | Protein-tyrosine phosphatase YopH, catalytic domai | 100.0 | |
| d1g4us2 | 243 | SptP tyrosine phosphatase, catalytic domain {Salmo | 100.0 | |
| d1gg3a1 | 106 | Erythroid membrane protein 4.1R {Human (Homo sapie | 99.96 | |
| d1mixa1 | 114 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.92 | |
| d1h4ra1 | 111 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 99.92 | |
| d1gg3a2 | 92 | Erythroid membrane protein 4.1R {Human (Homo sapie | 99.92 | |
| d1ef1a1 | 111 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d1ef1a2 | 99 | Moesin {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d1h4ra2 | 99 | Merlin {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d2al6a1 | 123 | Focal adhesion kinase 1 {Chicken (Gallus gallus) [ | 99.76 | |
| d2pt0a1 | 313 | Myo-inositol hexaphosphate phosphohydrolase (phyta | 99.48 | |
| d1rxda_ | 152 | Protein tyrosine phosphatase type IVa {Human (Homo | 99.2 | |
| d2cs5a1 | 106 | Tyrosine-protein phosphatase non-receptor type 4, | 97.47 | |
| d1mixa2 | 92 | Talin {Chicken (Gallus gallus) [TaxId: 9031]} | 97.27 | |
| d1ohea2 | 182 | Proline directed phosphatase CDC14b2 {Human (Homo | 97.18 | |
| d1d5ra2 | 174 | Phoshphoinositide phosphatase Pten (Pten tumor sup | 96.07 | |
| d1i9sa_ | 194 | mRNA capping enzyme, triphosphatase domain {Mouse | 95.97 | |
| d1hb6a_ | 86 | Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: | 95.29 | |
| d1fpza_ | 176 | Kinase associated phosphatase (kap) {Human (Homo s | 95.09 | |
| d1qava_ | 90 | Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | 94.85 | |
| d1uf1a_ | 128 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 94.14 | |
| d1x6da1 | 107 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 92.88 | |
| d1wi2a_ | 104 | PDZ domain containing protein 11, Pdzk11 {Mouse (M | 92.67 | |
| d1i16a_ | 130 | Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] | 92.56 | |
| d1hbka_ | 89 | Acyl-CoA binding protein {Plasmodium falciparum [T | 92.5 | |
| d1rgwa_ | 85 | Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax | 91.88 | |
| d1uepa_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 91.71 | |
| d1ueza_ | 101 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 91.49 | |
| d1v5qa_ | 122 | Glutamate receptor interacting protein {Mouse (Mus | 91.24 | |
| d2f0aa1 | 92 | Segment polarity protein dishevelled homolog Dvl-2 | 91.04 | |
| d1ueqa_ | 123 | Membrane associated guanylate kinase inverted-2 (M | 90.9 | |
| d1wfva_ | 103 | Membrane associated guanylate kinase inverted-2 (M | 90.58 | |
| d1qaua_ | 112 | Neuronal nitric oxide synthase, NNOS {Rat (Rattus | 90.18 | |
| d1x5ra1 | 99 | Glutamate receptor interacting protein 2, GRIP2 (K | 89.95 | |
| d1n7ea_ | 95 | Glutamate receptor-interacting protein 1, GRIP1 {R | 89.68 | |
| d1whaa_ | 105 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 88.79 | |
| d2fe5a1 | 92 | Synapse-associated protein 102 {Human (Homo sapien | 88.63 | |
| d2h3la1 | 103 | Erbin {Human (Homo sapiens) [TaxId: 9606]} | 88.12 | |
| d1vb7a_ | 94 | PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta | 85.9 | |
| d1v5la_ | 103 | Alpha-actinin-2 associated LIM protein {Mouse (Mus | 85.79 | |
| d1wi4a1 | 96 | Syntaxin binding protein 4 {Mouse (Mus musculus) [ | 85.67 | |
| d1v6ba_ | 118 | Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | 85.43 | |
| d1x5na1 | 101 | Harmonin {Human (Homo sapiens) [TaxId: 9606]} | 85.08 | |
| d1ihja_ | 94 | Inad {Fruit fly (Drosophila melanogaster) [TaxId: | 85.04 | |
| d1uhpa_ | 107 | Hypothetical protein KIAA1095 {Human (Homo sapiens | 84.79 | |
| d1kwaa_ | 88 | Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | 83.62 | |
| d2csja1 | 104 | Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc | 83.53 | |
| d1r6ja_ | 82 | Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | 83.49 | |
| d1ufxa_ | 103 | KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 | 83.11 | |
| d1p1da2 | 99 | Glutamate receptor interacting protein {Rat (Rattu | 82.24 | |
| d1y7na1 | 79 | Amyloid beta A4 precursor protein-binding family A | 82.13 | |
| d1t2ma1 | 92 | Afadin {Human (Homo sapiens) [TaxId: 9606]} | 82.01 | |
| d2fnea1 | 88 | Multiple PDZ domain protein {Human (Homo sapiens) | 81.78 | |
| d1ujua_ | 111 | Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: | 81.56 | |
| d1uewa_ | 114 | Membrane associated guanylate kinase inverted-2 (M | 80.65 | |
| d1xr0b_ | 129 | FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [Ta | 80.63 | |
| d1g9oa_ | 91 | Na+/H+ exchanger regulatory factor, NHERF {Human ( | 80.54 |
| >d1wcha_ c.45.1.2 (A:) Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: (Phosphotyrosine protein) phosphatases II superfamily: (Phosphotyrosine protein) phosphatases II family: Higher-molecular-weight phosphotyrosine protein phosphatases domain: Tyrosine-protein phosphatase, non-receptor type 13 (PTPL1) species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.4e-49 Score=421.26 Aligned_cols=199 Identities=39% Similarity=0.659 Sum_probs=178.3
Q ss_pred hHHHHHHHHHHhccCCCCccccccccccccCCCCCCCCcCCCceeeccCCCCCCceEeeeecccCCCCCcccceeeecCC
Q psy17835 494 EWALVAQFERLYRKKPGLSMLHANKQENVIKNRYRDISPYDATRVVLHEAPDGDYINANTVAMEIPGSGIVNRYIATQGP 573 (702)
Q Consensus 494 ~~~l~~EFe~L~~~~~~~~~~~a~~~~N~~KNRy~dIlPyD~tRV~L~~~~~~dYINAsyI~~~i~g~~~~~~yIaTQ~P 573 (702)
.+.+..||+.|.+.+|..++..|.+++|..||||+||+|||+|||+|.+ ++||||||||++. +.+....|||||+|
T Consensus 41 ~~~~~~ef~~l~~~~p~~~~~~~~~~eN~~KNRy~di~p~D~tRV~L~~--~~dYINAs~I~~~--~~~~~~~yIatQ~P 116 (308)
T d1wcha_ 41 QGIPSKELENLQELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGD--EGGYINASFIKIP--VGKEEFVYIACQGP 116 (308)
T ss_dssp TTHHHHHHHHHTTCCCSSCCCGGGSHHHHTTCSSTTCCCCSTTBCCBTT--TTBCCSEEEEEEE--ETTEEEEEEEECCC
T ss_pred cCcHHHHHHHhhccCCCchhhhhcCcccCCCCCCCCCCCCCccEEEcCC--CCccEeeeeeecC--CCCccceEEEecCC
Confidence 5667889999999888889999999999999999999999999999974 3799999999832 22344569999999
Q ss_pred CccchhhhhHHhhhccceeEEEEeeeeecCccccccccCCCC-C-eeEecCceEEEEEeeeeecCCCCEEEEEEEEEECC
Q psy17835 574 LASTVGDFWHMLVEAGSTLVVMVTTLVERGRTKCHKYWPSLG-E-TLELSGGRFNISCAKEEADPSGSFVFREFVLRDSQ 651 (702)
Q Consensus 574 l~~T~~DFWrMVwe~~v~~IVMLt~~~E~g~~kC~qYWP~~g-~-~~~~g~g~~~V~~~~~~~~~~~~y~~R~L~I~~~~ 651 (702)
|++|+.|||+||||+++.+|||||...|.++.+|++|||... + ...+|. |+|++.++....+ |+.|++.|++.+
T Consensus 117 l~~Tv~dFW~MVwe~~~~~IVmLt~~~E~~~~kc~~YwP~~~~~~~~~~g~--~~v~~~~~~~~~~--~~~r~~~l~~~~ 192 (308)
T d1wcha_ 117 LPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNR--LRLALVRMQQLKG--FVVRAMTLEDIQ 192 (308)
T ss_dssp CGGGHHHHHHHHHHTTCCEEEECSCSEETTEECCCCCSCSSTTCCEESSSS--EEEEEEEEEECSS--EEEEEEEEEETT
T ss_pred chhhHHHHHHHHHhCCCcEEEEccccccCCccccccccCCcCCCceEEece--EEEEEEEEEecCC--EEEEEeeeccCC
Confidence 999999999999999999999999999999999999999753 3 334555 9999999887766 999999999999
Q ss_pred CCceEEEEEEEECCCCCCCCCCChHHHHHHHHHHHHHcCCCCCcEEEEcCC
Q psy17835 652 TGEKRDVTQMQYLAWPDHGVPDDVNRFLAFTRQVRHERAGMVEPAIVHCSA 702 (702)
Q Consensus 652 ~~~~r~Vth~qy~~WPd~gvP~~~~~~L~fl~~Vr~~~~~~~~PIVVHCSA 702 (702)
+++.|.|+||||++|||+|+|.++.+|++|++.|+.... .+||||||||
T Consensus 193 ~~~~r~V~h~~~~~Wpd~~vP~~~~~~l~~l~~v~~~~~--~~PivVHCsa 241 (308)
T d1wcha_ 193 TREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHR--SGPIITHCSA 241 (308)
T ss_dssp TTEEEEEEEEEECSCCTTSCCSCHHHHHHHHHHHHHHCC--SSCEEEECSS
T ss_pred CCcceEEEEEeeCCccccccCCCchhHHHHHHHHHHhcc--CCcEEEEecc
Confidence 999999999999999999999999999999999988653 5799999997
|
| >d2shpa1 c.45.1.2 (A:219-525) Tyrosine phosphatase {Human (Homo sapiens), shp-2 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8ka_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), T-cell [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f71a1 c.45.1.2 (A:2-298) Tyrosine phosphatase {Human (Homo sapiens), 1B [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fpra_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), shp-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lara1 c.45.1.2 (A:1307-1623) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p15a_ c.45.1.2 (A:) Protein-tyrosine phosphatase alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1rpma_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), mu [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yfoa_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jlna_ c.45.1.2 (A:) Tyrosine phosphatase {Mouse (Mus musculus), ptp-sl/br7 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lara2 c.45.1.2 (A:1628-1876) RPTP Lar {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lyva_ c.45.1.2 (A:) Protein-tyrosine phosphatase YopH, catalytic domain {Yersinia enterocolitica [TaxId: 630]} | Back information, alignment and structure |
|---|
| >d1g4us2 c.45.1.2 (S:297-539) SptP tyrosine phosphatase, catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1gg3a1 a.11.2.1 (A:82-187) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa1 a.11.2.1 (A:195-308) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1h4ra1 a.11.2.1 (A:104-214) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gg3a2 b.55.1.5 (A:188-279) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a1 a.11.2.1 (A:88-198) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ef1a2 b.55.1.5 (A:199-297) Moesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h4ra2 b.55.1.5 (A:215-313) Merlin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2al6a1 a.11.2.1 (A:131-253) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2pt0a1 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphohydrolase (phytase) PhyA {Selenomonas ruminantium [TaxId: 971]} | Back information, alignment and structure |
|---|
| >d1rxda_ c.45.1.1 (A:) Protein tyrosine phosphatase type IVa {Human (Homo sapiens), pr-1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ohea2 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14b2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d5ra2 c.45.1.1 (A:14-187) Phoshphoinositide phosphatase Pten (Pten tumor suppressor), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i9sa_ c.45.1.1 (A:) mRNA capping enzyme, triphosphatase domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hb6a_ a.11.1.1 (A:) Acyl-CoA binding protein {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fpza_ c.45.1.1 (A:) Kinase associated phosphatase (kap) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hbka_ a.11.1.1 (A:) Acyl-CoA binding protein {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xr0b_ b.55.1.2 (B:) FGFR substrate 2 (SNT-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|