Psyllid ID: psy18090

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-
MGNEHSNKKQGSGSLKKNLSRKIKPEDVKKIKSLTNGKDVLTKVDVFELWSMEIKDSLINFYLKYYFPDKTEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYGDLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLIVYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQRIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGIPPPTAEEKGERSVLDADPTASALLELAGKTKHSAGLREPDVELEN
ccccccccccccccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHHccccccccccEEEEEccccccHHHHHHHHHHccccEEEEEEEccccEEEEEEcccccccccccccccEEEEEEcccccccccccccccEEEEccccccccccccccccccccEEEEccccccccccccccccccccccccccccEEEEEEEEEEcccccHHHHHcccccccccHHHHHHHHHccccccccccccccccccc
cccccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccEEccccccccccccccHHHcccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHcccccccccccccccccccHHccHHHHHHHHHHccHcccccEEEEEEccccccHHHHHHHHHcccccEEEEEEccccEEEEEEEccccEEcccccccccEEEEEEcccEEEEEccccccEEEEEcccccccccccccccccccEEEEEEccccccccccccccccccHHHcccccEEEEEEEEEEEccccccHHccccccEccccHHHHHHHHHHcccccccccccccccccc
mgnehsnkkqgsgslkknlsrkikpedvkkiksltngkdvltkVDVFELWSMEIKDSLINFYLkyyfpdktekidLSTFISLYYeldgsnidrKVEILLCFIGSYGDLINYVQALLNSCLFIyqsrddkelwsslnidsdkgsLIVYANYLcmgdcnneiTFDSLQKWLSTTHEIAYLHKYVLSHmfgfntsqriiptpvynpsftmsiLDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAInqgpllvlvkddkanifgayastnltlcpkfygdqnsflftlkpdmkvfnssgfnenfiylnsnqqtlpnglgfggqfeywglwidseygqgecnktcstfkdyqmlshdkHFKIMHIElwgvgippptaeekgersvldadPTASALLELAGKtkhsaglrepdvelen
mgnehsnkkqgsgslkknlsrkikpedvkkiksltngkdvltkVDVFELWSMEIKDSLINFYLKYYFPDKTEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYGDLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLIVYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQRIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGIPPPTAEEKGERSVLDADPTASALLELAgktkhsaglrepdvelen
MGNEHSNKKQGSGSLKKNLSRKIKPEDVKKIKSLTNGKDVLTKVDVFELWSMEIKDSLINFYLKYYFPDKTEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYGDLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLIVYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQRIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGIPPPTAEEKGERSVLDADPTASALLELAGKTKHSAGLREPDVELEN
*********************************LTNGKDVLTKVDVFELWSMEIKDSLINFYLKYYFPDKTEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYGDLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLIVYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQRIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGI*********************************************
************************************************LWSMEIKDSLIN*********************LYYELDGSNIDRKVEILLC**G******NYVQALLNSCLFIYQSR************************************DSLQKWLSTTHEIAYLHKY**************************SILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGV*******************PTASALLELA******************
*******************SRKIKPEDVKKIKSLTNGKDVLTKVDVFELWSMEIKDSLINFYLKYYFPDKTEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYGDLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLIVYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQRIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGIPPPT**********DADPTASALLELAGKTKHSAGLREPDVELEN
*************SLKKNLSRKIKPEDVKKIKSLTNGKDVLTKVDVFELWSMEIKDSLINFYLKYYFPDKTEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYGDLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLIVYA********NNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQRIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGIPP********RSVLDADPTASALLELAG*****************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGNEHSNKKQGSGSLKKNLSRKIKPEDVKKIKSLTNGKDVLTKVDVFELWSMEIKDSLINFYLKYYFPDKTEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYGDLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLIVYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQRIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGIPPPTAEEKGERSVLDADPTASALLELAGKTKHSAGLREPDVELEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query421 2.2.26 [Sep-21-2011]
Q5ZJX5468 TLD domain-containing pro yes N/A 0.798 0.717 0.338 1e-56
Q6DDZ9460 TLD domain-containing pro N/A N/A 0.527 0.482 0.460 6e-51
Q6P9B6456 TLD domain-containing pro yes N/A 0.498 0.460 0.434 6e-49
Q1LWV7450 TLD domain-containing pro yes N/A 0.612 0.573 0.394 6e-48
Q8K0P3455 TLD domain-containing pro yes N/A 0.489 0.452 0.421 4e-46
A2ACG1198 Uncharacterized protein C no N/A 0.370 0.787 0.325 4e-15
A0PJX2215 Uncharacterized protein C no N/A 0.363 0.711 0.295 4e-14
Q0IID2217 Uncharacterized protein C no N/A 0.389 0.755 0.313 1e-13
A8KBE0870 Oxidation resistance prot no N/A 0.375 0.181 0.333 1e-12
B4F6Q9857 Oxidation resistance prot N/A N/A 0.389 0.191 0.327 6e-12
>sp|Q5ZJX5|K1609_CHICK TLD domain-containing protein KIAA1609 homolog OS=Gallus gallus GN=RCJMB04_14k7 PE=2 SV=1 Back     alignment and function desciption
 Score =  221 bits (562), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 124/366 (33%), Positives = 203/366 (55%), Gaps = 30/366 (8%)

Query: 79  FISLYYELDGSNIDRKVEILLCFIGSY------GDLINYVQALLNSCLFIYQSRDDKELW 132
           F+     L   N D K+ I++  I +        ++  + + L+ S + +   R + + W
Sbjct: 96  FVIFMSNLLKGNADEKITIIMRMISTTEGPVKGKEIQEFTEDLIKSVVHVLSYRKELKGW 155

Query: 133 SSLNIDSDKGSLIVYANYLC----MGDCNN-------EITFDS--LQKWLSTTHEIAYLH 179
           +  N     G +   ++ L     + D          E++FD   ++ W+    +I+   
Sbjct: 156 TLENTRDSAGGIKALSSQLLSELKLADGTKAVSPQLMEMSFDRSVIEDWVYRVPQISAFL 215

Query: 180 KYVLS---HMFGFNTSQ-----RIIPTPVYNPSFTMSILDYSHIMFLNLNLMPEFQKQWR 231
             VL    H+      Q      ++P         +S+ D   I+++N +L  E Q +WR
Sbjct: 216 SVVLRQGLHVLHSLPDQTKDIVNLVPGCKGIKGRIVSLFDIPSIIYINSHLPAELQHKWR 275

Query: 232 LLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLF 291
           LLFSS+  GESF++L A  +N+GP +V++KD    IFG +AS +  + P+F GD   FLF
Sbjct: 276 LLFSSKLHGESFSQLCAHIVNKGPCVVILKDTDGFIFGGFASHSWEVKPQFQGDNRCFLF 335

Query: 292 TLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQG--ECNKTC 349
           ++ P + V+  +G+N++++YLN  QQT+PNGLG GGQ +Y+GLW+DS+YG+G  +    C
Sbjct: 336 SVFPSLAVYTYTGYNDHYMYLNHGQQTMPNGLGMGGQHDYFGLWVDSDYGKGHSKAKPRC 395

Query: 350 STFKDYQMLSHDKHFKIMHIELWGVGIPPPTAEEKGERSVLDADPTASALLELAGKTKHS 409
           +T+   Q LS  ++F +  +E+W VG  P +AE KG++S+LD DP A ALLE+ GK++HS
Sbjct: 396 TTYNSPQ-LSAKENFTLDALEVWAVGDMPESAETKGKKSILDVDPEAQALLEMTGKSRHS 454

Query: 410 AGLREP 415
            GLREP
Sbjct: 455 EGLREP 460

Gallus gallus (taxid: 9031)
>sp|Q6DDZ9|K1609_XENLA TLD domain-containing protein KIAA1609 homolog OS=Xenopus laevis PE=2 SV=1 Back     alignment and function description
>sp|Q6P9B6|K1609_HUMAN TLD domain-containing protein KIAA1609 OS=Homo sapiens GN=KIAA1609 PE=1 SV=2 Back     alignment and function description
>sp|Q1LWV7|K1609_DANRE TLD domain-containing protein KIAA1609 homolog OS=Danio rerio GN=si:ch211-260p9.6 PE=2 SV=1 Back     alignment and function description
>sp|Q8K0P3|K1609_MOUSE TLD domain-containing protein KIAA1609 OS=Mus musculus GN=Kiaa1609 PE=2 SV=1 Back     alignment and function description
>sp|A2ACG1|CT118_MOUSE Uncharacterized protein C20orf118 homolog OS=Mus musculus GN=Gm1332 PE=3 SV=1 Back     alignment and function description
>sp|A0PJX2|CT118_HUMAN Uncharacterized protein C20orf118 OS=Homo sapiens GN=C20orf118 PE=2 SV=1 Back     alignment and function description
>sp|Q0IID2|CT118_BOVIN Uncharacterized protein C20orf118 homolog OS=Bos taurus PE=2 SV=1 Back     alignment and function description
>sp|A8KBE0|OXR1_XENTR Oxidation resistance protein 1 OS=Xenopus tropicalis GN=oxr1 PE=2 SV=2 Back     alignment and function description
>sp|B4F6Q9|OXR1_XENLA Oxidation resistance protein 1 OS=Xenopus laevis GN=oxr1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query421
242016250406 conserved hypothetical protein [Pediculu 0.807 0.837 0.418 2e-70
91087271461 PREDICTED: similar to conserved hypothet 0.866 0.791 0.328 1e-63
125985259450 GA18692 [Drosophila pseudoobscura pseudo 0.902 0.844 0.339 8e-63
195052385448 GH13150 [Drosophila grimshawi] gi|193900 0.897 0.843 0.345 1e-62
195471523448 GE18362 [Drosophila yakuba] gi|194174153 0.966 0.908 0.326 2e-62
158297529459 AGAP007765-PA [Anopheles gambiae str. PE 0.928 0.851 0.316 4e-62
195577275448 GD22498 [Drosophila simulans] gi|1941905 0.895 0.841 0.339 5e-62
345498113443 PREDICTED: TLD domain-containing protein 0.900 0.855 0.347 9e-62
19920876448 CG5149 [Drosophila melanogaster] gi|7297 0.895 0.841 0.337 1e-61
195338897448 GM13572 [Drosophila sechellia] gi|194129 0.895 0.841 0.337 1e-61
>gi|242016250|ref|XP_002428742.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212513427|gb|EEB16004.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  273 bits (697), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 152/363 (41%), Positives = 222/363 (61%), Gaps = 23/363 (6%)

Query: 73  KIDLSTFISLYYELDGSNIDRKVEILLCFIG-------SYGDLINYVQALLNSCLFI--Y 123
           ++   TF   ++++    +D KVE+L   +G       S   L+N+V+++LNS L I  Y
Sbjct: 42  ELSCQTFKKFFFDMCKGGVDVKVEVLSKLLGGEENGIISKIKLMNFVKSILNSILIIQKY 101

Query: 124 QSRDDKELWSSLNIDSDKGSLI-VYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYV 182
           ++    E WSS    S+ GS +  YANY       +E    S     S  +   Y    V
Sbjct: 102 KAVKRYESWSSRMGQSEPGSSVNEYANYFLDKIHKSEENQYSKNDLYSLLNYFDYFLYMV 161

Query: 183 LSHMFGFNTSQRIIPT---PVYNPSFT--------MSILDYSHIMFLNLNLMPEFQKQWR 231
           LS+++  N+  R   +   P Y  S           S+L+  H++FLNL L  ++Q +WR
Sbjct: 162 LSNLY--NSEDRHFYSNLLPKYKSSQVDVGKKLSDFSVLNLLHVIFLNLELPVDYQSEWR 219

Query: 232 LLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLF 291
            LFSS+  GESF+RL+    NQGP ++++KD + +IFG +A  +  L P F+GD  S+LF
Sbjct: 220 PLFSSKVDGESFSRLLGQITNQGPTIIVIKDKEGHIFGGFAPFSWVLGPNFFGDSRSYLF 279

Query: 292 TLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCST 351
           TL P M +F S+ FN N+ Y+N NQQT+PNGLG GG+ EY+GLWIDSE+G+G C+++C+T
Sbjct: 280 TLYPKMNMFPSTNFNSNYQYVNINQQTMPNGLGMGGKLEYFGLWIDSEFGKGYCSESCTT 339

Query: 352 FKDYQMLSHDKHFKIMHIELWGVGIPPPTAEEKGERSVLDADPTASALLELAGKTKHSAG 411
           ++DY+M+S  K+F+I H E+WGVG PP +  E GERSVLD +  A A+LE+AGKT +S G
Sbjct: 340 YRDYKMMSGSKNFEISHCEVWGVGPPPLSPSELGERSVLDTNLDAKAILEMAGKTTYSEG 399

Query: 412 LRE 414
           LRE
Sbjct: 400 LRE 402

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91087271|ref|XP_975540.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|125985259|ref|XP_001356393.1| GA18692 [Drosophila pseudoobscura pseudoobscura] gi|195147110|ref|XP_002014523.1| GL19228 [Drosophila persimilis] gi|54644716|gb|EAL33456.1| GA18692 [Drosophila pseudoobscura pseudoobscura] gi|194106476|gb|EDW28519.1| GL19228 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195052385|ref|XP_001993291.1| GH13150 [Drosophila grimshawi] gi|193900350|gb|EDV99216.1| GH13150 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195471523|ref|XP_002088052.1| GE18362 [Drosophila yakuba] gi|194174153|gb|EDW87764.1| GE18362 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|158297529|ref|XP_317751.3| AGAP007765-PA [Anopheles gambiae str. PEST] gi|157015239|gb|EAA12178.3| AGAP007765-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195577275|ref|XP_002078498.1| GD22498 [Drosophila simulans] gi|194190507|gb|EDX04083.1| GD22498 [Drosophila simulans] Back     alignment and taxonomy information
>gi|345498113|ref|XP_003428151.1| PREDICTED: TLD domain-containing protein KIAA1609 homolog isoform 1 [Nasonia vitripennis] gi|345498115|ref|XP_003428152.1| PREDICTED: TLD domain-containing protein KIAA1609 homolog isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|19920876|ref|NP_609110.1| CG5149 [Drosophila melanogaster] gi|7297242|gb|AAF52506.1| CG5149 [Drosophila melanogaster] gi|17862218|gb|AAL39586.1| LD15196p [Drosophila melanogaster] gi|220942994|gb|ACL84040.1| CG5149-PA [synthetic construct] gi|220953178|gb|ACL89132.1| CG5149-PA [synthetic construct] Back     alignment and taxonomy information
>gi|195338897|ref|XP_002036060.1| GM13572 [Drosophila sechellia] gi|194129940|gb|EDW51983.1| GM13572 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query421
FB|FBgn0031904448 CG5149 [Drosophila melanogaste 0.686 0.645 0.378 1.6e-54
ZFIN|ZDB-GENE-050419-140450 tldc1 "TBC/LysM-associated dom 0.610 0.571 0.399 4.7e-48
UNIPROTKB|Q6P9B6456 KIAA1609 "TLD domain-containin 0.498 0.460 0.434 5.4e-47
MGI|MGI:1921597455 Tldc1 "TBC/LysM associated dom 0.489 0.452 0.421 3.1e-44
WB|WBGene00010671399 eak-7 [Caenorhabditis elegans 0.605 0.639 0.334 1.1e-40
DICTYBASE|DDB_G0290391308 DDB_G0290391 "Uncharacterized 0.387 0.529 0.342 1.1e-22
TAIR|locus:2164225424 AT5G06260 [Arabidopsis thalian 0.617 0.613 0.259 8.5e-19
MGI|MGI:2686178198 Tldc2 "TBC/LysM associated dom 0.391 0.833 0.337 1.7e-17
UNIPROTKB|E1C5W1957 NCOA7 "Nuclear receptor coacti 0.517 0.227 0.314 1.9e-17
UNIPROTKB|Q8NI08942 NCOA7 "Nuclear receptor coacti 0.515 0.230 0.310 2.7e-16
FB|FBgn0031904 CG5149 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 563 (203.2 bits), Expect = 1.6e-54, P = 1.6e-54
 Identities = 117/309 (37%), Positives = 188/309 (60%)

Query:   129 KELWSSLNIDSDKGSLIVYANYLC--MG-DCNNEITFDSLQKWLSTTHEIAYLHKYVLSH 185
             KE W  L  ++ + S   +A  L   +G +  + +  D+L++WL  T +   + + V S 
Sbjct:   140 KE-WHDLGFNTTERSAATFAKGLMRNLGKELEHTMPNDALERWLHVTPQFLQIWREVFSQ 198

Query:   186 MF-GFNTSQR---------IIPTPVYNP--SFTMSILDYSHIMFLNLNLMPEFQKQWRLL 233
             ++     S+R         I+P     P  S    I++  H++++N  L  E + +WR L
Sbjct:   199 LYCRHGGSKRNIIKEMEIPILPALCDAPQNSHYRPIIELPHVLYINAQLPREHRHKWRFL 258

Query:   234 FSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTL 293
             FSS+  GESF+ ++   +++GP L  ++D+   IFG YAS   ++ P+F GD +S L+TL
Sbjct:   259 FSSKINGESFSTMLGKVLDKGPTLFFIEDEDQYIFGGYASETWSVKPQFGGDDSSLLYTL 318

Query:   294 KPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFK 353
              P M+ F+++ +N ++ YLN NQQT+PNGLG GGQF++WGLWID  +G G+  ++C+T++
Sbjct:   319 SPAMRCFSATTYNNHYQYLNLNQQTMPNGLGMGGQFDFWGLWIDCSFGDGQSVESCTTYR 378

Query:   354 DYQMLSHDKHFKIMHIELWGVG-IPPPTAEEKGE---RSVLDADPTASALLELAGKTKHS 409
             DY  LS  K FKI ++E+W VG +P    +E+G+   RSVLD +    A+LE+AGK  HS
Sbjct:   379 DYVQLSKRKQFKIRNMEVWAVGDLPVKEEDEEGDGHKRSVLDGNLEDRAMLEIAGKKMHS 438

Query:   410 AGLREPDVE 418
              GLREP+++
Sbjct:   439 DGLREPNMD 447
GO:0005923 "tight junction" evidence=IEA
GO:0005198 "structural molecule activity" evidence=IEA
ZFIN|ZDB-GENE-050419-140 tldc1 "TBC/LysM-associated domain containing 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P9B6 KIAA1609 "TLD domain-containing protein KIAA1609" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1921597 Tldc1 "TBC/LysM associated domain containing 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
WB|WBGene00010671 eak-7 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290391 DDB_G0290391 "Uncharacterized protein C20orf118" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2164225 AT5G06260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
MGI|MGI:2686178 Tldc2 "TBC/LysM associated domain containing 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5W1 NCOA7 "Nuclear receptor coactivator 7" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8NI08 NCOA7 "Nuclear receptor coactivator 7" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZJX5K1609_CHICKNo assigned EC number0.33870.79800.7179yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
smart00584165 smart00584, TLDc, domain in TBC and LysM domain co 4e-39
pfam07534136 pfam07534, TLD, TLD 4e-33
COG5142212 COG5142, OXR1, Oxidation resistance protein [DNA r 1e-13
>gnl|CDD|214733 smart00584, TLDc, domain in TBC and LysM domain containing proteins Back     alignment and domain information 
 Score =  137 bits (348), Expect = 4e-39
 Identities = 58/171 (33%), Positives = 84/171 (49%), Gaps = 8/171 (4%)

Query: 207 MSILDYSHIMFLNLNLMPEFQ-KQWRLLFSSQFQGESFTRLM-ACAINQGPLLVLVKDDK 264
            SIL    +  +N +L    +   W LL+SS   G S   L       + P L+++KD  
Sbjct: 1   SSILSEEILALINSHLPTRAEGYPWTLLYSSSQHGYSLNTLYRKVEGYRPPTLLIIKDTD 60

Query: 265 ANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLG 324
             +FGAYAS    +   FYG   SFLF L P   V++ +G    + Y+N    +LP G G
Sbjct: 61  GEVFGAYASQAWRVSDHFYGTGESFLFQLNPKFVVYDWTG-KNKYYYINGTPDSLPIGGG 119

Query: 325 FGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVG 375
            GG    +GLWID +   G  +  C TF +  + +  + F I+ IE+WG G
Sbjct: 120 GGG----FGLWIDEDLNHGSSSH-CKTFGNPPLSTKQEDFLILDIEVWGFG 165

Length = 165
>gnl|CDD|219457 pfam07534, TLD, TLD Back     alignment and domain information
>gnl|CDD|227471 COG5142, OXR1, Oxidation resistance protein [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 421
KOG2557|consensus427 100.0
smart00584165 TLDc domain in TBC and LysM domain containing prot 100.0
KOG2372|consensus241 100.0
KOG4636|consensus483 100.0
PF07534139 TLD: TLD; InterPro: IPR006571 TLDc is a domain of 99.98
COG5142212 OXR1 Oxidation resistance protein [DNA replication 99.96
KOG2801|consensus559 99.87
KOG0044|consensus193 99.79
KOG0034|consensus187 99.14
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 98.92
PTZ00183158 centrin; Provisional 97.95
PTZ00184149 calmodulin; Provisional 97.68
KOG0038|consensus189 95.81
KOG2562|consensus493 95.59
KOG0044|consensus193 95.07
KOG0027|consensus151 94.9
cd0021388 S-100 S-100: S-100 domain, which represents the la 94.63
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 94.62
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 94.43
cd0503088 calgranulins Calgranulins: S-100 domain found in p 94.28
PTZ00184149 calmodulin; Provisional 94.26
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 94.2
KOG0034|consensus187 93.53
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 93.29
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 93.23
cd0005267 EH Eps15 homology domain; found in proteins implic 92.94
PTZ00183158 centrin; Provisional 92.81
PLN02964644 phosphatidylserine decarboxylase 92.8
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 92.32
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 91.84
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 91.27
KOG4347|consensus671 90.75
KOG0036|consensus463 90.64
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 90.02
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 90.02
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 88.76
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 88.75
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 88.7
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 88.65
PF0906990 EF-hand_3: EF-hand; InterPro: IPR015154 Like other 88.28
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 87.71
KOG4223|consensus325 87.53
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 87.23
KOG0027|consensus151 86.53
KOG4286|consensus 966 86.26
KOG0377|consensus631 86.02
KOG4666|consensus412 85.48
KOG4223|consensus325 85.03
KOG2643|consensus489 82.68
KOG0028|consensus172 82.66
KOG2643|consensus489 80.8
>KOG2557|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.6e-83  Score=620.19  Aligned_cols=399  Identities=29%  Similarity=0.480  Sum_probs=353.3

Q ss_pred             CCCccccccCCCccccccccccCCccchHHH----hhhcCCC-CcccHHHHHHHHHhhccchhHHHHHhhhcCC-----C
Q psy18090          1 MGNEHSNKKQGSGSLKKNLSRKIKPEDVKKI----KSLTNGK-DVLTKVDVFELWSMEIKDSLINFYLKYYFPD-----K   70 (421)
Q Consensus         1 mgn~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~-g~is~e~~~~~~~~~~~~~l~~~~~~~lF~~-----~   70 (421)
                      |||+.|+++.+         |++..|+++.+    +..++|+ .+.|.+.+...|....+.+|.+++..++|+.     +
T Consensus         1 mgn~n~kr~~~---------~~~naE~~~~l~~~kk~~~~ga~~k~t~dq~v~~~~~~~~~~l~e~~~q~~f~~vk~~~q   71 (427)
T KOG2557|consen    1 MGNSNSKRVDH---------RFINAETQKKLDDLKKLFVSGASNKQTNDQYVSYPVFQEYFGLSESLGQRMFDMVKQRRQ   71 (427)
T ss_pred             CCCcccccccc---------cccCHHHHHHHHHHhhccccccchhhhhhhhhhcccccchhhhhhhccceEeeeccCccC
Confidence            99999998855         24477777777    2235666 7899999999999989999999999999999     6


Q ss_pred             CCceeHhHHHHHHHHhhCCCHHHHHHHHHHhhCCcc-------hHHHHHHHHHHhhhhh-hcccchhhhhhcccCCCCcc
Q psy18090         71 TEKIDLSTFISLYYELDGSNIDRKVEILLCFIGSYG-------DLINYVQALLNSCLFI-YQSRDDKELWSSLNIDSDKG  142 (421)
Q Consensus        71 ~~~I~~e~Fv~~ls~~~rGt~eEk~~~i~~m~d~~~-------el~~~ve~lv~sv~~~-l~~~~~~~~w~~~~~~~~~~  142 (421)
                      +.++++++++++.+++.+||-++++++++.+.++++       ++.+|+..++.++++. ..+++...+|..+-...+  
T Consensus        72 ~~~~~l~k~~~~~~~~~~gt~dq~a~mL~~~~~~sgn~~~~~~q~eQ~~~~vlks~~~~ess~~es~~~~~~d~af~~--  149 (427)
T KOG2557|consen   72 DDKMTLEKLVIAKATYEKGTDDQIAEMLYQTLDVNGNGVLSRSQLEQFLVVVLKSVFSTESSDAESSDYKKMDDAFLN--  149 (427)
T ss_pred             CccchHHHHhhHHhhhccCcccHHHHHHHHHHhhccccccchhHHHHHHHHHhhheeeecccchhhhhhhhhhccccc--
Confidence            789999999999999999999999999999999987       5666666666665554 666666677554432222  


Q ss_pred             cHHHHHHHHhccCCCCccCHHHHHHHHhhchhHHHHHHHHHHhhhccCCCCc--c---cCCCCCCCCCcccCCCHHHHHH
Q psy18090        143 SLIVYANYLCMGDCNNEITFDSLQKWLSTTHEIAYLHKYVLSHMFGFNTSQR--I---IPTPVYNPSFTMSILDYSHIMF  217 (421)
Q Consensus       143 ~v~~la~~l~~k~~d~~is~~ef~~Wl~~~P~i~~~L~~~~~~~~~~~~~~~--~---~p~~~~~~~~~s~iL~~~~~~~  217 (421)
                            ...+.|.+++......|++|+..||.+..+.+.++.++|.+.+..+  +   +|..+..++.. -++..++++.
T Consensus       150 ------~~~~~ke~e~t~p~~~le~~~s~~p~f~~i~r~~fs~L~~~~g~sk~pil~~l~~~~~~sh~~-~~i~~~~~l~  222 (427)
T KOG2557|consen  150 ------AATFSKEDEGTEPGMSLEDFRSWCPFFPTIRKFLFSLLMPPSGVSKGPILPHLLYEDSVSHDR-LLIKKEYALH  222 (427)
T ss_pred             ------hhhhccccccCCCchhHHHHhhhchHHHHHHHHHHHHhccccCCccCcccccccccccccccc-ceeecchhhe
Confidence                  4456688899999999999999999999999999998887655554  3   33455677776 7889999999


Q ss_pred             HHHhcCccccCceeEEEeeccccchHHHHHHHhccCCCEEEEEEcCCccEEEeeccCCcccCCCcccCCceEEEEecCCC
Q psy18090        218 LNLNLMPEFQKQWRLLFSSQFQGESFTRLMACAINQGPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDM  297 (421)
Q Consensus       218 L~~~LP~~~~~~w~LLYss~~hG~S~~~f~~~~~~~gPtlllIk~~~g~VFG~y~s~~w~~~~~~~Gd~~~FLFsl~P~~  297 (421)
                      |+.+||...+.+|++||+++.||.||++|..++.++|||++||+|++|+|||+|+|++|...++|+||.+||||+|.|++
T Consensus       223 in~~lp~~~r~~wr~lysss~~gqsfSt~l~~~~~~gp~v~vI~d~d~~vFGgyASq~we~~pQF~Gd~~~fLfqL~Pkm  302 (427)
T KOG2557|consen  223 INGALPHHERVEWKLLYSSSVHGQSFSTFLGHTSGMGPSVLIIKDTEGYVFGGYASQPWERYPQFYGDMKSFLFQLNPKM  302 (427)
T ss_pred             ecccCCcchhhceeeeeeecccccchhhhhhhccCCCCeEEEEEcCCCceecccccCcccccCccCCccceeeeeecchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCCCCceEEecCCCCCCCCceeecCCCCceeEEEeCCCCCceecccccccCCCCCCCCCCCeeEEEEEEEEecCC
Q psy18090        298 KVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGVGIP  377 (421)
Q Consensus       298 ~vy~~tg~n~~~~y~n~~~~~~p~Gl~fGg~~~~~~L~id~d~~~g~s~~~c~Tf~~~~~Ls~~~~F~I~~iEVWg~g~~  377 (421)
                      ++|++||+|+||+|+|.+||||||||||||++++|+||||.+|+.|+|.+.|+||+ +|+|+..++|+|+.||||++| |
T Consensus       303 a~y~aTgyn~~yqylN~~QQtiPNGLGmGGq~n~fgL~Id~sFg~Gqs~e~cTty~-spqLSk~~~fqi~~iEvWavg-D  380 (427)
T KOG2557|consen  303 AIYRATGYNTNYQYLNFTQQTIPNGLGMGGQINHFGLFIDASFGQGQSFECCTTYE-SPQLSKTSRFQIEVIEVWAVG-D  380 (427)
T ss_pred             eeecccCCccceEEeccccccCCCccccCcccceeeEEEEeecCCCccccccccCC-CccccccccccceEEEEEecC-C
Confidence            99999999999999999999999999999999999999999999999999999998 999999999999999999999 9


Q ss_pred             CCchhhh-----cCCCCCCCChHHHHHHhhcCCCcCCCCCCCCCCcc
Q psy18090        378 PPTAEEK-----GERSVLDADPTASALLELAGKTKHSAGLREPDVEL  419 (421)
Q Consensus       378 ~~~~~~~-----~~~~~ld~~~e~ralLem~G~~~~s~g~re~~~~~  419 (421)
                      .|.+|+.     .||+|||.|||||||||+||+.+||||||||+.||
T Consensus       381 ~p~eEq~ekgn~~kkSvLD~dpEdrAmLElaGksmhSeglRep~~De  427 (427)
T KOG2557|consen  381 APNEEQDEKGNAMKKSVLDRDPEDRAMLELAGKSMHSEGLREPALDE  427 (427)
T ss_pred             CcchhhhhccCccccccccCCHHHHHHHHHhccccccccccCCCCCC
Confidence            8776542     58999999999999999999999999999999774

>smart00584 TLDc domain in TBC and LysM domain containing proteins Back     alignment and domain information
>KOG2372|consensus Back     alignment and domain information
>KOG4636|consensus Back     alignment and domain information
>PF07534 TLD: TLD; InterPro: IPR006571 TLDc is a domain of unknown function, restricted to eukaryotes, and commonly found in TBC (IPR000195 from INTERPRO) and LysM (IPR002482 from INTERPRO) domain containing proteins [] Back     alignment and domain information
>COG5142 OXR1 Oxidation resistance protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2801|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>KOG4347|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF09069 EF-hand_3: EF-hand; InterPro: IPR015154 Like other EF hand domains, this domain forms a helix-loop-helix motif, though since it does not contain the canonical pattern of calcium binding residues found in many EF hand domains, it does not bind calcium ions Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG4286|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
4acj_A167 Crystal Structure Of The Tldc Domain Of Oxidation R 1e-14
>pdb|4ACJ|A Chain A, Crystal Structure Of The Tldc Domain Of Oxidation Resistance Protein 2 From Zebrafish Length = 167 Back     alignment and structure 
Iteration: 1

 Score = 77.4 bits (189), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 73/144 (50%), Gaps = 9/144 (6%)
Query: 230 WRLLFSSQFQGESFTRLMACAINQ-GPLLVLVKDDKANIFGAYASTNLTLCPKFYGDQNS 288
           W L FS+   G S   L     +Q  P+L+++KD    IFGA AS    +   FYG   +
Sbjct: 29  WNLAFSTSKHGMSIKTLYRAMQDQDSPMLLVIKDSDGQIFGALASEPFKVSEGFYGTGET 88
Query: 289 FLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKT 348
           FLFT  P+ + +  +G  +N  ++  +  +    L FGG    +GLW+D +   G  N +
Sbjct: 89  FLFTFYPEFEAYKWTG--DNLFFIKGDMDS----LAFGGGSGEFGLWLDGDLYHGR-NHS 141
Query: 349 CSTFKDYQMLSHDKHFKIMHIELW 372
           C TF +  MLS  + F +  IE+W
Sbjct: 142 CKTFGN-PMLSMKEDFFVQDIEIW 164

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query421
4acj_A167 WU\:FB25H12 protein,; immune system; 0.97A {Danio 4e-29
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>4acj_A WU\:FB25H12 protein,; immune system; 0.97A {Danio rerio} Length = 167 Back     alignment and structure
 Score =  110 bits (276), Expect = 4e-29
 Identities = 54/173 (31%), Positives = 79/173 (45%), Gaps = 10/173 (5%)

Query: 204 SFTMSILDYSHIMFLNLNLMPEFQ-KQWRLLFSSQFQGESFTRLM-ACAINQGPLLVLVK 261
           +    +L+   I  L  +L P      W L FS+   G S   L  A      P+L+++K
Sbjct: 2   NEPSDLLEAEQIEKLAKHLPPRTIGYPWNLAFSTSKHGMSIKTLYRAMQDQDSPMLLVIK 61

Query: 262 DDKANIFGAYASTNLTLCPKFYGDQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPN 321
           D    IFGA AS    +   FYG   +FLFT  P+ + +  +G N  FI  +       +
Sbjct: 62  DSDGQIFGALASEPFKVSEGFYGTGETFLFTFYPEFEAYKWTGDNLFFIKGD------MD 115

Query: 322 GLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHFKIMHIELWGV 374
            L FGG    +GLW+D +   G  + +C TF    MLS  + F +  IE+W  
Sbjct: 116 SLAFGGGSGEFGLWLDGDLYHGRNH-SCKTF-GNPMLSMKEDFFVQDIEIWSF 166
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query421
4acj_A167 WU\:FB25H12 protein,; immune system; 0.97A {Danio 100.0
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.41
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.23
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 99.19
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.14
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.11
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.08
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.07
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.0
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 98.97
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 98.95
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 98.94
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.92
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 98.9
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 98.88
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 98.87
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 98.86
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 98.7
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 98.62
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 98.54
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 98.49
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 98.47
3fwb_A161 Cell division control protein 31; gene gating, com 98.44
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 98.38
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 98.33
2jnf_A158 Troponin C; stretch activated muscle contraction, 98.28
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 98.28
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 98.22
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 98.21
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 98.21
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 98.21
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 98.17
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 98.12
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 98.11
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 98.1
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 98.09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 98.09
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 98.08
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 98.08
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 98.05
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 98.04
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 98.03
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 98.02
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 98.02
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 98.01
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 97.99
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 97.98
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 97.97
1y1x_A191 Leishmania major homolog of programmed cell death 97.89
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 97.87
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 97.86
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 97.85
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 97.84
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 97.84
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 97.84
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 97.83
1exr_A148 Calmodulin; high resolution, disorder, metal trans 97.82
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 97.82
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 97.81
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 97.81
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 97.8
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 97.8
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 97.79
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 97.78
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 97.78
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 97.78
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 97.74
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 97.69
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 97.68
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 97.67
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 97.66
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 97.66
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 97.64
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 97.63
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 97.63
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 97.6
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 97.59
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 97.59
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 97.58
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 97.54
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 97.52
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 97.51
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 97.5
3lij_A494 Calcium/calmodulin dependent protein kinase with A 97.49
3akb_A166 Putative calcium binding protein; EF-hand, metal b 97.45
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 97.41
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 97.39
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 96.96
3a4u_B143 Multiple coagulation factor deficiency protein 2; 96.9
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 96.82
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 96.81
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 96.72
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 96.69
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 96.61
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 96.53
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 96.4
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 96.34
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 96.33
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 96.32
2hps_A186 Coelenterazine-binding protein with bound coelent; 96.25
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 96.24
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 96.23
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 96.21
3fwb_A161 Cell division control protein 31; gene gating, com 96.21
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 96.21
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 96.21
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 96.13
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 96.1
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 96.08
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 96.03
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.97
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 95.96
1y1x_A191 Leishmania major homolog of programmed cell death 95.93
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 95.93
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 95.85
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 95.77
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.72
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 95.72
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 95.72
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 95.69
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 95.68
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 95.65
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 95.61
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 95.6
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 95.59
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 95.59
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 95.58
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 95.55
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 95.49
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 95.48
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 95.46
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 95.46
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 95.4
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 95.39
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 95.33
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 95.28
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 95.23
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 95.22
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 95.22
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 95.18
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 95.17
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 95.17
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 95.16
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 95.11
1exr_A148 Calmodulin; high resolution, disorder, metal trans 95.08
1c07_A95 Protein (epidermal growth factor receptor pathway 95.07
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 95.04
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 94.95
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 94.91
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 94.86
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 94.84
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 94.83
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 94.83
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 94.7
1avs_A90 Troponin C; muscle contraction, calcium-activated, 94.67
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 94.65
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 94.64
2lv7_A100 Calcium-binding protein 7; metal binding protein; 94.58
3akb_A166 Putative calcium binding protein; EF-hand, metal b 94.53
2jnf_A158 Troponin C; stretch activated muscle contraction, 94.52
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 94.51
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 94.48
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 94.47
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 94.45
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 94.44
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 94.43
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 94.4
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 94.36
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 94.33
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 94.33
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 94.29
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 94.25
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 94.21
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 94.18
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 94.17
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 94.16
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 94.11
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 94.08
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 94.06
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 94.05
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 94.01
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 93.98
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 93.96
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 93.95
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 93.94
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 93.89
2jq6_A139 EH domain-containing protein 1; metal binding prot 93.85
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 93.8
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 93.75
1qjt_A99 EH1, epidermal growth factor receptor substrate su 93.72
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 93.66
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 93.64
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 93.49
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 93.45
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 93.4
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 93.3
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 93.26
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 93.21
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 92.95
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 92.94
3li6_A66 Calcium-binding protein; calcium signaling protein 92.93
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 92.87
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 92.82
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 92.73
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 92.7
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 92.69
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 92.67
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 92.59
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 92.53
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 92.42
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 92.36
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 92.1
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 92.07
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 92.03
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 91.98
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 91.91
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 91.84
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 91.84
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 91.75
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 91.65
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 91.57
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 91.45
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 91.41
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 91.21
3a4u_B143 Multiple coagulation factor deficiency protein 2; 91.15
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 91.13
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 91.12
2hps_A186 Coelenterazine-binding protein with bound coelent; 91.01
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 90.98
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 90.82
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 90.76
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 90.7
3lij_A494 Calcium/calmodulin dependent protein kinase with A 90.57
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 90.52
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 90.29
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 90.24
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 90.2
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 90.16
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 90.08
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 90.02
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 89.69
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 89.61
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 89.01
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 89.01
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 88.7
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 88.68
3li6_A66 Calcium-binding protein; calcium signaling protein 88.41
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 87.96
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 87.86
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 87.81
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 87.74
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 86.58
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 86.16
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 86.13
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 86.05
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 85.64
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 82.6
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 82.43
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 82.13
2lv7_A100 Calcium-binding protein 7; metal binding protein; 82.08
1avs_A90 Troponin C; muscle contraction, calcium-activated, 82.02
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 81.39
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 80.69
>4acj_A WU\:FB25H12 protein,; immune system; 0.97A {Danio rerio} Back     alignment and structure
Probab=100.00  E-value=1.7e-45  Score=332.91  Aligned_cols=160  Identities=33%  Similarity=0.625  Sum_probs=154.3

Q ss_pred             ccCCCHHHHHHHHHhcCccc-cCceeEEEeeccccchHHHHHHHhcc-CCCEEEEEEcCCccEEEeeccCCcccCCCccc
Q psy18090        207 MSILDYSHIMFLNLNLMPEF-QKQWRLLFSSQFQGESFTRLMACAIN-QGPLLVLVKDDKANIFGAYASTNLTLCPKFYG  284 (421)
Q Consensus       207 s~iL~~~~~~~L~~~LP~~~-~~~w~LLYss~~hG~S~~~f~~~~~~-~gPtlllIk~~~g~VFG~y~s~~w~~~~~~~G  284 (421)
                      |.||+..++.+|+.+||.+. ..+|+|||++++||+|+++|+++|.+ ++||||||++++|+|||||++++|+.++.|||
T Consensus         5 S~iLt~~~~~~L~~~LP~~~~~~~w~LlYss~~hG~S~~~~~~~~~~~~~ptllvik~~~g~vFGaf~s~~w~~~~~~~G   84 (167)
T 4acj_A            5 SDLLEAEQIEKLAKHLPPRTIGYPWNLAFSTSKHGMSIKTLYRAMQDQDSPMLLVIKDSDGQIFGALASEPFKVSEGFYG   84 (167)
T ss_dssp             CSSCCHHHHHHHHTTSCGGGTTCCCEEEEEHHHHCSCHHHHHHHHTTCCSCEEEEEEETTSCEEEEEESSCCCCCSSCBC
T ss_pred             CCcCCHHHHHHHHHHCchhhccCCCeEEEEeccCCccHHHHHHHhcCCCCCEEEEEEcCCceEEEEEeCCcccccCcccC
Confidence            48999999999999999985 48999999999999999999999998 69999999999999999999999999999999


Q ss_pred             CCceEEEEecCCCcccccCCCCCceEEecCCCCCCCCceeecCCCCceeEEEeCCCCCceecccccccCCCCCCCCCCCe
Q psy18090        285 DQNSFLFTLKPDMKVFNSSGFNENFIYLNSNQQTLPNGLGFGGQFEYWGLWIDSEYGQGECNKTCSTFKDYQMLSHDKHF  364 (421)
Q Consensus       285 d~~~FLFsl~P~~~vy~~tg~n~~~~y~n~~~~~~p~Gl~fGg~~~~~~L~id~d~~~g~s~~~c~Tf~~~~~Ls~~~~F  364 (421)
                      +++||||++.|++++|+|++.|++|+|++.      +||+|||++++++||||++|.+|+|. +|+||+ ||+|+.+++|
T Consensus        85 ~~~sFLF~l~p~~~~y~~tg~N~~f~~~~~------~~l~~Ggg~g~~~L~id~~l~~G~s~-~c~Tf~-n~~L~~~~~F  156 (167)
T 4acj_A           85 TGETFLFTFYPEFEAYKWTGDNLFFIKGDM------DSLAFGGGSGEFGLWLDGDLYHGRNH-SCKTFG-NPMLSMKEDF  156 (167)
T ss_dssp             CTTCEEEECSSSCEEEECCSSCCCCEEEET------TEEEESCSSSSCSEEEETTSCEEEEC-CBTTTT-BCCSSSSSEE
T ss_pred             CCCeEEEEEcCCCccccccCCCceEEEeCC------CccccCCCCCceEEEEeCCCCCEEeC-CCCCCC-CcccCCCCce
Confidence            999999999999999999999999999984      79999999999999999999999997 899999 9999999999


Q ss_pred             eEEEEEEEEe
Q psy18090        365 KIMHIELWGV  374 (421)
Q Consensus       365 ~I~~iEVWg~  374 (421)
                      .|.+||||++
T Consensus       157 ~i~~vEvW~~  166 (167)
T 4acj_A          157 FVQDIEIWSF  166 (167)
T ss_dssp             EEEEEEEEEC
T ss_pred             EEEEEEEEEE
Confidence            9999999997
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query421
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.65
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.52
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.47
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.43
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.38
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.36
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.26
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.24
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 99.06
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 98.59
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 98.11
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.8
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 97.69
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.67
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 97.63
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 97.53
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 97.5
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 97.5
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 97.42
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 97.4
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.29
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 97.15
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 97.13
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 97.12
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 97.01
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 96.95
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 96.9
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 96.89
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 96.64
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 96.6
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 96.58
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 96.46
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 96.42
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 96.28
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 96.27
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 96.22
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 96.2
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 96.14
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 96.07
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 96.06
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 96.04
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 95.92
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 95.84
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 95.8
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 95.56
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 95.53
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 95.39
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 95.35
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 95.3
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 95.23
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 95.07
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 94.93
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 94.89
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 94.87
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 94.82
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 94.78
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 94.67
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 94.67
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 94.67
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 94.67
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 94.55
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 94.4
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 94.35
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 94.28
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.22
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 94.14
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 94.0
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 93.95
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 93.79
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 93.75
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 93.75
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 93.74
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 93.7
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 93.46
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 93.3
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 93.29
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 93.15
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 93.14
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 93.03
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 93.0
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 92.89
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 92.84
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 92.82
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 92.79
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 92.71
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 92.64
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 92.61
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 92.46
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 92.33
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 92.33
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 92.04
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 92.02
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 91.98
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 91.56
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 91.55
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 91.4
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 91.36
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 91.21
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 91.04
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 90.84
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 90.67
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 90.64
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 90.4
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 90.32
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 90.23
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 90.16
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 89.92
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 89.49
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 89.46
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 89.46
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 89.45
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 89.23
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 89.15
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 88.25
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 88.07
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 87.16
d1eg3a297 Dystrophin {Human (Homo sapiens) [TaxId: 9606]} 87.09
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 86.77
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 86.73
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 86.67
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 86.09
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 85.87
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 85.86
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 85.47
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 84.27
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 83.32
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 82.66
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 82.66
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 81.87
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Frequenin (neuronal calcium sensor 1)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.65  E-value=2.8e-16  Score=141.31  Aligned_cols=167  Identities=10%  Similarity=0.102  Sum_probs=130.3

Q ss_pred             CCCccccccCCCccccccccccCCccchHHH----hhhcCCCCcccHHHHHHHHHhhccchhHHHHHhhhcCC----CCC
Q psy18090          1 MGNEHSNKKQGSGSLKKNLSRKIKPEDVKKI----KSLTNGKDVLTKVDVFELWSMEIKDSLINFYLKYYFPD----KTE   72 (421)
Q Consensus         1 mgn~~~~~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~g~is~e~~~~~~~~~~~~~l~~~~~~~lF~~----~~~   72 (421)
                      |||..|+-.......=+...+| .+.|..++    .++ .++|.|+.++|.+++...++...+..++.++|+.    .+|
T Consensus         1 MG~~~S~l~~e~l~~l~~~t~f-s~~Ei~~l~~~F~~~-~~~G~i~~~ef~~~~~~~~~~~~~~~~~~~if~~~D~~~~G   78 (190)
T d1fpwa_           1 MGAKTSKLSKDDLTCLKQSTYF-DRREIQQWHKGFLRD-CPSGQLAREDFVKIYKQFFPFGSPEDFANHLFTVFDKDNNG   78 (190)
T ss_dssp             CCCCSCCSTTHHHHHHTTTCCS-THHHHHHHHHHHHHH-CTTCCEEHHHHHHHHHHHCTTSCCSHHHHHHHHTCCSSCSS
T ss_pred             CCCccCCCCHHHHHHHHHHcCC-CHHHHHHHHHHHHHH-CCCCCccHHHHHHHHHHHCCCCChHHHHHHHHHHhCcCCCC
Confidence            9999997321100000123456 77777777    223 4569999999999999999888888888888887    899


Q ss_pred             ceeHhHHHHHHHHhhCCCHHHHHHHHHHhhCCcc-------hHHHHHHHHHHhhhhhhcccchhhhhhcccCCCCcccHH
Q psy18090         73 KIDLSTFISLYYELDGSNIDRKVEILLCFIGSYG-------DLINYVQALLNSCLFIYQSRDDKELWSSLNIDSDKGSLI  145 (421)
Q Consensus        73 ~I~~e~Fv~~ls~~~rGt~eEk~~~i~~m~d~~~-------el~~~ve~lv~sv~~~l~~~~~~~~w~~~~~~~~~~~v~  145 (421)
                      .|+|++|+.+++.+.+++.+++++++|++||.++       |+..++..+...+....            ....++..++
T Consensus        79 ~I~~~Ef~~~~~~~~~~~~~e~~~~~F~~~D~d~dG~is~~E~~~~~~~~~~~~~~~~------------~~~~~~~~~~  146 (190)
T d1fpwa_          79 FIHFEEFITVLSTTSRGTLEEKLSWAFELYDLNHDGYITFDEMLTIVASVYKMMGSMV------------TLNEDEATPE  146 (190)
T ss_dssp             EECHHHHHHHHHHHSCCCSTHHHHHHHHHHCSSCSSEEEHHHHHHHHHHHHTTSCSTT------------SSSCCCCCHH
T ss_pred             cccHHHHHHHHHHHccCchHHHHHHHHHHhccCCCCcCcHHHHHHHHHHHHHhccccc------------CCCchhhhHH
Confidence            9999999999999999999999999999999987       67777766654332221            1334456788


Q ss_pred             HHHHHHhc---cCCCCccCHHHHHHHHhhchhHHHHHHH
Q psy18090        146 VYANYLCM---GDCNNEITFDSLQKWLSTTHEIAYLHKY  181 (421)
Q Consensus       146 ~la~~l~~---k~~d~~is~~ef~~Wl~~~P~i~~~L~~  181 (421)
                      ..++.+|.   ++.||.||++||..|++++|.|..+|+.
T Consensus       147 ~~v~~if~~~D~d~dG~Is~~EF~~~~~~~p~i~~~l~~  185 (190)
T d1fpwa_         147 MRVKKIFKLMDKNEDGYITLDEFREGSKVDPSIIGALNL  185 (190)
T ss_dssp             HHHHHHHHHHTTTCSSEEEHHHHHHHHHSSTTHHHHHHH
T ss_pred             HHHHHHHHHhCCCCCCcCcHHHHHHHHHHCHHHHHHhhh
Confidence            89999987   7889999999999999999999988774
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1eg3a2 a.39.1.7 (A:210-306) Dystrophin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure