Psyllid ID: psy18216


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------
MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLYGIYKIISISRRKSSGEKLKKS
cccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccHHHHHcccEEEEEEccccccccccccccEEEEccccccccccccHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEccccccccccccccEEEEEccccHHHHHHHHccccEEcccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccHHHHHHccccEEEccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccccHHHHHccccEEEEEEcccccccccccccEEEEccccccccccccHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEccccccccccccEEEEEccccccccccccEEEEEccccccHHHHHHccccEEEccccccccHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcccccccccccEEEEcccccccHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccccccEEEEEEEEEcccccHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSwlyqyprpvfpntinvgpthigdtkplpedLATWIEGAEKGVIYFSLgsnmrsasleesKRSAILTTFAKFPQYRVIWKWeeeqlpglpsnvicrkwlpqhdllahpkikLFITqgglqslqesvyfevpligipffgdqdyNVKIIKNlgigtymdfdsVSTEVLYNLMKEVLYNTSYMDTVKRISALSktqmmsprdTAVWWIEYVLKsggnlrhlqpdhwdmpwyqyfgLDVFLVLLSPVILVLYGIYKIIsrshpniklFITQGglqslqesvyfevpligipffgdqdyNVKIIKNlgigtymtfdsinaenlYSNVKEILYNNSYMDTVKRISALSktqmmsprdTAVWWIEYVLKsggnlrhlqpdywdmpwyqyygLDVFLVLLSPVILVLYGIYKIISISrrkssgeklkks
migftnkmTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISalsktqmmspRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLYGIYKIisisrrkssgeklkks
MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLygiykiisisrrkssgEKLKKS
***FTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGS************SAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLYGIYKIISI*************
**GFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLYGIYKIISISRRK**GE*****
MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLYGIYKIISIS************
*****NKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLYGIYKIISISRRKS********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
oooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFLVLLSPVILVLYGIYKIISRSHPNIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMTFDSINAENLYSNVKEILYNNSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDYWDMPWYQYYGLDVFLVLLSPVILVLYGIYKIISISRRKSSGEKLKKS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query487 2.2.26 [Sep-21-2011]
O02663529 UDP-glucuronosyltransfera N/A N/A 0.642 0.591 0.354 2e-55
O97951529 UDP-glucuronosyltransfera N/A N/A 0.642 0.591 0.347 3e-54
P36537528 UDP-glucuronosyltransfera yes N/A 0.642 0.592 0.344 1e-53
P16662529 UDP-glucuronosyltransfera no N/A 0.642 0.591 0.338 3e-53
Q9GLD9529 UDP-glucuronosyltransfera no N/A 0.642 0.591 0.338 3e-53
Q9XT55528 UDP-glucuronosyltransfera N/A N/A 0.642 0.592 0.338 1e-52
Q9TSL6529 UDP-glucuronosyltransfera N/A N/A 0.642 0.591 0.335 3e-52
P36512531 UDP-glucuronosyltransfera no N/A 0.642 0.589 0.347 3e-52
O75310529 UDP-glucuronosyltransfera no N/A 0.642 0.591 0.341 8e-52
P06133528 UDP-glucuronosyltransfera no N/A 0.642 0.592 0.335 1e-51
>sp|O02663|UD2B9_MACFA UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis GN=UGT2B9 PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (551), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 114/322 (35%), Positives = 188/322 (58%), Gaps = 9/322 (2%)

Query: 1   MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPT-IQEMARNKS 59
           M   +++MTF+ER++N +++    FY     ++  ++    Y    G+PT + E      
Sbjct: 198 MSELSDQMTFMERVKNMIYMLSFDFYFQMYDMKKWDQF---YSEVLGRPTTLSETMGKAD 254

Query: 60  ILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGA-EKGVIYFSLGSNMR 118
           I L+ NSW +Q+P P+ PN   VG  H    KPLP+++  +++ + E GV+ FSLGS + 
Sbjct: 255 IWLIRNSWNFQFPHPLLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMV- 313

Query: 119 SASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLF 178
             ++EE + + I +  A+ PQ +V+W+++ ++   L  N    KW+PQ+DLL HPK + F
Sbjct: 314 -TNMEEERANVIASALAQIPQ-KVLWRFDGKKPDTLGLNTRLYKWIPQNDLLGHPKTRAF 371

Query: 179 ITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKE 238
           IT GG   + E++Y  VP++GIP F DQ  N+  +K  G    +DFD++S+  L N +K 
Sbjct: 372 ITHGGANGIYEAIYHGVPMVGIPLFADQPDNIAHMKTKGAAVRLDFDTMSSTDLANRLKT 431

Query: 239 VLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFG 298
           V+ +  Y + V ++S +   Q + P D AV+WIE+V++  G  +HL+P   D+ W+QY  
Sbjct: 432 VINDPLYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGA-KHLRPAAHDLTWFQYHS 490

Query: 299 LDVFLVLLSPVILVLYGIYKII 320
           LDV   LL+ V  V++ I K  
Sbjct: 491 LDVIGFLLACVATVIFVIMKCC 512




UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on C18, C19, and C21 steroids, bile acids, and several xenobiotics including eugenol, 1-naphthol, and p-nitrophenol.
Macaca fascicularis (taxid: 9541)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
>sp|O97951|UDB18_MACFA UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis GN=UGT2B18 PE=1 SV=1 Back     alignment and function description
>sp|P36537|UDB10_HUMAN UDP-glucuronosyltransferase 2B10 OS=Homo sapiens GN=UGT2B10 PE=1 SV=1 Back     alignment and function description
>sp|P16662|UD2B7_HUMAN UDP-glucuronosyltransferase 2B7 OS=Homo sapiens GN=UGT2B7 PE=1 SV=1 Back     alignment and function description
>sp|Q9GLD9|UDB33_MACMU UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta GN=UGT2B33 PE=1 SV=1 Back     alignment and function description
>sp|Q9XT55|UDB19_MACFA UDP-glucuronosyltransferase 2B19 OS=Macaca fascicularis GN=UGT2B19 PE=1 SV=1 Back     alignment and function description
>sp|Q9TSL6|UDB23_MACFA UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis GN=UGT2B23 PE=1 SV=1 Back     alignment and function description
>sp|P36512|UDB13_RABIT UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus GN=UGT2B13 PE=2 SV=1 Back     alignment and function description
>sp|O75310|UDB11_HUMAN UDP-glucuronosyltransferase 2B11 OS=Homo sapiens GN=UGT2B11 PE=2 SV=1 Back     alignment and function description
>sp|P06133|UD2B4_HUMAN UDP-glucuronosyltransferase 2B4 OS=Homo sapiens GN=UGT2B4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query487
91090210528 PREDICTED: similar to glucosyl/glucurono 0.652 0.602 0.438 2e-68
189240912526 PREDICTED: similar to glucosyl/glucurono 0.646 0.598 0.430 6e-66
189240910518 PREDICTED: similar to glucosyl/glucurono 0.609 0.573 0.44 8e-66
270013464530 hypothetical protein TcasGA2_TC012063 [T 0.646 0.594 0.430 8e-66
443419062517 glucosyl glucuronosyl transferases [Locu 0.652 0.615 0.400 2e-65
91090214519 PREDICTED: similar to glucosyl/glucurono 0.620 0.581 0.422 1e-64
242013333522 UDP-glucuronosyltransferase 1-8 precurso 0.648 0.605 0.411 2e-64
270013462 983 hypothetical protein TcasGA2_TC012061 [T 0.611 0.303 0.440 2e-64
189240914524 PREDICTED: similar to glucosyl/glucurono 0.611 0.568 0.440 2e-64
195111354483 GI10119 [Drosophila mojavensis] gi|19391 0.620 0.625 0.405 1e-61
>gi|91090210|ref|XP_967762.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] gi|270013463|gb|EFA09911.1| hypothetical protein TcasGA2_TC012062 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  266 bits (681), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 143/326 (43%), Positives = 199/326 (61%), Gaps = 8/326 (2%)

Query: 1   MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSI 60
           M  ++  MTF ERL N +   F     N +V   QN+L KKY  +  +  + ++  N SI
Sbjct: 191 MSDYSVPMTFCERLVNSLVYVFNDLLYNFIVFPKQNQLMKKYIPNAPE-HLSDVLYNSSI 249

Query: 61  LLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSA 120
           +LL +      P P  PN I +G  HI   K LP+DL  +++GA+ G+IYFS+GSN++SA
Sbjct: 250 VLLNSHPSINQPVPHVPNMIEIGGFHIKPPKKLPQDLQEFLDGAKDGIIYFSMGSNLKSA 309

Query: 121 SLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFIT 180
            L   KR AIL TFAK  Q +++WKWEE+ LPG P NV   KWLPQ +LLAHP ++LFIT
Sbjct: 310 DLPNDKRDAILKTFAKLKQ-KILWKWEEDDLPGKPPNVKTAKWLPQQELLAHPNVRLFIT 368

Query: 181 QGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVL 240
            GGL S  E++Y  VP++ IP FGDQ  N +     G G Y+ FD +S E L N + ++L
Sbjct: 369 HGGLLSTTETIYHGVPILAIPIFGDQKINARSAVTSGYGVYLAFDKLSEETLTNSINQIL 428

Query: 241 YNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLD 300
            N  Y + V+  S L   +++SP DTA++W+EYV++  G   HL+    D+PWY+Y  LD
Sbjct: 429 NNKKYKENVQMRSRLFHDRLVSPLDTAIYWVEYVIRHRG-APHLRVAALDLPWYKYLLLD 487

Query: 301 VF----LVLLSPVILVLYGIYKIISR 322
           V     LVLLS +++  Y I K+I R
Sbjct: 488 VIAVIALVLLSSLLIFCY-IVKLIGR 512




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189240912|ref|XP_967685.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240910|ref|XP_967606.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] gi|270013465|gb|EFA09913.1| hypothetical protein TcasGA2_TC012064 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270013464|gb|EFA09912.1| hypothetical protein TcasGA2_TC012063 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|443419062|gb|AGC84403.1| glucosyl glucuronosyl transferases [Locusta migratoria] Back     alignment and taxonomy information
>gi|91090214|ref|XP_967924.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242013333|ref|XP_002427365.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] gi|212511724|gb|EEB14627.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270013462|gb|EFA09910.1| hypothetical protein TcasGA2_TC012061 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240914|ref|XP_967845.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195111354|ref|XP_002000244.1| GI10119 [Drosophila mojavensis] gi|193916838|gb|EDW15705.1| GI10119 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query487
FB|FBgn0040256517 Ugt86Dd "Ugt86Dd" [Drosophila 0.628 0.591 0.418 7.1e-61
FB|FBgn0026314516 Ugt35b "UDP-glycosyltransferas 0.652 0.616 0.408 5e-60
FB|FBgn0040259528 Ugt86Da "Ugt86Da" [Drosophila 0.650 0.600 0.373 2.5e-58
FB|FBgn0026315537 Ugt35a "UDP-glycosyltransferas 0.644 0.584 0.396 7.5e-57
FB|FBgn0038886537 CG6475 [Drosophila melanogaste 0.657 0.595 0.373 1.6e-56
FB|FBgn0040257521 Ugt86Dc "Ugt86Dc" [Drosophila 0.650 0.608 0.372 2.6e-54
UNIPROTKB|E1BJU8529 UGT2B17 "Uncharacterized prote 0.628 0.578 0.362 3.4e-54
UNIPROTKB|I3LR26529 LOC100515741 "Uncharacterized 0.634 0.584 0.355 3.4e-54
UNIPROTKB|F1RUQ8529 LOC100738495 "Uncharacterized 0.634 0.584 0.352 8.9e-54
FB|FBgn0027073532 CG4302 [Drosophila melanogaste 0.650 0.595 0.380 1.5e-53
FB|FBgn0040256 Ugt86Dd "Ugt86Dd" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 623 (224.4 bits), Expect = 7.1e-61, P = 7.1e-61
 Identities = 130/311 (41%), Positives = 190/311 (61%)

Query:     5 TNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLT 64
             T++MTFLERL+N+  +     + + V +     + KKYF +  K T++E+  + S++LL 
Sbjct:   184 TDRMTFLERLENHYEVIVEDIHRHFVHLPHMRNVYKKYFPNA-KKTLEEVMDSFSLILLG 242

Query:    65 NSWLYQYPRPVFPNTINVGPTHIGDT-KPLPEDLATWIEGAEKGVIYFSLGSNMRSASLE 123
               +   YPRP  PN I VG  HI    KPLPED+  +IEG+  GVIYFS+GSN++S  L 
Sbjct:   243 QHFSLSYPRPYLPNMIEVGGMHISHKPKPLPEDIKQFIEGSPHGVIYFSMGSNVKSKDLP 302

Query:   124 ESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGG 183
             +  R  +L TFAK  Q RV+WK+E++ +PG P+NV+ +KW PQ D+LAHP +KLFI+ GG
Sbjct:   303 QETRDTLLKTFAKLKQ-RVLWKFEDDDMPGKPANVLIKKWYPQPDILAHPNVKLFISHGG 361

Query:   184 LQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNT 243
             L S  ESVYF  P++G+P F DQ  NV+  + +G G  +D +++  E L   ++ +L + 
Sbjct:   362 LLSSTESVYFGKPILGLPCFYDQHMNVQRAQRVGFGLGLDLNNLKQEDLEKAIQTLLTDP 421

Query:   244 SYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFGLDVFL 303
             SY      IS   + Q  S  D AVWW EYV++  G   HL+    D+ + Q   LD   
Sbjct:   422 SYAKASLAISERYRDQPQSAVDRAVWWTEYVIRHNG-APHLRATSRDLNFIQLNSLDTLA 480

Query:   304 VLLS-PVILVL 313
             V+L+ P++L L
Sbjct:   481 VILAVPLLLAL 491


GO:0015020 "glucuronosyltransferase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
FB|FBgn0026314 Ugt35b "UDP-glycosyltransferase 35b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040259 Ugt86Da "Ugt86Da" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0026315 Ugt35a "UDP-glycosyltransferase 35a" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038886 CG6475 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040257 Ugt86Dc "Ugt86Dc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJU8 UGT2B17 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LR26 LOC100515741 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RUQ8 LOC100738495 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0027073 CG4302 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.691

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 9e-67
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 2e-56
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 5e-29
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 2e-27
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 9e-20
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 3e-18
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 3e-17
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 7e-12
PLN02167475 PLN02167, PLN02167, UDP-glycosyltransferase family 6e-09
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 2e-08
PLN02207468 PLN02207, PLN02207, UDP-glycosyltransferase 2e-08
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 3e-08
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 7e-08
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 8e-08
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 2e-07
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 7e-07
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 1e-06
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 5e-06
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 1e-05
PLN02555480 PLN02555, PLN02555, limonoid glucosyltransferase 2e-04
PLN02863477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 3e-04
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 3e-04
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 6e-04
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 0.002
PLN02764453 PLN02764, PLN02764, glycosyltransferase family pro 0.002
PLN03007482 PLN03007, PLN03007, UDP-glucosyltransferase family 0.002
PLN02670472 PLN02670, PLN02670, transferase, transferring glyc 0.002
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 0.003
PLN02562448 PLN02562, PLN02562, UDP-glycosyltransferase 0.003
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 0.004
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
 Score =  222 bits (568), Expect = 9e-67
 Identities = 110/320 (34%), Positives = 183/320 (57%), Gaps = 10/320 (3%)

Query: 1   MIGFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKP-TIQEMARNKS 59
           +   ++ MTF ER++N + + +  F+  R   +  ++ A +     G+P T+ E+    S
Sbjct: 173 LSDLSDGMTFGERVKNMLIMLYFDFWFQRF-PKKWDQFASELL---GRPVTLPELMSKAS 228

Query: 60  ILLLTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIE-GAEKGVIYFSLGSNMR 118
             LL N W  ++PRP+ PN   +G  +    KPLP+++  +++   E GV+ FSLGS M 
Sbjct: 229 AWLLRNYWDLEFPRPLLPNMEFIGGLNCKPAKPLPQEMEAFVQSSGEHGVVVFSLGS-MV 287

Query: 119 SASLEESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPSNVICRKWLPQHDLLAHPKIKLF 178
           S   EE K + I +  A+ PQ +V+W+++  +   L  N    KWLPQ+DLL HPK + F
Sbjct: 288 SNIPEE-KANEIASALAQIPQ-KVLWRFDGTKPSTLGRNTRLVKWLPQNDLLGHPKTRAF 345

Query: 179 ITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLMKE 238
           +T  G   + E++   VP++G+P FGDQ  N K ++  G    ++  ++++E L N +K 
Sbjct: 346 VTHAGSNGVYEAICHGVPMVGMPLFGDQMDNAKHMEAKGAAVTLNVLTMTSEDLLNALKT 405

Query: 239 VLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSGGNLRHLQPDHWDMPWYQYFG 298
           V+ + SY + + R+S++   Q + P D AV+WIE+V++  G  +HL+P   D+ WYQY  
Sbjct: 406 VINDPSYKENIMRLSSIHHDQPVKPLDRAVFWIEFVMRHKGA-KHLRPAAHDLTWYQYHS 464

Query: 299 LDVFLVLLSPVILVLYGIYK 318
           LDV   LL+ V  V +  +K
Sbjct: 465 LDVIGFLLACVATVAFITFK 484


Length = 500

>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 487
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 100.0
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 100.0
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 100.0
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 100.0
KOG1192|consensus496 100.0
PLN02207468 UDP-glycosyltransferase 99.97
PLN02670472 transferase, transferring glycosyl groups 99.97
PLN02208442 glycosyltransferase family protein 99.97
PLN02562448 UDP-glycosyltransferase 99.97
PLN02554481 UDP-glycosyltransferase family protein 99.96
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.96
PLN03004451 UDP-glycosyltransferase 99.96
PLN02167475 UDP-glycosyltransferase family protein 99.96
PLN02992481 coniferyl-alcohol glucosyltransferase 99.95
KOG1192|consensus496 99.95
PLN02555480 limonoid glucosyltransferase 99.95
PLN02764453 glycosyltransferase family protein 99.95
PLN03007482 UDP-glucosyltransferase family protein 99.95
PLN02210456 UDP-glucosyl transferase 99.95
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.95
PLN03015470 UDP-glucosyl transferase 99.95
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.95
PLN00414446 glycosyltransferase family protein 99.95
PLN00164480 glucosyltransferase; Provisional 99.94
PLN02448459 UDP-glycosyltransferase family protein 99.94
PLN02173449 UDP-glucosyl transferase family protein 99.93
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.93
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.93
PLN02534491 UDP-glycosyltransferase 99.92
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.9
PLN02670472 transferase, transferring glycosyl groups 99.88
PLN02208442 glycosyltransferase family protein 99.85
PLN02554481 UDP-glycosyltransferase family protein 99.83
PLN02207468 UDP-glycosyltransferase 99.82
PLN03004451 UDP-glycosyltransferase 99.81
PLN02562448 UDP-glycosyltransferase 99.8
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.8
PLN02764453 glycosyltransferase family protein 99.79
PLN02992481 coniferyl-alcohol glucosyltransferase 99.79
PLN02555480 limonoid glucosyltransferase 99.77
PLN02210456 UDP-glucosyl transferase 99.77
PLN02167475 UDP-glycosyltransferase family protein 99.76
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.76
PLN00414446 glycosyltransferase family protein 99.76
PLN02173449 UDP-glucosyl transferase family protein 99.76
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.76
PLN00164480 glucosyltransferase; Provisional 99.75
PLN02448459 UDP-glycosyltransferase family protein 99.75
PLN03007482 UDP-glucosyltransferase family protein 99.74
PLN03015470 UDP-glucosyl transferase 99.73
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.72
PLN02534491 UDP-glycosyltransferase 99.68
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.6
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.54
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.31
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.29
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.27
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.21
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.2
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.17
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.14
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.13
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.1
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.01
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 98.98
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 98.89
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 98.81
PRK13608391 diacylglycerol glucosyltransferase; Provisional 98.67
PRK13609380 diacylglycerol glucosyltransferase; Provisional 98.6
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 98.58
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 98.56
COG4671400 Predicted glycosyl transferase [General function p 98.54
PRK13608391 diacylglycerol glucosyltransferase; Provisional 98.45
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 98.38
PLN02605382 monogalactosyldiacylglycerol synthase 98.32
PLN02605382 monogalactosyldiacylglycerol synthase 98.2
PRK13609380 diacylglycerol glucosyltransferase; Provisional 98.18
TIGR03492396 conserved hypothetical protein. This protein famil 98.18
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 98.1
KOG3349|consensus170 98.1
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 97.89
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 97.85
TIGR03492396 conserved hypothetical protein. This protein famil 97.84
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 97.82
COG4671400 Predicted glycosyl transferase [General function p 97.72
COG5017161 Uncharacterized conserved protein [Function unknow 97.64
KOG3349|consensus170 97.45
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 97.42
cd03814364 GT1_like_2 This family is most closely related to 97.41
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 97.25
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 97.21
cd03823359 GT1_ExpE7_like This family is most closely related 97.08
cd03795357 GT1_like_4 This family is most closely related to 97.06
cd03801374 GT1_YqgM_like This family is most closely related 96.97
cd03800398 GT1_Sucrose_synthase This family is most closely r 96.97
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 96.94
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 96.91
cd03814364 GT1_like_2 This family is most closely related to 96.84
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 96.83
cd03794394 GT1_wbuB_like This family is most closely related 96.82
PRK14089347 ipid-A-disaccharide synthase; Provisional 96.78
cd04946407 GT1_AmsK_like This family is most closely related 96.78
COG5017161 Uncharacterized conserved protein [Function unknow 96.69
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 96.67
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 96.67
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 96.66
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 96.65
cd03820348 GT1_amsD_like This family is most closely related 96.57
cd03821375 GT1_Bme6_like This family is most closely related 96.55
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 96.55
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 96.55
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 96.52
cd03804351 GT1_wbaZ_like This family is most closely related 96.5
cd03820348 GT1_amsD_like This family is most closely related 96.5
cd03817374 GT1_UGDG_like This family is most closely related 96.41
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 96.4
cd03801374 GT1_YqgM_like This family is most closely related 96.35
cd03822366 GT1_ecORF704_like This family is most closely rela 96.35
cd03798377 GT1_wlbH_like This family is most closely related 96.34
cd03808359 GT1_cap1E_like This family is most closely related 96.33
cd03808359 GT1_cap1E_like This family is most closely related 96.11
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 96.08
PRK10307412 putative glycosyl transferase; Provisional 96.08
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 96.02
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 96.02
cd04962371 GT1_like_5 This family is most closely related to 96.02
cd03822366 GT1_ecORF704_like This family is most closely rela 96.0
cd03807365 GT1_WbnK_like This family is most closely related 96.0
cd03794394 GT1_wbuB_like This family is most closely related 95.97
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 95.95
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 95.83
cd03795357 GT1_like_4 This family is most closely related to 95.75
cd03807365 GT1_WbnK_like This family is most closely related 95.73
cd03823359 GT1_ExpE7_like This family is most closely related 95.73
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 95.68
cd03818396 GT1_ExpC_like This family is most closely related 95.65
cd04949372 GT1_gtfA_like This family is most closely related 95.64
cd03825365 GT1_wcfI_like This family is most closely related 95.6
cd04962371 GT1_like_5 This family is most closely related to 95.59
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 95.56
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 95.5
cd03800398 GT1_Sucrose_synthase This family is most closely r 95.5
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 95.46
cd03811353 GT1_WabH_like This family is most closely related 95.46
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 95.44
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 95.42
cd03805392 GT1_ALG2_like This family is most closely related 95.41
cd03816415 GT1_ALG1_like This family is most closely related 95.39
cd03821375 GT1_Bme6_like This family is most closely related 95.36
cd04951360 GT1_WbdM_like This family is most closely related 95.27
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 95.27
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 95.2
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 95.03
cd04946407 GT1_AmsK_like This family is most closely related 95.02
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 95.02
cd03798377 GT1_wlbH_like This family is most closely related 94.99
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 94.97
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 94.94
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 94.89
cd03813475 GT1_like_3 This family is most closely related to 94.88
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 94.78
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 94.75
cd04949372 GT1_gtfA_like This family is most closely related 94.75
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 94.72
cd03818396 GT1_ExpC_like This family is most closely related 94.72
cd03825365 GT1_wcfI_like This family is most closely related 94.68
cd03809365 GT1_mtfB_like This family is most closely related 94.64
cd03812358 GT1_CapH_like This family is most closely related 94.56
cd03817374 GT1_UGDG_like This family is most closely related 94.34
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 94.19
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 94.18
PRK14089347 ipid-A-disaccharide synthase; Provisional 94.16
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 94.12
cd04955363 GT1_like_6 This family is most closely related to 94.08
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 93.7
cd04951360 GT1_WbdM_like This family is most closely related 93.7
cd03796398 GT1_PIG-A_like This family is most closely related 93.67
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 93.65
cd03812358 GT1_CapH_like This family is most closely related 93.46
cd03819355 GT1_WavL_like This family is most closely related 93.46
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 93.44
cd03816415 GT1_ALG1_like This family is most closely related 93.39
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 93.32
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 93.26
cd03811353 GT1_WabH_like This family is most closely related 93.21
cd03813475 GT1_like_3 This family is most closely related to 93.17
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 93.09
PRK10307412 putative glycosyl transferase; Provisional 92.9
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 92.87
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 92.61
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 92.4
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 92.01
cd03804351 GT1_wbaZ_like This family is most closely related 91.83
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 91.72
cd03819355 GT1_WavL_like This family is most closely related 91.56
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 91.35
PF0672297 DUF1205: Protein of unknown function (DUF1205); In 91.35
cd03802335 GT1_AviGT4_like This family is most closely relate 91.3
cd03809365 GT1_mtfB_like This family is most closely related 91.16
PLN02275371 transferase, transferring glycosyl groups 91.02
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 90.61
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 90.48
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 90.26
PHA01633335 putative glycosyl transferase group 1 89.99
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 89.99
PHA01630331 putative group 1 glycosyl transferase 89.17
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 88.8
cd04955363 GT1_like_6 This family is most closely related to 88.46
cd03796398 GT1_PIG-A_like This family is most closely related 88.33
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 88.3
PHA01633335 putative glycosyl transferase group 1 88.08
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 87.8
cd03805392 GT1_ALG2_like This family is most closely related 87.68
PHA01630331 putative group 1 glycosyl transferase 87.55
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 87.36
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 87.3
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 86.96
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 86.95
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 86.8
PRK10017426 colanic acid biosynthesis protein; Provisional 86.64
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 85.98
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 85.72
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 84.85
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 84.62
PLN00142815 sucrose synthase 84.33
PLN02275371 transferase, transferring glycosyl groups 84.09
TIGR02470784 sucr_synth sucrose synthase. This model represents 83.09
KOG4626|consensus966 83.09
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 83.06
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 82.99
PRK14098489 glycogen synthase; Provisional 82.41
PRK10125405 putative glycosyl transferase; Provisional 81.75
PLN02949463 transferase, transferring glycosyl groups 81.42
PRK00654466 glgA glycogen synthase; Provisional 80.86
cd03802335 GT1_AviGT4_like This family is most closely relate 80.83
cd03806419 GT1_ALG11_like This family is most closely related 80.67
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 80.34
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
Probab=100.00  E-value=5.2e-56  Score=462.43  Aligned_cols=300  Identities=29%  Similarity=0.537  Sum_probs=274.8

Q ss_pred             CCCCCCCCCHHHHHHHHHHH-HHHHHHHHHhcchhHHHHHHHHcCCCCCCCHHHHhhcccEEEEccCCCCCCCCCCCCCe
Q psy18216          1 MIGFTNKMTFLERLQNYVFI-FFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILLLTNSWLYQYPRPVFPNT   79 (487)
Q Consensus         1 ~~~~~~~~~~~~R~~n~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~el~~~~~l~lv~s~~~l~~~~~~~p~~   79 (487)
                      +++++++|||+||++|.+.+ ..........  +.++++++++||.+ .|++.++.++.+++|+|+++.+|+|+|++||+
T Consensus       191 ~~~~~~~Msf~~R~~N~~~~~~~~~~~~~~~--~~~~~l~~~~f~~~-~~~~~~l~~~~~l~lvns~~~~d~~rp~~p~v  267 (507)
T PHA03392        191 WRSKFGNLNVWETINEIYTELRLYNEFSLLA--DEQNKLLKQQFGPD-TPTIRELRNRVQLLFVNVHPVFDNNRPVPPSV  267 (507)
T ss_pred             ccCCCCCCCHHHHHHHHHHHHHHHHHHHHhh--HHHHHHHHHHcCCC-CCCHHHHHhCCcEEEEecCccccCCCCCCCCe
Confidence            46889999999999999877 4444433333  78899999999865 58899999999999999999999999999999


Q ss_pred             eeeCCcccCC--CCCCchhHHhhhccCCCeEEEEEcCccccCCCccHHHHHHHHHHHhhCCCceEEEEEcCCCCC-CCCC
Q psy18216         80 INVGPTHIGD--TKPLPEDLATWIEGAEKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEEQLP-GLPS  156 (487)
Q Consensus        80 ~~iG~~~~~~--~~~l~~~l~~~l~~~~~~~V~vs~Gs~~~~~~~~~~~~~~~~~a~~~~~~~~vI~~~~~~~~~-~~~~  156 (487)
                      ++|||++.++  .+++|+++.+|++++++++||+||||......++.+.++.+++++++++. +|||+++++... ..|+
T Consensus       268 ~~vGgi~~~~~~~~~l~~~l~~fl~~~~~g~V~vS~GS~~~~~~~~~~~~~~~l~a~~~l~~-~viw~~~~~~~~~~~p~  346 (507)
T PHA03392        268 QYLGGLHLHKKPPQPLDDYLEEFLNNSTNGVVYVSFGSSIDTNDMDNEFLQMLLRTFKKLPY-NVLWKYDGEVEAINLPA  346 (507)
T ss_pred             eeecccccCCCCCCCCCHHHHHHHhcCCCcEEEEECCCCCcCCCCCHHHHHHHHHHHHhCCC-eEEEEECCCcCcccCCC
Confidence            9999998743  36889999999998877899999999886556789999999999999997 999999865554 6899


Q ss_pred             cEEEeeccchhhhhcCCCcceeeccCCchhHHHhHhcCCCEEeccccCChHHHHHHHHHcCcEEEEeccCCCHHHHHHHH
Q psy18216        157 NVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKIIKNLGIGTYMDFDSVSTEVLYNLM  236 (487)
Q Consensus       157 nv~~~~~~pq~~lL~~p~~~~~IthgG~~s~~eal~~gvP~i~iP~~~DQ~~na~rv~~~g~g~~l~~~~~~~~~l~~ai  236 (487)
                      |+++.+|+||.++|.||++++||||||.||+.||+++|||++++|+++||+.||+|++++|+|+.++..+++.+++.+++
T Consensus       347 Nv~i~~w~Pq~~lL~hp~v~~fItHGG~~s~~Eal~~GvP~v~iP~~~DQ~~Na~rv~~~G~G~~l~~~~~t~~~l~~ai  426 (507)
T PHA03392        347 NVLTQKWFPQRAVLKHKNVKAFVTQGGVQSTDEAIDALVPMVGLPMMGDQFYNTNKYVELGIGRALDTVTVSAAQLVLAI  426 (507)
T ss_pred             ceEEecCCCHHHHhcCCCCCEEEecCCcccHHHHHHcCCCEEECCCCccHHHHHHHHHHcCcEEEeccCCcCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999998899999999999


Q ss_pred             HHHHhCCChhHHHHHHHHHhhccCCChhhHHHHHHHHHHHhC-CCccCCCCCCCCCChhhhhhhhHHhhh
Q psy18216        237 KEVLYNTSYMDTVKRISALSKTQMMSPRDTAVWWIEYVLKSG-GNLRHLQPDHWDMPWYQYFGLDVFLVL  305 (487)
Q Consensus       237 ~~vl~~~~~~~~a~~~s~~~~~~~~~~~~~a~~~ie~vi~~g-g~~~hl~~~~~~l~~~~~~~lD~~~~~  305 (487)
                      +++++||+|+++|+++++.++++|.+|.++|++|+|++++++ | +.|+++++.+|+|++|++||+++++
T Consensus       427 ~~vl~~~~y~~~a~~ls~~~~~~p~~~~~~av~~iE~v~r~~~g-~~~lr~~~~~l~~~qy~~lDv~~~~  495 (507)
T PHA03392        427 VDVIENPKYRKNLKELRHLIRHQPMTPLHKAIWYTEHVIRNKHG-NTSLKTKAANVSYSDYFMSYILVPL  495 (507)
T ss_pred             HHHhCCHHHHHHHHHHHHHHHhCCCCHHHHHHHHHHHHHhCCCC-cccccccccCCCHHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999999 9 9999999999999999999997544



>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>PF06722 DUF1205: Protein of unknown function (DUF1205); InterPro: IPR010610 This entry represents a conserved region of unknown function within bacterial glycosyl transferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 2e-27
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 4e-10
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 2e-09
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 6e-05
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 4e-09
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 1e-05
2iyf_A430 The Crystal Structure Of Macrolide Glycosyltransfer 1e-07
3hbf_A454 Structure Of Ugt78g1 Complexed With Myricetin And U 2e-07
2pq6_A482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 2e-07
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 8e-06
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 8e-06
2vce_A480 Characterization And Engineering Of The Bifunctiona 4e-04
3ia7_A402 Crystal Structure Of Calg4, The Calicheamicin Glyco 4e-04
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure

Iteration: 1

Score = 120 bits (301), Expect = 2e-27, Method: Compositional matrix adjust. Identities = 59/167 (35%), Positives = 99/167 (59%), Gaps = 4/167 (2%) Query: 90 TKPLPEDLATWIEGA-EKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEE 148 KPLP++ +++ + E GV+ FSLGS + + + E + + I + A+ PQ +V+W+++ Sbjct: 4 AKPLPKEXEDFVQSSGENGVVVFSLGSXVSNXT--EERANVIASALAQIPQ-KVLWRFDG 60 Query: 149 EQLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDY 208 + L N KW+PQ+DLL HPK + FIT GG + E++Y +P +GIP F DQ Sbjct: 61 NKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPXVGIPLFADQPD 120 Query: 209 NVKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISAL 255 N+ K G +DF++ S+ L N +K V+ + SY + V ++S + Sbjct: 121 NIAHXKARGAAVRVDFNTXSSTDLLNALKRVINDPSYKENVXKLSRI 167
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 Back     alignment and structure
>pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 Back     alignment and structure
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure
>pdb|3IA7|A Chain A, Crystal Structure Of Calg4, The Calicheamicin Glycosyltransferase Length = 402 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query487
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 2e-74
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 6e-32
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 3e-48
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 7e-20
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 5e-46
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 3e-20
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 3e-35
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 4e-14
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 3e-34
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 3e-14
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 5e-30
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 1e-10
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 5e-27
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 1e-09
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 9e-27
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 7e-11
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 1e-26
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 2e-09
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 2e-23
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 8e-09
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 3e-23
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 3e-09
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 1e-20
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 4e-07
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 7e-19
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 2e-08
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 3e-17
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 2e-05
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 4e-12
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 5e-04
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 2e-11
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 2e-09
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 5e-04
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 7e-09
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 1e-08
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 8e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-04
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  230 bits (590), Expect = 2e-74
 Identities = 59/166 (35%), Positives = 103/166 (62%), Gaps = 4/166 (2%)

Query: 91  KPLPEDLATWIEGA-EKGVIYFSLGSNMRSASLEESKRSAILTTFAKFPQYRVIWKWEEE 149
           KPLP+++  +++ + E GV+ FSLGS + +  + E + + I +  A+ PQ +V+W+++  
Sbjct: 5   KPLPKEMEDFVQSSGENGVVVFSLGSMVSN--MTEERANVIASALAQIPQ-KVLWRFDGN 61

Query: 150 QLPGLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYN 209
           +   L  N    KW+PQ+DLL HPK + FIT GG   + E++Y  +P++GIP F DQ  N
Sbjct: 62  KPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDN 121

Query: 210 VKIIKNLGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISAL 255
           +  +K  G    +DF+++S+  L N +K V+ + SY + V ++S +
Sbjct: 122 IAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRI 167


>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query487
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.97
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 99.97
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.96
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.96
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.96
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.96
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.95
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.94
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.93
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.93
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.89
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.88
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.87
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.85
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.85
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.84
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 99.8
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 99.79
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 99.78
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.77
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.77
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 99.76
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.74
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.74
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.73
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.7
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.7
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.7
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.68
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.64
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.64
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.63
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.59
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.53
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.49
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.49
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.48
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.47
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.41
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.39
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.37
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.32
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.3
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 98.9
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 98.86
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 98.64
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 98.56
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 98.18
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 98.04
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 97.73
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.63
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.54
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 97.5
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.38
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.35
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.24
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.09
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 97.07
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 96.97
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 96.94
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 96.85
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 96.85
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 96.84
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 96.79
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 96.65
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 96.57
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 96.51
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 96.51
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 96.42
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 96.38
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 96.27
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 96.12
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 96.12
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 96.04
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 95.96
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 95.87
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 95.84
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 95.78
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 95.74
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 95.63
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 95.57
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 95.48
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 95.31
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 95.15
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 95.04
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 94.93
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 94.79
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 94.71
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 94.66
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 94.18
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 94.13
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 93.39
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 93.35
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 93.32
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 93.12
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 93.06
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 91.36
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 90.76
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 90.55
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 90.4
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 90.0
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 89.81
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 89.53
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 86.29
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 85.94
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
Probab=99.97  E-value=5e-31  Score=271.02  Aligned_cols=200  Identities=21%  Similarity=0.380  Sum_probs=174.6

Q ss_pred             hcccEEEEccCCCCCCC-----CCCCCCeeeeCCcccCCCC---CCchhHHhhhccC-CCeEEEEEcCccccCCCccHHH
Q psy18216         56 RNKSILLLTNSWLYQYP-----RPVFPNTINVGPTHIGDTK---PLPEDLATWIEGA-EKGVIYFSLGSNMRSASLEESK  126 (487)
Q Consensus        56 ~~~~l~lv~s~~~l~~~-----~~~~p~~~~iG~~~~~~~~---~l~~~l~~~l~~~-~~~~V~vs~Gs~~~~~~~~~~~  126 (487)
                      .+++.+++||+++||++     ++..|++..|||++...+.   +-++++.+|++.. ++++||++|||...   ++.+.
T Consensus       214 ~~~~~vl~ns~~eLE~~~~~~~~~~~~~v~~vGPl~~~~~~~~~~~~~~~~~wLd~~~~~~vVyvsfGS~~~---~~~~~  290 (454)
T 3hbf_A          214 PRANAVAINSFATIHPLIENELNSKFKLLLNVGPFNLTTPQRKVSDEHGCLEWLDQHENSSVVYISFGSVVT---PPPHE  290 (454)
T ss_dssp             GGSSCEEESSCGGGCHHHHHHHHTTSSCEEECCCHHHHSCCSCCCCTTCHHHHHHTSCTTCEEEEECCSSCC---CCHHH
T ss_pred             ccCCEEEECChhHhCHHHHHHHHhcCCCEEEECCcccccccccccchHHHHHHHhcCCCCceEEEecCCCCc---CCHHH
Confidence            34789999999999986     6777899999998754322   2245799999976 57899999999985   56788


Q ss_pred             HHHHHHHHhhCCCceEEEEEcCCC---CCC-----CCCcEEEeeccchhhhhcCCCcceeeccCCchhHHHhHhcCCCEE
Q psy18216        127 RSAILTTFAKFPQYRVIWKWEEEQ---LPG-----LPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLI  198 (487)
Q Consensus       127 ~~~~~~a~~~~~~~~vI~~~~~~~---~~~-----~~~nv~~~~~~pq~~lL~~p~~~~~IthgG~~s~~eal~~gvP~i  198 (487)
                      ++++++++++.+. +|||.++++.   ++.     .++|+++.+|+||.++|.|+.+++||||||+||+.|++++|||+|
T Consensus       291 ~~el~~~l~~~~~-~flw~~~~~~~~~lp~~~~~~~~~~~~vv~w~Pq~~vL~h~~v~~fvtH~G~~S~~Eal~~GvP~i  369 (454)
T 3hbf_A          291 LTALAESLEECGF-PFIWSFRGDPKEKLPKGFLERTKTKGKIVAWAPQVEILKHSSVGVFLTHSGWNSVLECIVGGVPMI  369 (454)
T ss_dssp             HHHHHHHHHHHCC-CEEEECCSCHHHHSCTTHHHHTTTTEEEESSCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEE
T ss_pred             HHHHHHHHHhCCC-eEEEEeCCcchhcCCHhHHhhcCCceEEEeeCCHHHHHhhcCcCeEEecCCcchHHHHHHcCCCEe
Confidence            9999999999987 9999987643   221     357899999999999999999999999999999999999999999


Q ss_pred             eccccCChHHHHHHHHH-cCcEEEEeccCCCHHHHHHHHHHHHhCC---ChhHHHHHHHHHhhcc
Q psy18216        199 GIPFFGDQDYNVKIIKN-LGIGTYMDFDSVSTEVLYNLMKEVLYNT---SYMDTVKRISALSKTQ  259 (487)
Q Consensus       199 ~iP~~~DQ~~na~rv~~-~g~g~~l~~~~~~~~~l~~ai~~vl~~~---~~~~~a~~~s~~~~~~  259 (487)
                      ++|+++||+.||+++++ +|+|+.+....++.+.+.++|+++|+++   +|+++|+++++.+++.
T Consensus       370 ~~P~~~DQ~~Na~~v~~~~g~Gv~l~~~~~~~~~l~~av~~ll~~~~~~~~r~~a~~l~~~~~~a  434 (454)
T 3hbf_A          370 SRPFFGDQGLNTILTESVLEIGVGVDNGVLTKESIKKALELTMSSEKGGIMRQKIVKLKESAFKA  434 (454)
T ss_dssp             ECCCSTTHHHHHHHHHTTSCSEEECGGGSCCHHHHHHHHHHHHSSHHHHHHHHHHHHHHHHHHHH
T ss_pred             cCcccccHHHHHHHHHHhhCeeEEecCCCCCHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHHh
Confidence            99999999999999998 5999999877899999999999999876   7999999999999875



>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 487
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 3e-32
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 4e-18
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 4e-28
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 9e-13
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 5e-28
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 2e-12
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 5e-26
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 1e-09
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 6e-24
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 4e-11
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 4e-20
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 5e-10
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 2e-19
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 2e-09
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
 Score =  126 bits (315), Expect = 3e-32
 Identities = 53/289 (18%), Positives = 103/289 (35%), Gaps = 15/289 (5%)

Query: 3   GFTNKMTFLERLQNYVFIFFMHFYMNRVVIQGQNELAKKYFNHTGKPTIQEMARNKSILL 62
           G   +   L      +           +V    N L  +  +  G+   +  A   +   
Sbjct: 158 GIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRMLHRMGQVLPKATAVFINSFE 217

Query: 63  LTNSWLYQYPRPVFPNTINVGPTHIGDTKPLPEDLATWIEGAEKGVIYFSLGSNMRSASL 122
             +  L    +      +N+GP ++    P+  +    ++  ++      +  +  + + 
Sbjct: 218 ELDDSLTNDLKSKLKTYLNIGPFNLITPPPVVPNTTGCLQWLKERKPTSVVYISFGTVTT 277

Query: 123 EESKRSAILTTFAKFPQYRVIWKWEEEQLPGLPS--------NVICRKWLPQHDLLAHPK 174
                   L+   +  +   IW   ++    LP           +   W PQ ++LAH  
Sbjct: 278 PPPAEVVALSEALEASRVPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEA 337

Query: 175 IKLFITQGGLQSLQESVYFEVPLIGIPFFGDQDYNVKII-KNLGIGTYMDFDSVSTEVLY 233
           +  F+T  G  SL ESV   VPLI  PFFGDQ  N +++   L IG  ++    +   L 
Sbjct: 338 VGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLM 397

Query: 234 NLMKEVLYNTSYMDTVKRISALSKTQMM------SPRDTAVWWIEYVLK 276
           +   ++L         + + AL +T         S  +  +  ++ V K
Sbjct: 398 SCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVDLVSK 446


>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query487
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.96
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.95
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.95
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.94
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.93
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.92
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.92
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 99.92
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.85
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.8
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.8
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.8
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.75
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.66
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.47
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.45
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 97.01
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 96.93
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 96.59
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 94.6
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 94.48
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 94.27
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 92.92
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 92.69
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 92.66
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 91.9
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 89.42
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 86.96
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 85.77
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 85.63
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]
Probab=99.96  E-value=2.6e-30  Score=264.07  Aligned_cols=219  Identities=21%  Similarity=0.363  Sum_probs=175.1

Q ss_pred             cccEEEEccCCCCC-----CCCCCCCCeeeeCCcccCCCC---CCchhHHhhhccC-CCeEEEEEcCccccCCCccHHHH
Q psy18216         57 NKSILLLTNSWLYQ-----YPRPVFPNTINVGPTHIGDTK---PLPEDLATWIEGA-EKGVIYFSLGSNMRSASLEESKR  127 (487)
Q Consensus        57 ~~~l~lv~s~~~l~-----~~~~~~p~~~~iG~~~~~~~~---~l~~~l~~~l~~~-~~~~V~vs~Gs~~~~~~~~~~~~  127 (487)
                      ..+....++...+.     .+++.+|++..+|+.......   +.++++..|+... .+++||+++||...   ...+.+
T Consensus       207 ~~~~~~~~~~~~l~~~~~~~~~~~~p~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~s~gs~~~---~~~~~~  283 (450)
T d2c1xa1         207 KATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITPPPVVPNTTGCLQWLKERKPTSVVYISFGTVTT---PPPAEV  283 (450)
T ss_dssp             GSSCEEESSCGGGCHHHHHHHHHHSSCEEECCCHHHHC---------CHHHHHHTSCTTCEEEEECCSSCC---CCHHHH
T ss_pred             cccccccccHHhhhhhhhhhccccCCceeecCCccccCCCCCCcchhhhccccccCCccceeeeccccccc---CCHHHH
Confidence            34556666665543     345667888899987554332   3345677787775 46799999999875   467889


Q ss_pred             HHHHHHHhhCCCceEEEEEcCCCC---C-----CCCCcEEEeeccchhhhhcCCCcceeeccCCchhHHHhHhcCCCEEe
Q psy18216        128 SAILTTFAKFPQYRVIWKWEEEQL---P-----GLPSNVICRKWLPQHDLLAHPKIKLFITQGGLQSLQESVYFEVPLIG  199 (487)
Q Consensus       128 ~~~~~a~~~~~~~~vI~~~~~~~~---~-----~~~~nv~~~~~~pq~~lL~~p~~~~~IthgG~~s~~eal~~gvP~i~  199 (487)
                      +.++.++++.+. +|||+......   +     ..+.|+.+.+|+||.++|.||++++||||||.||+.||+++|||+++
T Consensus       284 ~~~~~~~~~~~~-~vl~~~~~~~~~~l~~~~~~~~~~nv~~~~~~pq~~lL~hp~~~~fItHGG~~s~~eal~~GvP~v~  362 (450)
T d2c1xa1         284 VALSEALEASRV-PFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLIC  362 (450)
T ss_dssp             HHHHHHHHHHTC-CEEEECCGGGGGGSCTTHHHHHTTTEEEESCCCHHHHHTSTTEEEEEECCCHHHHHHHHHHTCCEEE
T ss_pred             HHHHHHHHhcCC-eEEEEECCCccccCChhhhhhccccccccccCChHhhhccCceeEEEccCCccHHHHHHHcCCCEEe
Confidence            999999999997 99998755322   1     24679999999999999999999999999999999999999999999


Q ss_pred             ccccCChHHHHHHHHH-cCcEEEEeccCCCHHHHHHHHHHHHhCCChhHHHHHHHHH--hhccCCC----hhhHHHHHHH
Q psy18216        200 IPFFGDQDYNVKIIKN-LGIGTYMDFDSVSTEVLYNLMKEVLYNTSYMDTVKRISAL--SKTQMMS----PRDTAVWWIE  272 (487)
Q Consensus       200 iP~~~DQ~~na~rv~~-~g~g~~l~~~~~~~~~l~~ai~~vl~~~~~~~~a~~~s~~--~~~~~~~----~~~~a~~~ie  272 (487)
                      +|+++||+.||+|+++ +|+|+.++...+++++|.++|+++|+|++|++++++++++  ..++|..    +.+.+++|+|
T Consensus       363 ~P~~~DQ~~na~rv~~~~G~G~~l~~~~~t~~~l~~ai~~vL~d~~y~~~~~r~~~l~~~~~~a~~~~gss~~~~~~~~e  442 (450)
T d2c1xa1         363 RPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGPKGSSTENFITLVD  442 (450)
T ss_dssp             CCCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHTSTTCHHHHHHHHHHH
T ss_pred             cccccchHHHHHHHHHHcCcEEEecCCCcCHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHhccCCCCHHHHHHHHHH
Confidence            9999999999999976 6999999999999999999999999999988766665543  3334443    3788999999


Q ss_pred             HHHHhCC
Q psy18216        273 YVLKSGG  279 (487)
Q Consensus       273 ~vi~~gg  279 (487)
                      +|+|++.
T Consensus       443 ~v~r~~~  449 (450)
T d2c1xa1         443 LVSKPKD  449 (450)
T ss_dssp             HHTSCCC
T ss_pred             HHhhhcC
Confidence            9998754



>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure