Psyllid ID: psy192

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------90
MPSGNVDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQGYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIVGEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETSSVTVETVQKVAKNKTQGPVIPIFKSDASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKITGEGRKRNQISVGSCSEVSFPGKVSDSDIRSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDAKKVKVFGQSLTEGKTHEENPFTVDTRDAGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKYKDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHIPGSPFKVEV
cccccccccEEEEcccccEEEEEEccccEEEEEEEEEccEEccccccEEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEEEccEEEcccccEEEEEcccccccEEEEEEEEEEEEEEEEccEEEEEEEccccccccEEEEEEcccccEEEEEEEEccccEEEEEEEEcccEEEEEEEEEccEEcccccEEEEEccccccccEEEEEcccccccEEEcccEEEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEEEEcccEEEEEEEEEccccccccccEEEEcccccccEEEEEEEccccEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEEEccccEEEEEEEEcccEEEEEEEEEccEEccccccEEEcccccccccEEEEEccccEEEEEccEEEEEEcccccccccEEEEEEcccccEEEEEEEcccEEEEEEcccccEEEEEEEEcccccccccEEEEEEcccccccccccEEEEEEEEEEEEcccccccccEEEEccccccEEEEcccEEEEEEEEEEEEEEEccccccccEEEEcccccccEEEccccEEEEEEcccEEEEEEEccccccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEEEccccEEEEEEEEEccccccccccEEEEccccccEEEEEEccccccccccccccccccccEEEEEccccccccEEEEEcccccEEEEEEEcccEEEEEEEEEccEEcccccEEEEEcccccccccEEEEEEcccccccccccccEEEEEccccccEEEEEccccccccEEEEEcccccEEEcccEEEEEEEEEcccccEEEEEEEccccccccccEEEEEEEEccccEEEEEEEEcccEEEEEEEEEcccccccccEEEEc
cccccEEEEEEEEccccEEEEEEEcccccEEEEEEEEccEEccccccEEEEEEcccccEEEEEEccccEEEEEEEccccccEEEEEEEcccccccccEEEEEccccccccccEEEEcccccccEEccccEEEEEEEcccccccEEEEEEcccccEEEEEEEEccccEEEEEEEccccccEEEEEEEcccccccccEEEEEcccccccccEEEEEcccccccEccccEEEEEEEcccccccEEEEEEccccccEEEEEccccEEEEEEEccccccEEEEEEEcccccccccEEEEEccccccccEEEEEccccccEEccccEEEEEEcccccccEEEEEEcccccEEEEEEEEccccEEEEEEEcccccEEEEEEEEcccccccccEEEEEcccccccccEEEEccccccEEccccEEEEEEccccccccEEEEEEcccccEEEEEEccccEEEEEEccccccEEEEEEEcccccccccEEEEEEcccccccccccEEEEEEEccccccccccccccccccccccccccccccccEEEcccccccEEEccccccccEEEEEccccccEEEEEccccccccccccEEEEEEcccccccccEEEEEccccccEEEEEEEcccccEEEEEEccccEEEEEEEcccccEEEEEEEEcccccccccEEEEEEccccccccEEEccccEEEEEEEcccccccEEEEEEEcccccEEEEEEEEccccEEEEEEEccccccEEEEEEEcccccccccEEEEEccccccccccEEEcccccccccccccEEEEEEccccccccEEEcccccccccEEEEEccccccEEEcccEEEEEEccccccccEEEEEEccccccccccEEEEEEEEccccEEEEEEEccccccEEEEEEEcccccccccEEEEc
mpsgnvdkpviednhdgtvslhydpreegLHELALKFngdhvqgygglslsiegpskaeiqckdnadgslnisyrptepgyyIINLkfadhhvegspftakivgegsnrqREKIQRqreavpvtevgstckltfkmpgitafdlsatvtspggvtedaeinevedglyavhfvpkelgVHTVsvrykdihipgspfqftvgplrdggahrvhaggpglergeqnqpcefnvwtreagagslaisvegpskaeidfkdrkdgscyvsyvvaepgeyrvgikfndqhipdspyklfvspamgdahkleiaqfpqgvvmadkptqflvrkngavgaldakvispsgteddcfiqpidgdnysirfmprengihnihikfngvhipgsplrikvgkgeadpaavhatGNGLAEIKSGVKTDFIVDTCnagagtlavtidgpskvsmdcteveegykvrytplvpgdyyvslkyngyhivgspfkvkctgkdlgerggqetsSVTVETVQKVAknktqgpvipifksdaskvtckgMGLKKAYAQKQNMFTIhcqdagspfklyvdsipsgyvtaygpglisgvsgepclftistkgagagspfqftvgplrdgglsmavegpskaeityhdnkdgtvavsylptapgeyKIAVKFGekhikgspylakitgegrkrnqisvgscsevsfpgkvsdsdiRSLNasiqapsgleepcflkkipngnlgisftprevgSHLVSVKKmgvhiknspfkinvgerevgdakKVKVFGQsltegktheenpftvdtrdagsplrikvgkgeadpaavhatGNGLAEIKSGVKTDFIVDTCnagagtlavtidgpskvsvKKYKDEIftrhtgrnnfEVKYIVRDRGEYLLIVKwgddhipgspfkvev
mpsgnvdkpviednhdgtvSLHYDPREEGLHELALKFNGDHVQGYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIVGEGSNRQRekiqrqreavpvtevgstcklTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGgpglergeqnQPCEFNVWTREAGAGSLAIsvegpskaeidfkdrkdgsCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVrkngavgaldakvispsgteddcfiqPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTlavtidgpskvSMDCTEVeegykvrytplvPGDYYVSLKYNGYHIVGSPFKVKCTGKDLGerggqetssvtVETVQkvaknktqgpvipifksdaskvTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAeityhdnkdgTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLakitgegrkrnqisvgscsevsfpgkvsdsdiRSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKmgvhiknspfkinvgerevgdaKKVKVFGqsltegktheenpftvdtrdagSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGtlavtidgpskvsvKKYKdeiftrhtgrnnfevkyIVRDRGEYLLIVkwgddhipgspfkvev
MPSGNVDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQGYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIVGEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETSSVTVETVQKVAKNKTQGPVIPIFKSDASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKITGEGRKRNQISVGSCSEVSFPGKVSDSDIRSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDAKKVKVFGQSLTEGKTHEENPFTVDTRDAGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKYKDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHIPGSPFKVEV
****************************GLHELALKFNGDHVQGYGGLSLSI********QC****DGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIV******************PVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAH*****************CEFNVWTREAGAGSLAISV*******IDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKD**************************GPVIPIFKSDASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAV*****AEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKIT******************************************EPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDA*KVKVF***************************************VHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKYKDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHI*********
*PSG*VDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQGYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIVGEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETSSVTVETVQKVAKNKTQGPVIPIFKSDASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKITGEGRKRNQISVGSCSEVSFPGKVSDSDIRSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDAKKVKVFGQSLTEGKTHEENPFTVDTRDAGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKYKDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHIPGSPFKVEV
MPSGNVDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQGYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIVGE*******************EVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKDL***************VQKVAKNKTQGPVIPIFKSDASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKITGEGRKRNQISVGSCSEVSFPGKVSDSDIRSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDAKKVKVFGQSLTEGKTHEENPFTVDTRDAGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKYKDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHIPGSPFKVEV
***GNVDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQGYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIVGEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETSSVTVETVQK*******************KVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKITGEGRKRNQISVGSCSEVSFPGKVSDSDIRSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDAKKVKVFGQSLTEGKTHEENPFTVDTRDAGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKYKDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHIPGSPFKVEV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPSGNVDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQGYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIVGEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETSSVTVETVQKVAKNKTQGPVIPIFKSDASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKITGEGRKRNQISVGSCSEVSFPGKVSDSDIRSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDAKKVKVFGQSLTEGKTHEENPFTVDTRDAGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKYKDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHIPGSPFKVEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query898 2.2.26 [Sep-21-2011]
Q9VEN12210 Filamin-A OS=Drosophila m yes N/A 0.630 0.256 0.670 0.0
Q8BTM82647 Filamin-A OS=Mus musculus yes N/A 0.670 0.227 0.462 1e-164
P213332647 Filamin-A OS=Homo sapiens yes N/A 0.673 0.228 0.460 1e-163
Q80X902602 Filamin-B OS=Mus musculus no N/A 0.673 0.232 0.437 1e-153
O753692602 Filamin-B OS=Homo sapiens no N/A 0.673 0.232 0.437 1e-152
Q8VHX62726 Filamin-C OS=Mus musculus no N/A 0.602 0.198 0.457 1e-127
Q143152725 Filamin-C OS=Homo sapiens no N/A 0.602 0.198 0.455 1e-126
Q9MZD2294 Filamin-B (Fragment) OS=O no N/A 0.315 0.962 0.411 1e-59
P13466857 Gelation factor OS=Dictyo yes N/A 0.498 0.522 0.256 3e-29
Q5BIM1580 Tripartite motif-containi no N/A 0.074 0.115 0.391 4e-05
>sp|Q9VEN1|FLNA_DROME Filamin-A OS=Drosophila melanogaster GN=cher PE=1 SV=2 Back     alignment and function desciption
 Score =  826 bits (2133), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/619 (67%), Positives = 475/619 (76%), Gaps = 53/619 (8%)

Query: 44   GYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIV 103
            G+GGLS+SIEGPSKAEIQC D  DG+LNISY+PTEPGYYI+NLKFADHHVEGSPFT K+ 
Sbjct: 1640 GFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVA 1699

Query: 104  GEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEV 163
            GEGSNR+REKIQR+R+AVP+TE+GS CKLTFKMPGIT+FDL+A VTSP  VTEDAEI EV
Sbjct: 1700 GEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEV 1759

Query: 164  EDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQ 223
            EDGLYAVHFVPKELGVHTVSVRY ++HIPGSPFQFTVGPLRD G+H V AGG GLERG  
Sbjct: 1760 EDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVV 1819

Query: 224  NQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFND 283
             +  EFNVWTREAG GSLAISVEGPSKA+I+FKDRKDGSC VSY V EPGEYRVG+KFND
Sbjct: 1820 GEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFND 1879

Query: 284  QHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSG 343
            +HIPDSP+K++VSP  GDAHKLE+ QFPQG + AD P QF+VRKNGA G LDAK+++PSG
Sbjct: 1880 RHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSG 1939

Query: 344  TEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHAT 403
            T+DDCFIQ IDG+ YS+RF PRENGIH IH+KFNGVHIP SP RIKVGK  ADPAAVHA+
Sbjct: 1940 TDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHAS 1999

Query: 404  GNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDY 463
            GNGL E+K+G K DFI++TCNAG GTLAV+IDGPSKV+MDCTEVEEGYKVRYTPL+PG++
Sbjct: 2000 GNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEH 2059

Query: 464  YVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETSSVTVETVQKVAK-NKTQGPVIPIFKS 522
            Y+++KYN  HIVGSPFKV  TG  L + G QETS+V VETVQKVAK  K  G  +P FKS
Sbjct: 2060 YITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKS 2119

Query: 523  DASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSIPSGYVTAYGPGLISGVSGE 582
            DASKV  KGMGLKKAY  KQN F+I   DAG+            YV  YGP         
Sbjct: 2120 DASKVVSKGMGLKKAYIGKQNQFSISATDAGNNIL---------YVGMYGP-------KG 2163

Query: 583  PCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEITYHDNKDGTVAVSYLPTAP 642
            PC      K AG                               H+N +    V YL    
Sbjct: 2164 PCE-EFHVKHAG-------------------------------HNNYN----VQYLVRDR 2187

Query: 643  GEYKIAVKFGEKHIKGSPY 661
            G+Y + +K+GE+HI GSP+
Sbjct: 2188 GQYVLLIKWGEEHIPGSPF 2206
Involved in the germline ring canal formation. May tether actin microfilament within the ovarian ring canal to the cell membrane. Contributes to actin microfilaments organization.
Drosophila melanogaster (taxid: 7227)
>sp|Q8BTM8|FLNA_MOUSE Filamin-A OS=Mus musculus GN=Flna PE=1 SV=5 Back     alignment and function description
>sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 Back     alignment and function description
>sp|Q80X90|FLNB_MOUSE Filamin-B OS=Mus musculus GN=Flnb PE=1 SV=3 Back     alignment and function description
>sp|O75369|FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 Back     alignment and function description
>sp|Q8VHX6|FLNC_MOUSE Filamin-C OS=Mus musculus GN=Flnc PE=1 SV=3 Back     alignment and function description
>sp|Q14315|FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 Back     alignment and function description
>sp|Q9MZD2|FLNB_RABIT Filamin-B (Fragment) OS=Oryctolagus cuniculus GN=FLNB PE=1 SV=1 Back     alignment and function description
>sp|P13466|GELA_DICDI Gelation factor OS=Dictyostelium discoideum GN=abpC PE=1 SV=1 Back     alignment and function description
>sp|Q5BIM1|TRI45_BOVIN Tripartite motif-containing protein 45 OS=Bos taurus GN=TRIM45 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query898
380021528 2417 PREDICTED: LOW QUALITY PROTEIN: filamin- 0.681 0.253 0.655 0.0
334724440 2227 filamin-like [Apis mellifera] 0.681 0.274 0.653 0.0
340724304 2227 PREDICTED: filamin-C-like [Bombus terres 0.681 0.274 0.651 0.0
350420743 2282 PREDICTED: filamin-A-like [Bombus impati 0.681 0.268 0.651 0.0
383857180 2475 PREDICTED: filamin-A [Megachile rotundat 0.634 0.230 0.713 0.0
307210403 2325 Filamin-C [Harpegnathos saltator] 0.681 0.263 0.648 0.0
242004976837 Filamin-C, putative [Pediculus humanus c 0.677 0.726 0.659 0.0
345485608 2237 PREDICTED: filamin-C-like [Nasonia vitri 0.677 0.271 0.643 0.0
307183643 2435 Filamin-B [Camponotus floridanus] 0.634 0.234 0.713 0.0
328701730 2667 PREDICTED: filamin-A-like [Acyrthosiphon 0.630 0.212 0.722 0.0
>gi|380021528|ref|XP_003694615.1| PREDICTED: LOW QUALITY PROTEIN: filamin-C-like [Apis florea] Back     alignment and taxonomy information
 Score =  926 bits (2393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/708 (65%), Positives = 528/708 (74%), Gaps = 96/708 (13%)

Query: 2    PSGNVDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQ------------------ 43
            PSG  +   ++   +G + + + PRE G H +A+K  G H+Q                  
Sbjct: 1762 PSGLEEPCFLKMMPNGNMCVSFTPREAGSHTVAVKKLGKHIQNSPFKIDVKDREVGDAKK 1821

Query: 44   --------------------------GYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPT 77
                                      G+GGLSLS+EGPSKAEIQCKDN DG+LNISY+PT
Sbjct: 1822 VKVSGGGLVEGKTHVENFFSIDTRNAGFGGLSLSVEGPSKAEIQCKDNEDGTLNISYKPT 1881

Query: 78   EPGYYIINLKFADHHVEGSPFTAKIVGEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMP 137
            EPGYYIINLKFADHHVEGSPFT K+ GEGSNRQREKIQRQREAVP+TEVGS CKLTFKMP
Sbjct: 1882 EPGYYIINLKFADHHVEGSPFTVKVTGEGSNRQREKIQRQREAVPITEVGSQCKLTFKMP 1941

Query: 138  GITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQ 197
            GIT+FDL+ATVTSPGGVTEDAEI EVEDGLYAV FVPKELGVHTVSVRYK++HIPGSPFQ
Sbjct: 1942 GITSFDLAATVTSPGGVTEDAEIKEVEDGLYAVAFVPKELGVHTVSVRYKEMHIPGSPFQ 2001

Query: 198  FTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKD 257
            FTVGPLRDGGAHRVHAGGPGLERGEQ +PCEFN+WTREAGAG+LA+SVEGPSKA+IDFKD
Sbjct: 2002 FTVGPLRDGGAHRVHAGGPGLERGEQGEPCEFNIWTREAGAGTLAVSVEGPSKAQIDFKD 2061

Query: 258  RKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMA 317
            RKDGSCYVSYVV+EPGEYRVGIKFNDQHIPDSP+K++VSPAMGDAHKLE+AQFP+  V  
Sbjct: 2062 RKDGSCYVSYVVSEPGEYRVGIKFNDQHIPDSPHKVYVSPAMGDAHKLEVAQFPESGVQP 2121

Query: 318  DKPTQFLVRKNGAVGALDAKVISPSGTEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFN 377
            DKP  FLVRKNGA G LDAK++SPSG EDDCFIQ ID D YS+RFMPRENGIHNIH+KFN
Sbjct: 2122 DKPATFLVRKNGAKGELDAKIVSPSGIEDDCFIQGIDSDTYSVRFMPRENGIHNIHVKFN 2181

Query: 378  GVHIPGSPLRIKVGKGEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGP 437
            GVH+ GSP RIKVGK EADPAA+HA GNGL EIK+G KTDFI+DTCNAG+G L VT+DGP
Sbjct: 2182 GVHMQGSPFRIKVGKVEADPAALHAYGNGLKEIKTGQKTDFIIDTCNAGSGALCVTVDGP 2241

Query: 438  SKVSMDCTEVEEGYKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETS 497
            SKV+MDCTEVEEGYKVRYTPLVPGDYY+S+KY+GYHIVGSPFKV CTG DL ERG QETS
Sbjct: 2242 SKVAMDCTEVEEGYKVRYTPLVPGDYYISIKYDGYHIVGSPFKVPCTGADLAERGAQETS 2301

Query: 498  SVTVETVQKVAKNKTQGPVIPIFKSDASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFK 557
            S+ VETVQK++K K  GPV+P+FKSDASKVT KGMGLKKAY  KQN+FT++  DAG+   
Sbjct: 2302 SIVVETVQKISKAKQVGPVLPLFKSDASKVTSKGMGLKKAYLGKQNVFTVNASDAGNNIL 2361

Query: 558  LYVDSIPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEG 617
                     YV  YGP                                          +G
Sbjct: 2362 ---------YVGVYGP------------------------------------------KG 2370

Query: 618  PSKAEITYHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKI 665
            P   E++          V+YL    GEY + VK+G++HI GSPY  ++
Sbjct: 2371 PCD-EVSMKHTGRNNYNVNYLVRERGEYIVIVKWGDEHIPGSPYKVEV 2417

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|334724440|ref|NP_001229316.1| filamin-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340724304|ref|XP_003400522.1| PREDICTED: filamin-C-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350420743|ref|XP_003492609.1| PREDICTED: filamin-A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383857180|ref|XP_003704083.1| PREDICTED: filamin-A [Megachile rotundata] Back     alignment and taxonomy information
>gi|307210403|gb|EFN86968.1| Filamin-C [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242004976|ref|XP_002423351.1| Filamin-C, putative [Pediculus humanus corporis] gi|212506381|gb|EEB10613.1| Filamin-C, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345485608|ref|XP_001607090.2| PREDICTED: filamin-C-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307183643|gb|EFN70346.1| Filamin-B [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328701730|ref|XP_001945154.2| PREDICTED: filamin-A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query898
FB|FBgn00141412399 cher "cheerio" [Drosophila mel 0.581 0.217 0.752 6.3e-236
MGI|MGI:955562647 Flna "filamin, alpha" [Mus mus 0.562 0.190 0.565 3.4e-170
UNIPROTKB|F1PWW02646 FLNA "Uncharacterized protein" 0.564 0.191 0.563 4.3e-170
UNIPROTKB|B5FW902647 FLNA "Filamin A, alpha isoform 0.565 0.191 0.563 1.9e-169
UNIPROTKB|B0KWW52647 FLNA "Filamin A, alpha isoform 0.565 0.191 0.559 6.7e-169
UNIPROTKB|P213332647 FLNA "Filamin-A" [Homo sapiens 0.565 0.191 0.561 8.4e-169
UNIPROTKB|A9CB592639 FLNA "Filamin A, alpha (Predic 0.565 0.192 0.559 4.6e-168
RGD|15606142607 Flna "filamin A, alpha" [Rattu 0.562 0.193 0.563 9.5e-162
UNIPROTKB|Q5HY542607 FLNA "Filamin-A" [Homo sapiens 0.565 0.194 0.561 1.2e-161
ZFIN|ZDB-GENE-030131-21452614 flna "filamin A, alpha (actin 0.563 0.193 0.558 3.9e-159
FB|FBgn0014141 cher "cheerio" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 2115 (749.6 bits), Expect = 6.3e-236, Sum P(2) = 6.3e-236
 Identities = 395/525 (75%), Positives = 447/525 (85%)

Query:    44 GYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIV 103
             G+GGLS+SIEGPSKAEIQC D  DG+LNISY+PTEPGYYI+NLKFADHHVEGSPFT K+ 
Sbjct:  1829 GFGGLSVSIEGPSKAEIQCTDKDDGTLNISYKPTEPGYYIVNLKFADHHVEGSPFTVKVA 1888

Query:   104 GEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEV 163
             GEGSNR+REKIQR+R+AVP+TE+GS CKLTFKMPGIT+FDL+A VTSP  VTEDAEI EV
Sbjct:  1889 GEGSNRKREKIQRERDAVPITEIGSQCKLTFKMPGITSFDLAACVTSPSNVTEDAEIQEV 1948

Query:   164 EDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQ 223
             EDGLYAVHFVPKELGVHTVSVRY ++HIPGSPFQFTVGPLRD G+H V AGG GLERG  
Sbjct:  1949 EDGLYAVHFVPKELGVHTVSVRYSEMHIPGSPFQFTVGPLRDSGSHLVKAGGSGLERGVV 2008

Query:   224 NQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFND 283
              +  EFNVWTREAG GSLAISVEGPSKA+I+FKDRKDGSC VSY V EPGEYRVG+KFND
Sbjct:  2009 GEAAEFNVWTREAGGGSLAISVEGPSKADIEFKDRKDGSCDVSYKVTEPGEYRVGLKFND 2068

Query:   284 QHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGAVGALDAKVISPSG 343
             +HIPDSP+K++VSP  GDAHKLE+ QFPQG + AD P QF+VRKNGA G LDAK+++PSG
Sbjct:  2069 RHIPDSPFKVYVSPDAGDAHKLEVQQFPQGNIQADAPYQFMVRKNGAKGELDAKIVAPSG 2128

Query:   344 TEDDCFIQPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGEADPAAVHAT 403
             T+DDCFIQ IDG+ YS+RF PRENGIH IH+KFNGVHIP SP RIKVGK  ADPAAVHA+
Sbjct:  2129 TDDDCFIQVIDGEMYSVRFYPRENGIHAIHVKFNGVHIPDSPFRIKVGKDVADPAAVHAS 2188

Query:   404 GNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSMDCTEVEEGYKVRYTPLVPGDY 463
             GNGL E+K+G K DFI++TCNAG GTLAV+IDGPSKV+MDCTEVEEGYKVRYTPL+PG++
Sbjct:  2189 GNGLDEVKTGHKADFIINTCNAGVGTLAVSIDGPSKVAMDCTEVEEGYKVRYTPLLPGEH 2248

Query:   464 YVSLKYNGYHIVGSPFKVKCTGKDLGERGGQETSSVTVETVQKVAKN-KTQGPVIPIFKS 522
             Y+++KYN  HIVGSPFKV  TG  L + G QETS+V VETVQKVAK  K  G  +P FKS
Sbjct:  2249 YITVKYNNMHIVGSPFKVNATGDKLADEGAQETSTVIVETVQKVAKGGKNTGVHLPTFKS 2308

Query:   523 DASKVTCKGMGLKKAYAQKQNMFTIHCQDAGSPFKLYVDSI-PSG 566
             DASKV  KGMGLKKAY  KQN F+I   DAG+   LYV    P G
Sbjct:  2309 DASKVVSKGMGLKKAYIGKQNQFSISATDAGNNI-LYVGMYGPKG 2352
GO:0007301 "female germline ring canal formation" evidence=IMP
GO:0008104 "protein localization" evidence=IMP
GO:0003779 "actin binding" evidence=ISS
GO:0035183 "female germline ring canal inner rim" evidence=IDA
GO:0035182 "female germline ring canal outer rim" evidence=IDA
GO:0008302 "female germline ring canal formation, actin assembly" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
GO:0008355 "olfactory learning" evidence=IMP
GO:0007611 "learning or memory" evidence=IMP
GO:0030708 "germarium-derived female germ-line cyst encapsulation" evidence=IMP
GO:0030725 "germline ring canal formation" evidence=IMP
GO:0035204 "negative regulation of lamellocyte differentiation" evidence=IMP
GO:0048149 "behavioral response to ethanol" evidence=IMP
GO:0007067 "mitosis" evidence=IMP
GO:0008045 "motor neuron axon guidance" evidence=IMP
MGI|MGI:95556 Flna "filamin, alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PWW0 FLNA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B5FW90 FLNA "Filamin A, alpha isoform 2 (Predicted)" [Otolemur garnettii (taxid:30611)] Back     alignment and assigned GO terms
UNIPROTKB|B0KWW5 FLNA "Filamin A, alpha isoform 2 (Predicted)" [Callithrix jacchus (taxid:9483)] Back     alignment and assigned GO terms
UNIPROTKB|P21333 FLNA "Filamin-A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A9CB59 FLNA "Filamin A, alpha (Predicted)" [Papio anubis (taxid:9555)] Back     alignment and assigned GO terms
RGD|1560614 Flna "filamin A, alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5HY54 FLNA "Filamin-A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2145 flna "filamin A, alpha (actin binding protein 280)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VEN1FLNA_DROMENo assigned EC number0.67040.63020.2561yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query898
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 6e-29
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 4e-24
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 1e-22
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 3e-21
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 2e-20
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 2e-19
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 3e-18
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 6e-18
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 3e-16
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 4e-15
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 9e-14
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 1e-13
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 1e-13
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 4e-12
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 4e-11
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 1e-08
smart0055793 smart00557, IG_FLMN, Filamin-type immunoglobulin d 5e-07
pfam0063093 pfam00630, Filamin, Filamin/ABP280 repeat 1e-05
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information 
 Score =  110 bits (277), Expect = 6e-29
 Identities = 46/93 (49%), Positives = 59/93 (63%), Gaps = 2/93 (2%)

Query: 208 AHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPS--KAEIDFKDRKDGSCYV 265
           A +V A GPGLE+G   +P EF V TR+AG G L + V GPS  K  ++ KD  DG+  V
Sbjct: 1   ASKVKASGPGLEKGVVGEPAEFTVDTRDAGGGELEVEVTGPSGKKVPVEVKDNGDGTYTV 60

Query: 266 SYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPA 298
           SY   EPG+Y V +KF  +HIP SP+ + V PA
Sbjct: 61  SYTPTEPGDYTVTVKFGGEHIPGSPFTVKVGPA 93

These form a rod-like structure in the actin-binding cytoskeleton protein, filamin. The C-terminal repeats of filamin bind beta1-integrin (CD29). Length = 93
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information
>gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains Back     alignment and domain information
>gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 898
KOG0518|consensus1113 100.0
KOG0518|consensus 1113 100.0
smart0055793 IG_FLMN Filamin-type immunoglobulin domains. These 99.81
smart0055793 IG_FLMN Filamin-type immunoglobulin domains. These 99.81
PF00630101 Filamin: Filamin/ABP280 repeat; InterPro: IPR01786 99.72
PF00630101 Filamin: Filamin/ABP280 repeat; InterPro: IPR01786 99.67
PRK14081667 triple tyrosine motif-containing protein; Provisio 99.36
PRK14081667 triple tyrosine motif-containing protein; Provisio 99.33
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 95.26
PF13584484 BatD: Oxygen tolerance 94.87
KOG1948|consensus 1165 94.82
TIGR03503374 conserved hypothetical protein TIGR03503. This set 94.4
PF13584484 BatD: Oxygen tolerance 92.63
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 92.39
TIGR03503374 conserved hypothetical protein TIGR03503. This set 91.63
KOG1428|consensus 3738 90.52
TIGR00868863 hCaCC calcium-activated chloride channel protein 1 90.16
PF1311586 YtkA: YtkA-like 88.23
PF0913499 Invasin_D3: Invasin, domain 3; InterPro: IPR015217 87.6
PF0183599 A2M_N: MG2 domain; InterPro: IPR002890 The protein 87.1
PF10670215 DUF4198: Domain of unknown function (DUF4198) 87.08
PF0183599 A2M_N: MG2 domain; InterPro: IPR002890 The protein 86.94
COG2373 1621 Large extracellular alpha-helical protein [General 86.57
PF09315179 DUF1973: Domain of unknown function (DUF1973); Int 85.82
COG1470513 Predicted membrane protein [Function unknown] 83.12
KOG1428|consensus 3738 82.26
>KOG0518|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.4e-106  Score=925.23  Aligned_cols=851  Identities=30%  Similarity=0.498  Sum_probs=675.2

Q ss_pred             CCCCcccCeEEeCCCCeEEEEEEcCCceeEEEEEEECCEEec--------------------------------------
Q psy192            2 PSGNVDKPVIEDNHDGTVSLHYDPREEGLHELALKFNGDHVQ--------------------------------------   43 (898)
Q Consensus         2 p~g~~~~~~i~~~~d~~~~v~f~P~~~G~h~v~v~~~G~~v~--------------------------------------   43 (898)
                      |+|....|.++++.||+|+++++|.+.|+|.+.++|++.+++                                      
T Consensus       116 ~~g~~~~~~v~~~~dg~y~~k~~p~e~~~h~~e~~~~e~~~~~sP~~~~v~~~td~n~~~Alg~~le~~~vg~p~~f~v~  195 (1113)
T KOG0518|consen  116 LIGSLTWTLVQDYGDGIYKTKRTPKEKGEHEVEVLYDEKPVPASPFVVKVNEGTDWNDVQALGPGLESARVGKPNVFEVE  195 (1113)
T ss_pred             ccccceeEeeeccCCcceeeecCchhccchhhhhhhcccccccCCceeccccccCcccceEeccchhhcccCCCceeEEe
Confidence            678999999999999999999999999999999999999874                                      


Q ss_pred             ----CCCCeeEEEecCccceEEEEeCCCCeEEEEEeeCCCeEEEEEEEECCeecCCCCeE---EEEecCCcccceeeeee
Q psy192           44 ----GYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFT---AKIVGEGSNRQREKIQR  116 (898)
Q Consensus        44 ----G~g~l~v~v~GP~~~~i~~~d~~dG~~~v~ytP~~~G~~~I~V~~~g~~i~gSPf~---~~v~~~~~~~~~~~i~~  116 (898)
                          |.++|.+.++||+++...|.|+++|+|.++|+|.++|+|.+++.|.+.||+||||.   ++..|+.+  .  .+  
T Consensus       196 ~~Ga~~gnl~~a~~gpse~~~~~~di~~g~c~veyip~~~gd~sv~~~~gg~~v~GsPf~~~t~~~~Dp~k--i--ki--  269 (1113)
T KOG0518|consen  196 TPGAGQGNLEVAVEGPSEALTVIPDIKPGSCSVEYIPPEPGDYSVNTYYGGVPVPGSPFRVATCDKVDPSK--I--KI--  269 (1113)
T ss_pred             cCCccccceeeeecChhhhcccccccCCCcceeeecCCCCCceEEeeeecccccCCCCeeeeeecccChhh--e--ee--
Confidence                33689999999999999999999999999999999999999999999999999995   44556552  2  22  


Q ss_pred             eecccceeeeCcEEEEEEEcCCCcccceEEEEeCCCCCeeeeEEEEcCCCEEEEEEEcCcceeEEEEEEECCeecCCCce
Q psy192          117 QREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEVEDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPF  196 (898)
Q Consensus       117 ~~~~~~~~~vg~~~~f~v~~~~~~~~~~~~~V~~p~G~~~~~~v~~~~~g~y~v~f~P~~~G~h~I~V~~~g~~V~gSPf  196 (898)
                        .+++..+..++..|++|++.++-..+.+.|-++.+-..+..+.++++++|+|.|+|.+.|.|.|+|.++++.++.|||
T Consensus       270 --~gl~~gr~~~p~~F~vD~S~aG~~pl~v~V~g~r~p~e~v~~v~~~d~t~~V~fvPs~~g~~~isV~~ade~vp~spf  347 (1113)
T KOG0518|consen  270 --SGLPKGRLNKPQYFTVDASKAGLLPLEVAVCGGRVPVEPVMAVALGDGTYNVSFVPSEDGPYTISVRIADEDVPRSPF  347 (1113)
T ss_pred             --cCCCcccccCCeeEEEechhcCccceEEEecCCCCcccceEEecCCCceeEEEEeEcccCCeeEEEEecCCcCCCCcc
Confidence              134444778899999999999999999999887777566788899999999999999999999999999999999999


Q ss_pred             EEEEccCCCCCcceEEEeCCCCCcc--eeeeeeEEEEEeccCCCCceEEEEEcCCcc--eeeEEECCCC-cEEEEEEeCC
Q psy192          197 QFTVGPLRDGGAHRVHAGGPGLERG--EQNQPCEFNVWTREAGAGSLAISVEGPSKA--EIDFKDRKDG-SCYVSYVVAE  271 (898)
Q Consensus       197 ~v~V~~~~~~d~~~v~a~G~GL~~~--~~g~~~~F~V~~~daG~g~l~v~v~gps~~--~i~~~d~~dG-ty~v~y~P~~  271 (898)
                      .+.|.|.  .+++++++.|+||...  .+-.+..|++|.+|||.+.|++.|.||.+.  +..+.++++| .|.++|.|.+
T Consensus       348 ~~kvlp~--~~as~~~a~g~gLt~~~v~as~~~d~~fD~~Dageg~levqV~gp~Gk~~~~~V~d~~~~~~h~vsY~pd~  425 (1113)
T KOG0518|consen  348 LVKVLPT--VDASKVTASGAGLTDIGVNASVEVDFTFDEGDAGEGLLEVQVVGPEGKEKEVVVRDNGRGGIHIVTYVPDC  425 (1113)
T ss_pred             eeeeccc--cchhhhccccCccccccccccccceeeEEccccccceEEEEEECCCCCceeeEEEecCCCceEEEEEcCCC
Confidence            9999974  5689999999999987  456778999999999999999999999764  4567888887 9999999999


Q ss_pred             CceEEEEEEECCeeCCCCCceeEecCCCCCceeEEEeeeCCCceecCCCeEEEEEecCC-ccceEEEEECCCCCeeeeEE
Q psy192          272 PGEYRVGIKFNDQHIPDSPYKLFVSPAMGDAHKLEIAQFPQGVVMADKPTQFLVRKNGA-VGALDAKVISPSGTEDDCFI  350 (898)
Q Consensus       272 ~G~y~i~V~~~g~~I~gSPf~v~V~~~~~~~~~~~~~~~~~~~~~~g~~~~f~V~~~~a-~G~l~v~v~~p~g~~~~~~v  350 (898)
                      +|.|.|.|+|+|++|++|||++...+   |++++.+..-.  .+++|.+..|.||++.+ .|.+.+.+.+|+++..+..+
T Consensus       426 ~G~y~i~v~~~gd~i~gSPf~~ra~~---dask~~~~~~i--~~~vg~~~~~~vdak~ag~g~~~~~~~~pdn~n~~~~v  500 (1113)
T KOG0518|consen  426 PGRYLIVVFYGGDPIPGSPFTARAYP---DASKEVLVPPI--NAQVGKEANFVVDAKAAGAGPVTCTVVTPDNRNVPADV  500 (1113)
T ss_pred             CCceEEEEEECCcccCCCceEEEecc---CccceEecCCC--cccccceeeeEeehhhccCCCceeEEeccccCCCCcee
Confidence            99999999999999999999999876   56776654322  26899999999999877 47789999999999999999


Q ss_pred             EecCCCeEEEEEEecCCeeEEEEEEECCeecCCCCeEEEeccCC------------CCCceEEecC-----------CCc
Q psy192          351 QPIDGDNYSIRFMPRENGIHNIHIKFNGVHIPGSPLRIKVGKGE------------ADPAAVHATG-----------NGL  407 (898)
Q Consensus       351 ~~~~~g~y~v~f~P~~~G~h~i~V~~~g~~I~gSPf~v~V~~~~------------~d~s~v~v~G-----------~Gl  407 (898)
                      +.+++|+|.+.|++.++|+|.|+|+|+|+|+++|||.+.+..+.            .+-.......           -+|
T Consensus       501 ~~~~dg~~~iv~ta~~~~~~~i~v~f~ge~vp~sp~~~~a~~~~~~~~~~r~v~e~h~v~v~~~~~~~~vi~~~v~k~~l  580 (1113)
T KOG0518|consen  501 QKNGDGTFDIVFTAQDPGTYTIDVRFGGEHVPDSPFIVSASAGIGTAVAARWVTEEHSVEVIEQQSKTLVIPFTVQKKEL  580 (1113)
T ss_pred             eeccCcceeeEeccCCCCcceEEEEECCeeCCCCceeEEEecccccccccccccccccccccccccccccccccccccch
Confidence            99999999999999999999999999999999999999886430            0000000000           011


Q ss_pred             ce----eeeCCeEEEEEEcCCCC---CCceEEEEECCCCceeeeEEeCCe-EEEEEecCCCeeEEEEEEECCEecCCCCe
Q psy192          408 AE----IKSGVKTDFIVDTCNAG---AGTLAVTIDGPSKVSMDCTEVEEG-YKVRYTPLVPGDYYVSLKYNGYHIVGSPF  479 (898)
Q Consensus       408 ~~----~~~g~~~~F~Vd~~~aG---~g~l~v~v~gp~~~~~~~~~~~~g-y~v~ytp~~~G~y~i~V~~~g~~I~gSPf  479 (898)
                      ..    ...++..-++||..+.-   .-.+.+.|.||++..+.|.+|+|| |.++|+|+.||.|+|.|+|+++||+||||
T Consensus       581 ~~ev~~~t~k~~~~~iiDn~d~t~~v~~~~t~aiegPskaei~c~dn~Dgt~~vsy~P~vpG~y~i~V~~~~k~vpgSPF  660 (1113)
T KOG0518|consen  581 AGEVNMPTGKQAKPEIIDNKDGTITVRYAPTLAIEGPSKAEIRCYDNKDGTCSVSYTPTVPGVYKIEVKFGDKHVPGSPF  660 (1113)
T ss_pred             hccccCccccccCceeeccCCCceeEEeccccccCCCCccceeEEeCCCCcEEeccCCCCCceEEEEEEECCeeCCCCCc
Confidence            10    11123334556554431   112345578999999999999999 99999999999999999999999999999


Q ss_pred             EEEEec-ccCCCCC--cceeeeEEEeeEEeeeccCCC-CCccccccCCCceEEEe--cCc--eeeeeccCccEEEEEeec
Q psy192          480 KVKCTG-KDLGERG--GQETSSVTVETVQKVAKNKTQ-GPVIPIFKSDASKVTCK--GMG--LKKAYAQKQNMFTIHCQD  551 (898)
Q Consensus       480 ~v~v~~-~~~~~~~--~~~~s~v~v~~~~~~~~~~~~-~~~~p~~~~~~~~v~~~--g~g--l~~~~~~~~~~f~v~~~~  551 (898)
                      +..|.+ .++...-  ...+..+.+.. .+..-.... ....|..  ....+.++  -.|  -..+.+++.+.+.|+.+.
T Consensus       661 ~~~Vt~~~s~r~s~~~Vgs~~ev~in~-~~~~~s~ltaeI~~PsG--n~~~c~~r~l~~g~~~itF~P~e~GeH~I~Vk~  737 (1113)
T KOG0518|consen  661 VALVTGDESIRTSHLSVGSIHEVTINI-TEADLSVLTAEIVDPSG--NPEPCLVRRLPNGHDGITFTPREVGEHKINVKV  737 (1113)
T ss_pred             eEEEecccccccccceecceeeEEeec-cccCCceeEEEEECCCC--CccceeeEecCCCceeEEECCCcCcceEEEEEE
Confidence            999986 2111000  00111222210 000000000 0000111  11122221  112  224668888999998765


Q ss_pred             C-----CCCeEEEEec--cCCcceeEeCCCccceecCCeeEEEEEecCCCCCCCceeeecccCCCCcEEEEeCCccceEE
Q psy192          552 A-----GSPFKLYVDS--IPSGYVTAYGPGLISGVSGEPCLFTISTKGAGAGSPFQFTVGPLRDGGLSMAVEGPSKAEIT  624 (898)
Q Consensus       552 ~-----G~~~~l~v~~--~~~~~v~~~Gpgl~~g~~g~p~~fti~t~~ag~g~p~~~~~~~~~~g~l~v~v~GPs~~~i~  624 (898)
                      +     |+||.+.|..  .+.+++.++|++|..|+.-+|++|+|||+.||.             |+|+++++||+|++++
T Consensus       738 ~G~hVpgsPf~i~V~~~e~dAsk~~v~g~g~~~G~t~ep~~fivDtr~agy-------------GgLsi~~~Gpskvd~~  804 (1113)
T KOG0518|consen  738 AGKHVPGSPFSIKVSESEIDASKVRVSGQGLKEGHTFEPAEFIVDTRKAGY-------------GGLSISVQGPSKVDLN  804 (1113)
T ss_pred             cceECCCCCeEEEeccccccceeEEEecccccccccccchheEeccccCCC-------------CceEEEEeCCcccccc
Confidence            4     5788777753  356789999999999988899999999999997             8999999999999999


Q ss_pred             EEeCCCCeEEEEEEcCCCeeEEEEEEECCeecCCCceEEEEccCcccccee----------eecCceeecccceeeccCc
Q psy192          625 YHDNKDGTVAVSYLPTAPGEYKIAVKFGEKHIKGSPYLAKITGEGRKRNQI----------SVGSCSEVSFPGKVSDSDI  694 (898)
Q Consensus       625 ~~~~~dg~~~v~Y~P~~pG~Y~i~V~~~~~~I~GSPF~v~V~~~~~~~~~~----------~~g~~~~~~~~~~i~~~~~  694 (898)
                      |.|++||+|+|+|+|++||.|.|+|+|+++||+||||+|+++++++.-+.+          .+|+.  .+|..++++...
T Consensus       805 ~~d~~dGt~kV~ytPtepG~Y~I~i~Fad~~I~gSPftVkv~~~~~vvesi~~~~~~~~va~~g~~--~~l~lk~~~~~~  882 (1113)
T KOG0518|consen  805 VEDREDGTCKVSYTPTEPGTYIINIKFADEHIKGSPFTVKVTGESRVVESITRDREAPSVARVGHT--CSLDLKATEASS  882 (1113)
T ss_pred             eeecCCCeEEEEEeCCCCceEEEEEEEcCccCCCCceEEEecCCeeEeeeeeecccccceecccce--eeeeeecCCCCc
Confidence            999999999999999999999999999999999999999999987422222          22322  234445554444


Q ss_pred             ceeEEEEECCCCCeeceEEEeeCCCcEEEEEEEcccccEEEEEEECCEEcCCCCeEEEeccccccCcceeEEeCcccccc
Q psy192          695 RSLNASIQAPSGLEEPCFLKKIPNGNLGISFTPREVGSHLVSVKKMGVHIKNSPFKINVGEREVGDAKKVKVFGQSLTEG  774 (898)
Q Consensus       695 ~~l~a~v~~psg~~~~~~v~~~~~g~y~v~ftP~e~G~h~i~V~~~G~~i~gSPf~i~V~~~e~~da~kv~v~G~gl~~g  774 (898)
                      ...+|.+.+|||...+..+.++.+++|+|+|||+|+|.|+|+|+|.++|+.+|||++-  +-+-+-++|+|+-|+||..+
T Consensus       883 ~d~ta~vt~PSG~~~~aei~~~~~~~y~vrFtP~e~G~~tl~V~y~~~~vegspftvg--s~~e~~ahkvra~g~Gl~R~  960 (1113)
T KOG0518|consen  883 QDITARVTDPSGRVFEAEIVDLGQGTYQVRFTPKEPGNHTLSVKYKDQHVEGSPFTVG--SLGEGGAHKVRAAGPGLERG  960 (1113)
T ss_pred             cceEEEeeCCCCCccccEEEECCCceEEEEecCCCCCceEEEEEecCccCCCCceeee--cccccccceeeccCCceeec
Confidence            5678889999999999999999999999999999999999999999999999997763  33457899999999999999


Q ss_pred             ccCCCCceEEecCCCCCc-eEEecCCCCCCCceeEEecCCccce-ecCceeEEEEEcCCCCCceeEEEEeCCCccccccc
Q psy192          775 KTHEENPFTVDTRDAGSP-LRIKVGKGEADPAAVHATGNGLAEI-KSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSVKKY  852 (898)
Q Consensus       775 ~~~~~~~f~vd~~~aG~p-~~v~v~~~~~~~~~v~a~G~GL~~~-~~g~~~~f~vdt~~aG~g~l~v~i~gp~~~~~~~~  852 (898)
                      .++++  |+|++|+||-. +-+.+...+ =....++.++||... ..|.+..|.|+|+. +.|.+.+.+.+|+....   
T Consensus       961 ~~g~~--F~I~~rea~~~g~~va~egps-c~v~y~v~~pGv~~l~~~~~~~~~~v~tn~-a~g~ida~v~~p~~~~~--- 1033 (1113)
T KOG0518|consen  961 EAGEP--FSIWTREAGAGGLAVAVEGPS-CGVSYTVQTPGVGSLQEQGVPASFAVTTNR-AKGDIDAKVHTPSNAVE--- 1033 (1113)
T ss_pred             cccCc--eeEeehhcCccceEEEeeCCC-ceeEEEecCCCcchhhhcCcceEEEEEecc-ccCceeeEEeCCCCCcc---
Confidence            99998  99999999843 222232111 122345567776532 12247889999865 56788899999986432   


Q ss_pred             cceEEEEeeCCceEEEEEEeCCCeeEEEEEEECCccCCCCCceeeC
Q psy192          853 KDEIFTRHTGRNNFEVKYIVRDRGEYLLIVKWGDDHIPGSPFKVEV  898 (898)
Q Consensus       853 ~~~~~~~~~g~~~y~v~y~~~~~G~y~l~vk~~~~~i~GSPF~v~v  898 (898)
                        ++++  ...++|.++|+|.|+|.|+|.|||+|.|||||||+|+|
T Consensus      1034 --~c~~--~~~~~ya~~f~P~e~G~h~i~Vkfd~~hv~gSPF~i~v 1075 (1113)
T KOG0518|consen 1034 --ECYV--SEIEKYAMRFIPKENGVHTIDVKFDGEHVPGSPFKIRV 1075 (1113)
T ss_pred             --EEEe--eccceEEEEEeecCCCcEEEEEEeCCccCCCCCeEEEE
Confidence              2332  23449999999999999999999999999999999986

>KOG0518|consensus Back     alignment and domain information
>smart00557 IG_FLMN Filamin-type immunoglobulin domains Back     alignment and domain information
>smart00557 IG_FLMN Filamin-type immunoglobulin domains Back     alignment and domain information
>PF00630 Filamin: Filamin/ABP280 repeat; InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod Back     alignment and domain information
>PF00630 Filamin: Filamin/ABP280 repeat; InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>PRK14081 triple tyrosine motif-containing protein; Provisional Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF13584 BatD: Oxygen tolerance Back     alignment and domain information
>KOG1948|consensus Back     alignment and domain information
>TIGR03503 conserved hypothetical protein TIGR03503 Back     alignment and domain information
>PF13584 BatD: Oxygen tolerance Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>TIGR03503 conserved hypothetical protein TIGR03503 Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>TIGR00868 hCaCC calcium-activated chloride channel protein 1 Back     alignment and domain information
>PF13115 YtkA: YtkA-like Back     alignment and domain information
>PF09134 Invasin_D3: Invasin, domain 3; InterPro: IPR015217 This domain adopts a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, arranged in a Greek-key topology Back     alignment and domain information
>PF01835 A2M_N: MG2 domain; InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white Back     alignment and domain information
>PF10670 DUF4198: Domain of unknown function (DUF4198) Back     alignment and domain information
>PF01835 A2M_N: MG2 domain; InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white Back     alignment and domain information
>COG2373 Large extracellular alpha-helical protein [General function prediction only] Back     alignment and domain information
>PF09315 DUF1973: Domain of unknown function (DUF1973); InterPro: IPR015394 These functionally uncharacterised domains are found in various eukaryotic calcium-dependent chloride channels Back     alignment and domain information
>COG1470 Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query898
2j3s_A288 Crystal Structure Of The Human Filamin A Ig Domains 3e-90
2j3s_A288 Crystal Structure Of The Human Filamin A Ig Domains 2e-45
2j3s_A288 Crystal Structure Of The Human Filamin A Ig Domains 1e-37
2j3s_A 288 Crystal Structure Of The Human Filamin A Ig Domains 3e-10
2k9u_A119 Solution Nmr Structure Of The Filamin-Migfilin Comp 3e-39
2k9u_A119 Solution Nmr Structure Of The Filamin-Migfilin Comp 2e-16
2k9u_A119 Solution Nmr Structure Of The Filamin-Migfilin Comp 4e-09
3isw_A99 Crystal Structure Of Filamin-A Immunoglobulin-Like 2e-34
3isw_A99 Crystal Structure Of Filamin-A Immunoglobulin-Like 9e-16
3isw_A99 Crystal Structure Of Filamin-A Immunoglobulin-Like 2e-09
2brq_A97 Crystal Structure Of The Filamin A Repeat 21 Comple 3e-33
2brq_A97 Crystal Structure Of The Filamin A Repeat 21 Comple 8e-16
2brq_A97 Crystal Structure Of The Filamin A Repeat 21 Comple 2e-09
2w0p_A94 Crystal Structure Of The Filamin A Repeat 21 Comple 4e-33
2w0p_A94 Crystal Structure Of The Filamin A Repeat 21 Comple 8e-16
2w0p_A94 Crystal Structure Of The Filamin A Repeat 21 Comple 2e-09
2k7q_A191 Filamin A Ig-Like Domains 18-19 Length = 191 3e-32
2k7p_A188 Filamin A Ig-Like Domains 16-17 Length = 188 3e-31
2k7p_A188 Filamin A Ig-Like Domains 16-17 Length = 188 1e-28
2k7p_A188 Filamin A Ig-Like Domains 16-17 Length = 188 2e-07
2ee6_A105 Solution Structure Of The 21th Filamin Domain From 9e-31
2ee6_A105 Solution Structure Of The 21th Filamin Domain From 4e-17
2ee6_A105 Solution Structure Of The 21th Filamin Domain From 3e-08
2d7o_A111 Solution Structure Of The 17th Filamin Domain From 2e-26
2d7o_A111 Solution Structure Of The 17th Filamin Domain From 2e-06
2eea_A115 Solution Structure Of The 17th Filamin Domain From 4e-26
2eea_A115 Solution Structure Of The 17th Filamin Domain From 4e-06
2aav_A98 Solution Nmr Structure Of Filamin A Domain 17 Lengt 2e-24
2aav_A98 Solution Nmr Structure Of Filamin A Domain 17 Lengt 7e-06
2bp3_A97 Crystal Structure Of Filamin A Domain 17 And Gpib A 2e-24
2bp3_A97 Crystal Structure Of Filamin A Domain 17 And Gpib A 7e-06
2dmc_A116 Solution Structure Of The 18th Filamin Domain From 3e-24
2nqc_A138 Crystal Structure Of Ig-Like Domain 23 From Human F 4e-24
2nqc_A138 Crystal Structure Of Ig-Like Domain 23 From Human F 4e-12
2nqc_A138 Crystal Structure Of Ig-Like Domain 23 From Human F 8e-12
2k3t_A99 Solution Structure Of Ig-Like Domain 23 From Human 4e-24
2k3t_A99 Solution Structure Of Ig-Like Domain 23 From Human 6e-12
2k3t_A99 Solution Structure Of Ig-Like Domain 23 From Human 1e-10
2eec_A125 Solution Structure Of The 23th Filamin Domain From 8e-24
2eec_A125 Solution Structure Of The 23th Filamin Domain From 2e-09
2d7q_A111 Solution Structure Of The 23th Filamin Domain From 1e-23
2d7q_A111 Solution Structure Of The 23th Filamin Domain From 6e-12
2d7q_A111 Solution Structure Of The 23th Filamin Domain From 2e-11
2e9i_A106 Solution Structure Of The N-Terminal Extended 20th 1e-22
2e9i_A106 Solution Structure Of The N-Terminal Extended 20th 2e-07
2e9i_A106 Solution Structure Of The N-Terminal Extended 20th 3e-04
2d7p_A112 Solution Structure Of The 22th Filamin Domain From 1e-21
2d7p_A112 Solution Structure Of The 22th Filamin Domain From 6e-07
2eeb_A106 Solution Structure Of The 22th Filamin Domain From 1e-19
2eeb_A106 Solution Structure Of The 22th Filamin Domain From 1e-05
2dlg_A102 Solution Structure Of The 20th Filamin Domain From 8e-19
2dlg_A102 Solution Structure Of The 20th Filamin Domain From 2e-07
2dlg_A102 Solution Structure Of The 20th Filamin Domain From 3e-04
2di8_A111 Solution Structure Of The 19th Filamin Domain From 3e-17
2di8_A111 Solution Structure Of The 19th Filamin Domain From 3e-16
2di8_A111 Solution Structure Of The 19th Filamin Domain From 5e-09
2dic_A105 Solution Structure Of The 12th Filamin Domain From 7e-17
2dic_A105 Solution Structure Of The 12th Filamin Domain From 2e-14
2dic_A105 Solution Structure Of The 12th Filamin Domain From 5e-07
2eed_A101 Solution Structure Of The 24th Filamin Domain From 9e-16
1v05_A96 Dimerization Of Human Filamin C: Crystal Structure 4e-15
2di9_A131 Solution Structure Of The 9th Filamin Domain From H 4e-15
2di9_A131 Solution Structure Of The 9th Filamin Domain From H 4e-13
2di9_A131 Solution Structure Of The 9th Filamin Domain From H 6e-05
3cnk_A89 Crystal Structure Of The Dimerization Domain Of Hum 9e-15
1wlh_A311 Molecular Structure Of The Rod Domain Of Dictyostel 9e-14
1wlh_A311 Molecular Structure Of The Rod Domain Of Dictyostel 4e-12
1wlh_A311 Molecular Structure Of The Rod Domain Of Dictyostel 1e-06
1wlh_A311 Molecular Structure Of The Rod Domain Of Dictyostel 5e-05
3rgh_A100 Structure Of Filamin A Immunoglobulin-Like Repeat 1 3e-09
3rgh_A100 Structure Of Filamin A Immunoglobulin-Like Repeat 1 3e-04
2e9j_A119 Solution Structure Of The 14th Filamin Domain From 1e-08
2e9j_A119 Solution Structure Of The 14th Filamin Domain From 7e-07
2e9j_A119 Solution Structure Of The 14th Filamin Domain From 5e-05
2d7n_A93 Solution Structure Of The 16th Filamin Domain From 8e-08
2d7n_A93 Solution Structure Of The 16th Filamin Domain From 3e-06
2d7n_A93 Solution Structure Of The 16th Filamin Domain From 2e-04
2dia_A113 Solution Structure Of The 10th Filamin Domain From 9e-08
2dia_A113 Solution Structure Of The 10th Filamin Domain From 4e-06
2dia_A113 Solution Structure Of The 10th Filamin Domain From 4e-04
2d7m_A115 Solution Structure Of The 14th Filamin Domain From 1e-07
2d7m_A115 Solution Structure Of The 14th Filamin Domain From 4e-06
2dj4_A108 Solution Structure Of The 13th Filamin Domain From 1e-06
4b7l_A347 Crystal Structure Of Human Filamin B Actin Binding 6e-06
4b7l_A347 Crystal Structure Of Human Filamin B Actin Binding 8e-05
2ee9_A95 Solution Structure Of The 16th Filamin Domain From 7e-06
2ee9_A95 Solution Structure Of The 16th Filamin Domain From 5e-05
2ee9_A95 Solution Structure Of The 16th Filamin Domain From 6e-04
2dmb_A124 Solution Structure Of The 15th Filamin Domain From 8e-06
2dmb_A124 Solution Structure Of The 15th Filamin Domain From 7e-04
2ds4_A113 Solution Structure Of The Filamin Domain From Human 2e-05
2ds4_A113 Solution Structure Of The Filamin Domain From Human 2e-04
2dib_A128 Solution Structure Of The 11th Filamin Domain From 2e-05
2dib_A128 Solution Structure Of The 11th Filamin Domain From 8e-05
1qfh_A212 Dimerization Of Gelation Factor From Dictyostelium 5e-05
1qfh_A212 Dimerization Of Gelation Factor From Dictyostelium 5e-05
1qfh_A212 Dimerization Of Gelation Factor From Dictyostelium 7e-04
1ksr_A100 The Repeating Segments Of The F-Actin Cross-Linking 2e-04
1ksr_A100 The Repeating Segments Of The F-Actin Cross-Linking 3e-04
>pdb|2J3S|A Chain A, Crystal Structure Of The Human Filamin A Ig Domains 19 To 21 Length = 288 Back     alignment and structure 
Iteration: 1

 Score =  329 bits (844), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 195/253 (77%), Gaps = 2/253 (0%)
Query: 44  GYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIV 103
           GYGGLSLSIEGPSK +I  +D  DG+  ++Y PTEPG YIIN+KFAD HV GSPF+ K+ 
Sbjct: 35  GYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVT 94
Query: 104 GEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEV 163
           GEG  R +E I R+R A  V  VGS C L+ K+P I+  D++A VTSP G T +AEI E 
Sbjct: 95  GEG--RVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEG 152
Query: 164 EDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQ 223
           E+  Y + FVP E+G HTVSV+YK  H+PGSPFQFTVGPL +GGAH+V AGGPGLER E 
Sbjct: 153 ENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEA 212
Query: 224 NQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFND 283
             P EF++WTREAGAG LAI+VEGPSKAEI F+DRKDGSC V+YVV EPG+Y V +KFN+
Sbjct: 213 GVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNE 272
Query: 284 QHIPDSPYKLFVS 296
           +HIPDSP+ + V+
Sbjct: 273 EHIPDSPFVVPVA 285
>pdb|2J3S|A Chain A, Crystal Structure Of The Human Filamin A Ig Domains 19 To 21 Length = 288 Back     alignment and structure
>pdb|2J3S|A Chain A, Crystal Structure Of The Human Filamin A Ig Domains 19 To 21 Length = 288 Back     alignment and structure
>pdb|2J3S|A Chain A, Crystal Structure Of The Human Filamin A Ig Domains 19 To 21 Length = 288 Back     alignment and structure
>pdb|2K9U|A Chain A, Solution Nmr Structure Of The Filamin-Migfilin Complex Length = 119 Back     alignment and structure
>pdb|2K9U|A Chain A, Solution Nmr Structure Of The Filamin-Migfilin Complex Length = 119 Back     alignment and structure
>pdb|2K9U|A Chain A, Solution Nmr Structure Of The Filamin-Migfilin Complex Length = 119 Back     alignment and structure
>pdb|3ISW|A Chain A, Crystal Structure Of Filamin-A Immunoglobulin-Like Repeat 21 An N-Terminal Peptide Of Cftr Length = 99 Back     alignment and structure
>pdb|3ISW|A Chain A, Crystal Structure Of Filamin-A Immunoglobulin-Like Repeat 21 An N-Terminal Peptide Of Cftr Length = 99 Back     alignment and structure
>pdb|3ISW|A Chain A, Crystal Structure Of Filamin-A Immunoglobulin-Like Repeat 21 An N-Terminal Peptide Of Cftr Length = 99 Back     alignment and structure
>pdb|2BRQ|A Chain A, Crystal Structure Of The Filamin A Repeat 21 Complexed With The Integrin Beta7 Cytoplasmic Tail Peptide Length = 97 Back     alignment and structure
>pdb|2BRQ|A Chain A, Crystal Structure Of The Filamin A Repeat 21 Complexed With The Integrin Beta7 Cytoplasmic Tail Peptide Length = 97 Back     alignment and structure
>pdb|2BRQ|A Chain A, Crystal Structure Of The Filamin A Repeat 21 Complexed With The Integrin Beta7 Cytoplasmic Tail Peptide Length = 97 Back     alignment and structure
>pdb|2W0P|A Chain A, Crystal Structure Of The Filamin A Repeat 21 Complexed With The Migfilin Peptide Length = 94 Back     alignment and structure
>pdb|2W0P|A Chain A, Crystal Structure Of The Filamin A Repeat 21 Complexed With The Migfilin Peptide Length = 94 Back     alignment and structure
>pdb|2W0P|A Chain A, Crystal Structure Of The Filamin A Repeat 21 Complexed With The Migfilin Peptide Length = 94 Back     alignment and structure
>pdb|2K7Q|A Chain A, Filamin A Ig-Like Domains 18-19 Length = 191 Back     alignment and structure
>pdb|2K7P|A Chain A, Filamin A Ig-Like Domains 16-17 Length = 188 Back     alignment and structure
>pdb|2K7P|A Chain A, Filamin A Ig-Like Domains 16-17 Length = 188 Back     alignment and structure
>pdb|2K7P|A Chain A, Filamin A Ig-Like Domains 16-17 Length = 188 Back     alignment and structure
>pdb|2EE6|A Chain A, Solution Structure Of The 21th Filamin Domain From Human Filamin-B Length = 105 Back     alignment and structure
>pdb|2EE6|A Chain A, Solution Structure Of The 21th Filamin Domain From Human Filamin-B Length = 105 Back     alignment and structure
>pdb|2EE6|A Chain A, Solution Structure Of The 21th Filamin Domain From Human Filamin-B Length = 105 Back     alignment and structure
>pdb|2D7O|A Chain A, Solution Structure Of The 17th Filamin Domain From Human Filamin C Length = 111 Back     alignment and structure
>pdb|2D7O|A Chain A, Solution Structure Of The 17th Filamin Domain From Human Filamin C Length = 111 Back     alignment and structure
>pdb|2EEA|A Chain A, Solution Structure Of The 17th Filamin Domain From Human Filamin-B Length = 115 Back     alignment and structure
>pdb|2EEA|A Chain A, Solution Structure Of The 17th Filamin Domain From Human Filamin-B Length = 115 Back     alignment and structure
>pdb|2AAV|A Chain A, Solution Nmr Structure Of Filamin A Domain 17 Length = 98 Back     alignment and structure
>pdb|2AAV|A Chain A, Solution Nmr Structure Of Filamin A Domain 17 Length = 98 Back     alignment and structure
>pdb|2BP3|A Chain A, Crystal Structure Of Filamin A Domain 17 And Gpib Alpha Cytoplasmic Domain Complex Length = 97 Back     alignment and structure
>pdb|2BP3|A Chain A, Crystal Structure Of Filamin A Domain 17 And Gpib Alpha Cytoplasmic Domain Complex Length = 97 Back     alignment and structure
>pdb|2DMC|A Chain A, Solution Structure Of The 18th Filamin Domain From Human Filamin-B Length = 116 Back     alignment and structure
>pdb|2NQC|A Chain A, Crystal Structure Of Ig-Like Domain 23 From Human Filamin C Length = 138 Back     alignment and structure
>pdb|2NQC|A Chain A, Crystal Structure Of Ig-Like Domain 23 From Human Filamin C Length = 138 Back     alignment and structure
>pdb|2NQC|A Chain A, Crystal Structure Of Ig-Like Domain 23 From Human Filamin C Length = 138 Back     alignment and structure
>pdb|2K3T|A Chain A, Solution Structure Of Ig-Like Domain 23 From Human Filamin A Length = 99 Back     alignment and structure
>pdb|2K3T|A Chain A, Solution Structure Of Ig-Like Domain 23 From Human Filamin A Length = 99 Back     alignment and structure
>pdb|2K3T|A Chain A, Solution Structure Of Ig-Like Domain 23 From Human Filamin A Length = 99 Back     alignment and structure
>pdb|2EEC|A Chain A, Solution Structure Of The 23th Filamin Domain From Human Filamin-B Length = 125 Back     alignment and structure
>pdb|2EEC|A Chain A, Solution Structure Of The 23th Filamin Domain From Human Filamin-B Length = 125 Back     alignment and structure
>pdb|2D7Q|A Chain A, Solution Structure Of The 23th Filamin Domain From Human Filamin C Length = 111 Back     alignment and structure
>pdb|2D7Q|A Chain A, Solution Structure Of The 23th Filamin Domain From Human Filamin C Length = 111 Back     alignment and structure
>pdb|2D7Q|A Chain A, Solution Structure Of The 23th Filamin Domain From Human Filamin C Length = 111 Back     alignment and structure
>pdb|2E9I|A Chain A, Solution Structure Of The N-Terminal Extended 20th Filamin Domain From Human Filamin-B Length = 106 Back     alignment and structure
>pdb|2E9I|A Chain A, Solution Structure Of The N-Terminal Extended 20th Filamin Domain From Human Filamin-B Length = 106 Back     alignment and structure
>pdb|2E9I|A Chain A, Solution Structure Of The N-Terminal Extended 20th Filamin Domain From Human Filamin-B Length = 106 Back     alignment and structure
>pdb|2D7P|A Chain A, Solution Structure Of The 22th Filamin Domain From Human Filamin C Length = 112 Back     alignment and structure
>pdb|2D7P|A Chain A, Solution Structure Of The 22th Filamin Domain From Human Filamin C Length = 112 Back     alignment and structure
>pdb|2EEB|A Chain A, Solution Structure Of The 22th Filamin Domain From Human Filamin-B Length = 106 Back     alignment and structure
>pdb|2EEB|A Chain A, Solution Structure Of The 22th Filamin Domain From Human Filamin-B Length = 106 Back     alignment and structure
>pdb|2DLG|A Chain A, Solution Structure Of The 20th Filamin Domain From Human Filamin-B Length = 102 Back     alignment and structure
>pdb|2DLG|A Chain A, Solution Structure Of The 20th Filamin Domain From Human Filamin-B Length = 102 Back     alignment and structure
>pdb|2DLG|A Chain A, Solution Structure Of The 20th Filamin Domain From Human Filamin-B Length = 102 Back     alignment and structure
>pdb|2DI8|A Chain A, Solution Structure Of The 19th Filamin Domain From Human Filamin-B Length = 111 Back     alignment and structure
>pdb|2DI8|A Chain A, Solution Structure Of The 19th Filamin Domain From Human Filamin-B Length = 111 Back     alignment and structure
>pdb|2DI8|A Chain A, Solution Structure Of The 19th Filamin Domain From Human Filamin-B Length = 111 Back     alignment and structure
>pdb|2DIC|A Chain A, Solution Structure Of The 12th Filamin Domain From Human Filamin-B Length = 105 Back     alignment and structure
>pdb|2DIC|A Chain A, Solution Structure Of The 12th Filamin Domain From Human Filamin-B Length = 105 Back     alignment and structure
>pdb|2DIC|A Chain A, Solution Structure Of The 12th Filamin Domain From Human Filamin-B Length = 105 Back     alignment and structure
>pdb|2EED|A Chain A, Solution Structure Of The 24th Filamin Domain From Human Filamin-B Length = 101 Back     alignment and structure
>pdb|1V05|A Chain A, Dimerization Of Human Filamin C: Crystal Structure Of The Domain 24 Length = 96 Back     alignment and structure
>pdb|2DI9|A Chain A, Solution Structure Of The 9th Filamin Domain From Human Filamin-B Length = 131 Back     alignment and structure
>pdb|2DI9|A Chain A, Solution Structure Of The 9th Filamin Domain From Human Filamin-B Length = 131 Back     alignment and structure
>pdb|2DI9|A Chain A, Solution Structure Of The 9th Filamin Domain From Human Filamin-B Length = 131 Back     alignment and structure
>pdb|3CNK|A Chain A, Crystal Structure Of The Dimerization Domain Of Human Filamin A Length = 89 Back     alignment and structure
>pdb|1WLH|A Chain A, Molecular Structure Of The Rod Domain Of Dictyostelium Filamin Length = 311 Back     alignment and structure
>pdb|1WLH|A Chain A, Molecular Structure Of The Rod Domain Of Dictyostelium Filamin Length = 311 Back     alignment and structure
>pdb|1WLH|A Chain A, Molecular Structure Of The Rod Domain Of Dictyostelium Filamin Length = 311 Back     alignment and structure
>pdb|1WLH|A Chain A, Molecular Structure Of The Rod Domain Of Dictyostelium Filamin Length = 311 Back     alignment and structure
>pdb|3RGH|A Chain A, Structure Of Filamin A Immunoglobulin-Like Repeat 10 From Homo Sapiens Length = 100 Back     alignment and structure
>pdb|3RGH|A Chain A, Structure Of Filamin A Immunoglobulin-Like Repeat 10 From Homo Sapiens Length = 100 Back     alignment and structure
>pdb|2E9J|A Chain A, Solution Structure Of The 14th Filamin Domain From Human Filamin-B Length = 119 Back     alignment and structure
>pdb|2E9J|A Chain A, Solution Structure Of The 14th Filamin Domain From Human Filamin-B Length = 119 Back     alignment and structure
>pdb|2E9J|A Chain A, Solution Structure Of The 14th Filamin Domain From Human Filamin-B Length = 119 Back     alignment and structure
>pdb|2D7N|A Chain A, Solution Structure Of The 16th Filamin Domain From Human Filamin C Length = 93 Back     alignment and structure
>pdb|2D7N|A Chain A, Solution Structure Of The 16th Filamin Domain From Human Filamin C Length = 93 Back     alignment and structure
>pdb|2D7N|A Chain A, Solution Structure Of The 16th Filamin Domain From Human Filamin C Length = 93 Back     alignment and structure
>pdb|2DIA|A Chain A, Solution Structure Of The 10th Filamin Domain From Human Filamin-B Length = 113 Back     alignment and structure
>pdb|2DIA|A Chain A, Solution Structure Of The 10th Filamin Domain From Human Filamin-B Length = 113 Back     alignment and structure
>pdb|2DIA|A Chain A, Solution Structure Of The 10th Filamin Domain From Human Filamin-B Length = 113 Back     alignment and structure
>pdb|2D7M|A Chain A, Solution Structure Of The 14th Filamin Domain From Human Filamin C Length = 115 Back     alignment and structure
>pdb|2D7M|A Chain A, Solution Structure Of The 14th Filamin Domain From Human Filamin C Length = 115 Back     alignment and structure
>pdb|2DJ4|A Chain A, Solution Structure Of The 13th Filamin Domain From Human Filamin-B Length = 108 Back     alignment and structure
>pdb|4B7L|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain With 1st Filamin Repeat Length = 347 Back     alignment and structure
>pdb|4B7L|A Chain A, Crystal Structure Of Human Filamin B Actin Binding Domain With 1st Filamin Repeat Length = 347 Back     alignment and structure
>pdb|2EE9|A Chain A, Solution Structure Of The 16th Filamin Domain From Human Filamin-B Length = 95 Back     alignment and structure
>pdb|2EE9|A Chain A, Solution Structure Of The 16th Filamin Domain From Human Filamin-B Length = 95 Back     alignment and structure
>pdb|2EE9|A Chain A, Solution Structure Of The 16th Filamin Domain From Human Filamin-B Length = 95 Back     alignment and structure
>pdb|2DMB|A Chain A, Solution Structure Of The 15th Filamin Domain From Human Filamin-B Length = 124 Back     alignment and structure
>pdb|2DMB|A Chain A, Solution Structure Of The 15th Filamin Domain From Human Filamin-B Length = 124 Back     alignment and structure
>pdb|2DS4|A Chain A, Solution Structure Of The Filamin Domain From Human Tripartite Motif Protein 45 Length = 113 Back     alignment and structure
>pdb|2DS4|A Chain A, Solution Structure Of The Filamin Domain From Human Tripartite Motif Protein 45 Length = 113 Back     alignment and structure
>pdb|2DIB|A Chain A, Solution Structure Of The 11th Filamin Domain From Human Filamin-B Length = 128 Back     alignment and structure
>pdb|2DIB|A Chain A, Solution Structure Of The 11th Filamin Domain From Human Filamin-B Length = 128 Back     alignment and structure
>pdb|1QFH|A Chain A, Dimerization Of Gelation Factor From Dictyostelium Discoideum: Crystal Structure Of Rod Domains 5 And 6 Length = 212 Back     alignment and structure
>pdb|1QFH|A Chain A, Dimerization Of Gelation Factor From Dictyostelium Discoideum: Crystal Structure Of Rod Domains 5 And 6 Length = 212 Back     alignment and structure
>pdb|1QFH|A Chain A, Dimerization Of Gelation Factor From Dictyostelium Discoideum: Crystal Structure Of Rod Domains 5 And 6 Length = 212 Back     alignment and structure
>pdb|1KSR|A Chain A, The Repeating Segments Of The F-Actin Cross-Linking Gelation Factor (Abp-120) Have An Immunoglobulin Fold, Nmr, 20 Structures Length = 100 Back     alignment and structure
>pdb|1KSR|A Chain A, The Repeating Segments Of The F-Actin Cross-Linking Gelation Factor (Abp-120) Have An Immunoglobulin Fold, Nmr, 20 Structures Length = 100 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query898
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 3e-64
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 2e-59
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 3e-47
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 8e-40
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 6e-23
2j3s_A 288 Filamin-A; cytoskeleton, phosphorylation, structur 8e-17
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 4e-14
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 3e-47
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 4e-38
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 3e-29
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 1e-24
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 1e-18
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 9e-18
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 9e-17
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 2e-14
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 3e-41
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 2e-37
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 4e-36
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 9e-28
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 4e-24
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 6e-24
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 8e-22
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 1e-20
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 3e-40
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 7e-35
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 2e-30
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 3e-26
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 1e-18
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 8e-18
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 8e-12
1wlh_A 311 Gelation factor; ABP-120, filamin, immunoglobulin 2e-08
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 6e-40
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 1e-25
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 1e-23
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 6e-22
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 8e-15
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 3e-11
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 3e-10
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 1e-09
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 2e-05
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-39
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-29
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-25
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-25
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-14
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-12
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-12
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 9e-06
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-37
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-25
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-25
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-22
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-17
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-11
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-10
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-09
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-05
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 8e-37
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-31
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-25
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-21
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 9e-21
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-16
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-15
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-15
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-36
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-25
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-23
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-22
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-22
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 7e-18
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-16
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-12
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-06
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 1e-35
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 2e-26
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 8e-26
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 6e-23
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 5e-17
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 4e-11
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 1e-10
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 3e-09
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 2e-05
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 9e-35
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-33
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-30
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-24
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-16
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-15
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 7e-12
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-10
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 1e-34
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 2e-30
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 1e-21
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 5e-20
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 8e-19
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 2e-18
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 2e-18
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 3e-16
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 5e-12
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 3e-07
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 9e-32
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-19
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 9e-18
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-17
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-17
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-15
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 7e-15
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-09
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-07
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-31
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 4e-30
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 1e-24
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 1e-21
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-17
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 1e-10
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-10
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 1e-08
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 3e-04
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-31
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-29
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-27
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-22
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 7e-21
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-12
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-11
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-09
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-05
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-30
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-25
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-24
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-20
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-17
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-12
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-11
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-09
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-05
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 3e-30
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 5e-21
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 3e-20
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 1e-19
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 8e-14
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 9e-13
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 2e-12
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 4e-10
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 6e-07
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 4e-30
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 9e-30
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 1e-26
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 8e-22
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 3e-19
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 7e-12
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 2e-11
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 7e-10
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 1e-05
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 1e-28
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 7e-21
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 3e-19
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 3e-18
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 4e-18
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 3e-17
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 4e-15
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 5e-11
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-07
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-28
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-22
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-20
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-19
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-17
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-16
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-13
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-11
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-06
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-28
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 9e-22
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-21
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-20
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-13
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-12
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-12
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-06
1qfh_A212 Protein (gelation factor); actin binding protein, 1e-27
1qfh_A212 Protein (gelation factor); actin binding protein, 5e-23
1qfh_A212 Protein (gelation factor); actin binding protein, 2e-21
1qfh_A212 Protein (gelation factor); actin binding protein, 4e-21
1qfh_A212 Protein (gelation factor); actin binding protein, 3e-16
1qfh_A212 Protein (gelation factor); actin binding protein, 1e-15
1qfh_A212 Protein (gelation factor); actin binding protein, 4e-15
1qfh_A212 Protein (gelation factor); actin binding protein, 5e-14
1qfh_A212 Protein (gelation factor); actin binding protein, 2e-12
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 4e-26
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 2e-24
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 6e-22
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 7e-21
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 2e-14
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 3e-13
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 1e-12
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 1e-10
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 2e-07
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-25
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-21
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-20
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 8e-20
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 7e-13
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-12
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-11
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-06
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-24
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-20
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-18
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-17
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-17
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-12
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-11
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-06
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 5e-24
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 3e-23
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 5e-20
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 3e-19
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 2e-13
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 2e-12
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 2e-12
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 2e-11
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 4e-07
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 7e-24
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 9e-20
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-19
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 4e-19
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-14
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 3e-14
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 4e-13
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 8e-12
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 5e-07
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 7e-23
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-21
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-19
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-18
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 8e-15
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-13
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 5e-13
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-10
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-06
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 3e-19
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 1e-17
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 6e-16
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 9e-15
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 4e-11
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 2e-10
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 3e-09
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 4e-07
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 1e-04
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-19
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-17
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 6e-16
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 1e-13
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 3e-12
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-12
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 8e-12
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 4e-11
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 2e-09
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 6e-19
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-18
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 4e-17
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 6e-15
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 9e-15
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 9e-13
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 6e-12
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 9e-12
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 2e-11
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 3e-12
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 5e-10
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 2e-07
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 9e-07
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 1e-05
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 7e-04
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
 Score =  217 bits (552), Expect = 3e-64
 Identities = 158/255 (61%), Positives = 193/255 (75%), Gaps = 2/255 (0%)

Query: 44  GYGGLSLSIEGPSKAEIQCKDNADGSLNISYRPTEPGYYIINLKFADHHVEGSPFTAKIV 103
           GYGGLSLSIEGPSK +I  +D  DG+  ++Y PTEPG YIIN+KFAD HV GSPF+ K+ 
Sbjct: 35  GYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKV- 93

Query: 104 GEGSNRQREKIQRQREAVPVTEVGSTCKLTFKMPGITAFDLSATVTSPGGVTEDAEINEV 163
             G  R +E I R+R A  V  VGS C L+ K+P I+  D++A VTSP G T +AEI E 
Sbjct: 94  -TGEGRVKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEG 152

Query: 164 EDGLYAVHFVPKELGVHTVSVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQ 223
           E+  Y + FVP E+G HTVSV+YK  H+PGSPFQFTVGPL +GGAH+V AGGPGLER E 
Sbjct: 153 ENHTYCIRFVPAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEA 212

Query: 224 NQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFND 283
             P EF++WTREAGAG LAI+VEGPSKAEI F+DRKDGSC V+YVV EPG+Y V +KFN+
Sbjct: 213 GVPAEFSIWTREAGAGGLAIAVEGPSKAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNE 272

Query: 284 QHIPDSPYKLFVSPA 298
           +HIPDSP+ + V+  
Sbjct: 273 EHIPDSPFVVPVASP 287
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query898
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 100.0
2j3s_A288 Filamin-A; cytoskeleton, phosphorylation, structur 100.0
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 100.0
1wlh_A311 Gelation factor; ABP-120, filamin, immunoglobulin 100.0
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 100.0
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 100.0
2k7q_A191 Filamin-A; IG-like, ABP-280, actin binding protein 100.0
2k7p_A188 Filamin-A; IG-like, ABP-280, actin binding protein 99.98
1qfh_A212 Protein (gelation factor); actin binding protein, 99.97
1qfh_A212 Protein (gelation factor); actin binding protein, 99.96
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.94
2di9_A131 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.93
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 99.92
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.91
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.91
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.91
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 99.91
2nqc_A138 Filamin-C; immunoglobulin, metal binding, immune s 99.91
2eea_A115 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.9
2eec_A125 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.9
2dmc_A116 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.89
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.89
2k9u_A119 Gamma filamin; cytoskeletal complex, alternative s 99.88
2e9j_A119 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.88
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 99.87
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 99.87
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.87
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 99.87
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.87
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.87
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.86
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 99.86
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 99.86
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.86
2w0p_A94 Filamin-A; alternative splicing, cytoskeleton/comp 99.86
2dia_A113 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.85
2bp3_A97 Filamin A; structural protein, cytoskeleton/comple 99.85
2d7m_A115 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.85
3rgh_A100 Filamin-A; cell adhesion, cytoskeleton-complex, di 99.85
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.84
2dib_A128 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.84
2ee6_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.84
2di8_A111 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.84
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.84
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.83
2d7o_A111 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.83
1v05_A96 Filamin C; actin-binding protein, immunoglobulin; 99.82
2dic_A105 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.82
3cnk_A89 Filamin-A; FLNA24, X-RAY crystalography, homodimer 99.81
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.81
2dj4_A108 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.81
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 99.78
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.78
2dmb_A124 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.78
2ds4_A113 Tripartite motif protein 45; beta-sandwich, immuno 99.77
2d7p_A112 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.76
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 99.76
3tkv_A414 FDEC fragment B, attaching and effacing protein, p 99.72
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.72
4b7l_A347 Filamin-B; structural protein, FR 1 filamin hinge 99.72
3tkv_A414 FDEC fragment B, attaching and effacing protein, p 99.69
2dlg_A102 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.68
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.6
2d7n_A93 Filamin-C; beta-sandwich, immunoglobulin-like fold 99.58
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.53
2ee9_A95 Filamin-B; beta-sandwich, immunoglobulin-like fold 99.49
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 99.46
2di7_A124 BK158_1; beta-sandwich, immunoglobulin-like fold, 99.4
1cwv_A492 Invasin; integrin-binding protein, INV gene, struc 98.32
1cwv_A492 Invasin; integrin-binding protein, INV gene, struc 98.17
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 95.52
2pn5_A 1325 TEP1R, thioester-containing protein I; FULL-length 94.76
4fxk_A656 Complement C4 beta chain; immune system, proteolyt 94.35
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 93.77
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 92.44
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 86.58
2hr0_A645 Complement C3 beta chain; complement component C3B 85.11
2b39_A 1661 C3; thioester, immune defense, immune system; HET: 80.27
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Back     alignment and structure
Probab=100.00  E-value=7.9e-52  Score=450.17  Aligned_cols=280  Identities=38%  Similarity=0.675  Sum_probs=243.6

Q ss_pred             CCcceEEEeCCCCCcceeeeeeEEEEEeccCCCCceEEEEEcCCcceeeEEECCCCcEEEEEEeCCCceEEEEEEECCee
Q psy192          206 GGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQH  285 (898)
Q Consensus       206 ~d~~~v~a~G~GL~~~~~g~~~~F~V~~~daG~g~l~v~v~gps~~~i~~~d~~dGty~v~y~P~~~G~y~i~V~~~g~~  285 (898)
                      .||++|+|+|+||+.+.+|++++|+|+++|||.+.|+|.|.+|++.++.+.|++||+|.++|+|+++|.|.|+|+|+|+|
T Consensus         4 ~d~~~~~~~G~Gl~~~~~g~~~~F~I~~~dag~g~l~v~i~~p~~~~~~~~d~~dGty~v~y~p~~~G~y~i~V~~~g~~   83 (288)
T 2j3s_A            4 GDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLEDGTCRVTYCPTEPGNYIINIKFADQH   83 (288)
T ss_dssp             BCGGGCEEESGGGTEEETTSCEEEEEECTTSBSCCEEEEEESSSCCEEEEEECTTSEEEEEEECSSCEEEEEEEEETTEE
T ss_pred             CCcceEEEECCCcCCcCCCCcEEEEEEeccCCCCcEEEEEECCCCceeEEEECCCCEEEEEEECCCCeEEEEEEEECCEE
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCceeEecCCCCCceeE-EEeeeCCCceecCCCeEEEEEecCC-ccceEEEEECCCCCeeeeEEEecCCCeEEEEEE
Q psy192          286 IPDSPYKLFVSPAMGDAHKL-EIAQFPQGVVMADKPTQFLVRKNGA-VGALDAKVISPSGTEDDCFIQPIDGDNYSIRFM  363 (898)
Q Consensus       286 I~gSPf~v~V~~~~~~~~~~-~~~~~~~~~~~~g~~~~f~V~~~~a-~G~l~v~v~~p~g~~~~~~v~~~~~g~y~v~f~  363 (898)
                      |+||||++.|.+... .+.. ...........+|.+++|.+++.++ .++|+++|++|+|...++.+.++++|+|.++|+
T Consensus        84 i~gSPf~v~v~~~~~-v~~~~~~~~~~~~~~~vg~~~~~~~~~~~~~~~~l~~~V~~psG~~~~~~v~~~~~g~y~v~f~  162 (288)
T 2j3s_A           84 VPGSPFSVKVTGEGR-VKESITRRRRAPSVANVGSHCDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFV  162 (288)
T ss_dssp             CTTCSEEEEEESCCS-EEEEEEEEECCCCCCSCCSSCCC--------CCCEEEEEECTTCCEEEEBC-------CCCBCC
T ss_pred             CCCCCEEEEEcCCcc-ccceecccccCCCccccCcceEEEEEcCCCCcCceEEEEECCCCCeeeeEEEeCCCCEEEEEEe
Confidence            999999999987532 2111 1111122345689999999988766 467999999999999999999999999999999


Q ss_pred             ecCCeeEEEEEEECCeecCCCCeEEEecc-CCCCCceEEecCCCcceeeeCCeEEEEEEcCCCCCCceEEEEECCCCcee
Q psy192          364 PRENGIHNIHIKFNGVHIPGSPLRIKVGK-GEADPAAVHATGNGLAEIKSGVKTDFIVDTCNAGAGTLAVTIDGPSKVSM  442 (898)
Q Consensus       364 P~~~G~h~i~V~~~g~~I~gSPf~v~V~~-~~~d~s~v~v~G~Gl~~~~~g~~~~F~Vd~~~aG~g~l~v~v~gp~~~~~  442 (898)
                      |+++|.|+|+|+|+|++|++|||.++|.+ ...||+||+++|+||..+.+|++++|+|++++||.+.|++.|.||+++.+
T Consensus       163 P~e~G~h~v~V~~~g~~i~gsPf~~~V~~~~~~d~~k~~~~G~GL~~~~~g~~~~F~I~~~dag~g~l~v~v~gp~~~~~  242 (288)
T 2j3s_A          163 PAEMGTHTVSVKYKGQHVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEAGVPAEFSIWTREAGAGGLAIAVEGPSKAEI  242 (288)
T ss_dssp             CCSCEEEEEEEEETTEECTTCSEEEEESCCCCCCGGGCEEESGGGTCEETTBCEEEEEECCBSSSEEEEEEEEESSCEEE
T ss_pred             cccceeeEEEEEECCeeCCCCCeEEEEeccCCCCcceEEEEcCCccceEeCCceEEEEEeCCCCCCceEEEEeCCCCcce
Confidence            99999999999999999999999999985 35799999999999999999999999999999999999999999999889


Q ss_pred             eeEEeCCe-EEEEEecCCCeeEEEEEEECCEecCCCCeEEEEecc
Q psy192          443 DCTEVEEG-YKVRYTPLVPGDYYVSLKYNGYHIVGSPFKVKCTGK  486 (898)
Q Consensus       443 ~~~~~~~g-y~v~ytp~~~G~y~i~V~~~g~~I~gSPf~v~v~~~  486 (898)
                      ++.+++|| |.|+|+|+++|.|.|+|+|+|+||+||||++.|.++
T Consensus       243 ~~~d~~dGt~~v~y~p~~~G~y~i~V~~~~~~i~gSPf~v~v~~~  287 (288)
T 2j3s_A          243 SFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASP  287 (288)
T ss_dssp             EEEECTTSEEEEEEEESSCEEEEEEEEETTEECTTCSEEEEEECC
T ss_pred             eEEECCCCEEEEEEEcCCCeeEEEEEEECCEECCCCCEEEEEeCC
Confidence            99999999 999999999999999999999999999999999754
>2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Back     alignment and structure
>1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Back     alignment and structure
>1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Back     alignment and structure
>2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Back     alignment and structure
>2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Back     alignment and structure
>2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Back     alignment and structure
>2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Back     alignment and structure
>2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Back     alignment and structure
>2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A Back     alignment and structure
>2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 Back     alignment and structure
>1cwv_A Invasin; integrin-binding protein, INV gene, structural protein; HET: CIT; 2.30A {Yersinia pseudotuberculosis} SCOP: b.1.14.1 b.1.14.1 b.1.14.1 b.1.14.1 d.169.1.3 Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>2pn5_A TEP1R, thioester-containing protein I; FULL-length mature peptide, immune system; HET: NAG; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fxk_A Complement C4 beta chain; immune system, proteolytic cascade; HET: NAG BMA; 3.60A {Homo sapiens} PDB: 4fxg_A* Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure
>2hr0_A Complement C3 beta chain; complement component C3B, immune system; HET: THC; 2.26A {Homo sapiens} PDB: 2i07_A* 2wii_A* 2win_A* 2xwj_A* 3l3o_A* 3l5n_A* 3nms_A* 3nsa_A* 3ohx_A* 3t4a_A 2a74_A* 2a73_A* 2qki_A* 3g6j_A 2ice_A* 2icf_A* 2xwb_A* Back     alignment and structure
>2b39_A C3; thioester, immune defense, immune system; HET: NAG BMA; 3.00A {Bos taurus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 898
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 5e-33
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 6e-29
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 3e-22
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 1e-20
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 5e-18
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 7e-14
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 2e-13
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 9e-12
d2di9a1118 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens 5e-05
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 4e-27
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 3e-20
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 3e-20
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 4e-18
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 1e-12
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 1e-10
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 5e-09
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 7e-06
d2w0pa192 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap 0.004
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 6e-25
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 2e-21
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 5e-20
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 7e-18
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 2e-13
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 5e-12
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 2e-11
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 6e-08
d2dica198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 0.002
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 1e-24
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 5e-23
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 2e-21
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 4e-20
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 7e-19
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 2e-17
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 4e-17
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 1e-11
d2dmca1103 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens 1e-05
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 1e-24
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 1e-21
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 4e-21
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 2e-18
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 2e-13
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 4e-13
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 5e-11
d2di8a198 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens 4e-06
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 2e-24
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 2e-18
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 1e-15
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 3e-15
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 2e-14
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 4e-14
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 2e-13
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 5e-12
d2j3sa288 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap 4e-06
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 3e-24
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 5e-22
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 7e-18
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 2e-17
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 2e-11
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 6e-11
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 1e-10
d2nqca197 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap 1e-06
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 2e-23
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 8e-18
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 2e-17
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 6e-17
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 1e-15
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 2e-14
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 3e-11
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 8e-11
d2diaa1100 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens 1e-04
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 7e-23
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 4e-21
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 1e-20
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 4e-17
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 7e-13
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 4e-11
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 6e-11
d2bp3a192 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap 6e-07
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 8e-23
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 1e-19
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 6e-18
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 8e-18
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 6e-17
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 7e-14
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 6e-12
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 1e-11
d2diba1115 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens 1e-05
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 3e-22
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 1e-19
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 4e-19
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 2e-16
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 8e-16
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 1e-12
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 9e-11
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 2e-10
d2d7ma1102 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens 3e-05
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 2e-20
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 1e-18
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 4e-18
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 3e-15
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 1e-14
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 3e-12
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 1e-09
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 3e-09
d2dj4a1101 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens 6e-04
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 3e-20
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 2e-17
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 3e-17
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 3e-16
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 4e-14
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 5e-12
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 2e-10
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 1e-09
d2dmba1111 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens 2e-04
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 5e-20
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 6e-17
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 9e-17
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 2e-15
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 1e-13
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 1e-13
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 2e-10
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 3e-10
d2d7pa199 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens 0.004
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 9e-20
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 1e-17
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 1e-17
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 4e-16
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 7e-11
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 8e-11
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 1e-10
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 8e-06
d1wlha1101 b.1.18.10 (A:547-647) F-actin cross-linking gelati 7e-04
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 1e-19
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 4e-18
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 7e-17
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 4e-15
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 4e-14
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 5e-13
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 1e-10
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 1e-09
d1v05a_96 b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta 6e-04
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 5e-19
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 5e-18
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 3e-16
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 1e-15
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 3e-13
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 7e-11
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 2e-10
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 4e-10
d1qfha1104 b.1.18.10 (A:646-749) F-actin cross-linking gelati 2e-05
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 1e-18
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 2e-17
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 4e-17
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 3e-14
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 4e-14
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 5e-14
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 8e-14
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 5e-12
d2d7na180 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) 1e-08
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 1e-13
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 7e-12
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 4e-11
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 5e-11
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 1e-09
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 2e-08
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 2e-08
d1qfha2108 b.1.18.10 (A:750-857) F-actin cross-linking gelati 1e-07
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: Filamin repeat (rod domain)
domain: Filamin b
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  121 bits (304), Expect = 5e-33
 Identities = 49/115 (42%), Positives = 66/115 (57%), Gaps = 2/115 (1%)

Query: 184 VRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAI 243
           V Y    +PGSP+        D    +V A GPGLE G   +P EF + T+ AG G L +
Sbjct: 2   VTYDGHPVPGSPYTVEASLPPD--PSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGL 59

Query: 244 SVEGPSKAEIDFKDRKDGSCYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPA 298
           +VEGP +A+I+  D  DG+C VSY+  +PGEY V I F + HIP SP+K  +   
Sbjct: 60  TVEGPCEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMP 114
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query898
d2di9a1118 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.93
d2di9a1118 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2w0pa192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2w0pa192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2bp3a192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2dica198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.87
d2nqca197 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2di8a198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2bp3a192 Filamin a {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2dica198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.86
d2di8a198 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.85
d1v05a_96 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.85
d2dj4a1101 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2d7ma1102 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2nqca197 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.84
d2d7ma1102 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2diaa1100 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2dj4a1101 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2dmca1103 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2diaa1100 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2dmca1103 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.81
d2diba1115 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.81
d1v05a_96 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.8
d2dmba1111 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.8
d2diba1115 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.79
d1qfha1104 F-actin cross-linking gelation factor (ABP-120) re 99.79
d2dmba1111 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2d7pa199 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1wlha1101 F-actin cross-linking gelation factor (ABP-120) re 99.77
d2d7pa199 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1wlha1101 F-actin cross-linking gelation factor (ABP-120) re 99.76
d1qfha1104 F-actin cross-linking gelation factor (ABP-120) re 99.75
d2j3sa288 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2j3sa288 Filamin b {Human (Homo sapiens) [TaxId: 9606]} 99.64
d2d7na180 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.59
d2d7na180 Filamin C {Human (Homo sapiens) [TaxId: 9606]} 99.58
d1qfha2108 F-actin cross-linking gelation factor (ABP-120) re 99.52
d1qfha2108 F-actin cross-linking gelation factor (ABP-120) re 99.5
d1cwva3103 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 92.29
d1cwva3103 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 91.33
d1cwva296 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 90.11
d1cwva296 Invasin {Yersinia pseudotuberculosis [TaxId: 633]} 88.66
d1vlfn179 Transhydroxylase beta subunit, BthL, C-terminal do 86.68
d1vjja399 Transglutaminase, two C-terminal domains {Human (H 85.23
d1f00i195 Intimin {Escherichia coli [TaxId: 562]} 85.01
d1vjja399 Transglutaminase, two C-terminal domains {Human (H 83.55
d1ex0a3100 Transglutaminase, two C-terminal domains {Human (H 82.82
d2q3za398 Transglutaminase, two C-terminal domains {Human (H 80.01
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: E set domains
family: Filamin repeat (rod domain)
domain: Filamin b
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=7.9e-27  Score=216.50  Aligned_cols=115  Identities=42%  Similarity=0.769  Sum_probs=109.8

Q ss_pred             EEEECCeecCCCceEEEEccCCCCCcceEEEeCCCCCcceeeeeeEEEEEeccCCCCceEEEEEcCCcceeeEEECCCCc
Q psy192          183 SVRYKDIHIPGSPFQFTVGPLRDGGAHRVHAGGPGLERGEQNQPCEFNVWTREAGAGSLAISVEGPSKAEIDFKDRKDGS  262 (898)
Q Consensus       183 ~V~~~g~~V~gSPf~v~V~~~~~~d~~~v~a~G~GL~~~~~g~~~~F~V~~~daG~g~l~v~v~gps~~~i~~~d~~dGt  262 (898)
                      +|+|+|++|+||||.+.|.+.  .|+++|+|+|+||+++.+|++++|+|++++||.|.|+|.|++|++.++.|.+++||+
T Consensus         1 ~V~~~g~~v~gSPf~~~v~~~--~d~~kv~v~G~Gl~~~~vg~~~~F~Vd~~~ag~g~l~v~i~~p~~~~~~v~~~~dG~   78 (118)
T d2di9a1           1 DVTYDGHPVPGSPYTVEASLP--PDPSKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGPCEAKIECSDNGDGT   78 (118)
T ss_dssp             CCCCCCCCCSSCTTSCSCCCC--CCGGGCEEESHHHHEEETTSCEEEEEECTTTCSSCEEEEECSSSCCEEEEEECSSSE
T ss_pred             CeeECCEECCCCCEEEEEcCC--CCccEEEEECCccCceeeeeeEEEEEEeCCCCCCccEEEEecCCceEEEEEECCCCE
Confidence            478999999999999999864  579999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEEeCCCceEEEEEEECCeeCCCCCceeEecCCC
Q psy192          263 CYVSYVVAEPGEYRVGIKFNDQHIPDSPYKLFVSPAM  299 (898)
Q Consensus       263 y~v~y~P~~~G~y~i~V~~~g~~I~gSPf~v~V~~~~  299 (898)
                      |.++|+|.++|.|.|+|+|+|++|+||||++.|.++.
T Consensus        79 y~v~ytP~~~G~y~i~V~~~g~~i~gSPf~v~V~~~~  115 (118)
T d2di9a1          79 CSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPF  115 (118)
T ss_dssp             EEEEEECSSSSEEEEEEEESSCBCTTCSEEEEEECCC
T ss_pred             EEEEEEeCCcEeEEEEEEECCEECCCCCEEEEEeCCC
Confidence            9999999999999999999999999999999998864
>d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1cwva3 b.1.14.1 (A:693-795) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1cwva3 b.1.14.1 (A:693-795) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1vjja3 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} Back     information, alignment and structure
>d1f00i1 b.1.14.1 (I:658-752) Intimin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjja3 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} Back     information, alignment and structure
>d1ex0a3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} Back     information, alignment and structure
>d2q3za3 b.1.5.1 (A:586-683) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} Back     information, alignment and structure