Psyllid ID: psy2356


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------53
SGEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKVVAPEIMQETFMSDSEDENGEW
ccccHHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccccHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHccccHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHHccHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHHHcHHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHHHcccccccccccccc
ccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccccccccHHHHHHHcccHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHcccHHHHHHHHHcccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccHHHHHHHHHHcccccccEcccccEHHHHHHHHccHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHcHccccccccccccccHHHHHHHcccHHHHHHHHHccccc
SGEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSrganvdsatkkgNTALHIASLGeflvpvwlgdfkqgdgftpLAVAMQQGHDKVVAVLLEndtrgkdgfTPLAVAMQQGHDKVVAVLLEndtrgkvrlpalhiaAKKDDTKAAKLLLEVSCtvdpasvlssttgnaatggyliknehnpdvtsksgftplhiashygnegvanilldkradvnfsaksgltplhvASFMGCMNIVIYLLqndanpdiptvrgetplhlaaRANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKgdgekhkngltplhlcaqEDRVGVAELLLKnnaqvdtptkMDIATTLLeygakpnaesvagftplhlsasegHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAkgdgekhkvvapEIMQetfmsdsedengew
SGEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAAKLLLEVSCtvdpasvlssttgnaATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSqlkkrgreghTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLknnaqvdtptKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIiakgdgekhkvvaPEIMqetfmsdsedengew
SGEGHTSFLRAARAGHLDKIIEHLKNNVDIntananglnalhlaSKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIaakkddtkaaklllEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKVVAPEIMQETFMSDSEDENGEW
********LRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEH***V**KSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISV*********************ALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKP***SVAGFTPL****************************GHTALSIAQKLGYISVEESLKGVTETLIIAKGD***************************
SGEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKVVAPEIMQETFMSDS**E***W
SGEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLG**************HTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKVVAPEIMQETF***********
***GHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKVVAPEIMQETFMSDSEDENG**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SGEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKVVAPEIMQETFMSDSEDENGEW
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query529 2.2.26 [Sep-21-2011]
Q01484 3957 Ankyrin-2 OS=Homo sapiens yes N/A 0.860 0.114 0.426 3e-99
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.850 0.102 0.433 2e-98
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus yes N/A 0.860 0.116 0.424 3e-98
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.858 0.231 0.427 9e-98
P16157 1881 Ankyrin-1 OS=Homo sapiens no N/A 0.841 0.236 0.406 1e-88
Q02357 1862 Ankyrin-1 OS=Mus musculus no N/A 0.835 0.237 0.404 9e-86
Q4UMH61179 Putative ankyrin repeat p yes N/A 0.888 0.398 0.280 5e-37
Q9ULJ7 1429 Ankyrin repeat domain-con no N/A 0.848 0.314 0.299 3e-34
Q5ZLC8 1073 Serine/threonine-protein no N/A 0.837 0.412 0.273 1e-28
Q8BTI7 1076 Serine/threonine-protein no N/A 0.880 0.433 0.266 3e-27
>sp|Q01484|ANK2_HUMAN Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 Back     alignment and function desciption
 Score =  362 bits (930), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 247/579 (42%), Positives = 320/579 (55%), Gaps = 124/579 (21%)

Query: 2   GEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGA 61
            + + SFLRAARAG+LDK++E+LK  +DINT N NGLNALHLA+K+GH+ +V ELL RG+
Sbjct: 29  SDSNASFLRAARAGNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGS 88

Query: 62  NVDSATKKGNTALHIASL-GEFLVPVWLGDFKQG--------DGFTPLAVAMQQGHDKVV 112
           +VDSATKKGNTALHIASL G+  V   L   K+G        +GFTPL +A Q+ H  VV
Sbjct: 89  SVDSATKKGNTALHIASLAGQAEVVKVL--VKEGANINAQSQNGFTPLYMAAQENHIDVV 146

Query: 113 AVLLEN----DTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTK 168
             LLEN     T  +DGFTPLAVA+QQGH++ VA+LLENDT+GKVRLPALHIAA+KDDTK
Sbjct: 147 KYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTK 206

Query: 169 AAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSK--------SGFTPLHIA 220
           +A LLL+                          N+HN DV SK        SGFTPLHIA
Sbjct: 207 SAALLLQ--------------------------NDHNADVQSKMMVNRTTESGFTPLHIA 240

Query: 221 SHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGE 280
           +HYGN  VA +LL++ A V+F+A++G+TPLHVAS  G  N+V  LL      D  T  G 
Sbjct: 241 AHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGL 300

Query: 281 TPLHLAARANQTDIIRILLRNGAQVDARAREG----H----------------------- 313
           TPLH AAR+    ++ +LL  GA + AR + G    H                       
Sbjct: 301 TPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDD 360

Query: 314 ------TALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEE---- 363
                 TAL +A   G+  V + L   +R+    R   G T L IA K   I V E    
Sbjct: 361 VTLDYLTALHVAAHCGHYRVTKLL-LDKRANPNARALNGFTPLHIACKKNRIKVMELLVK 419

Query: 364 ---SLKGVTET------------------LIIAKGDGEKHKN--GLTPLHLCAQEDRVGV 400
              S++ +TE+                  L++  G      N  G T LH+ A+  +V V
Sbjct: 420 YGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEV 479

Query: 401 AELLLKNNAQVD-------TPT-------KMDIATTLLEYGAKPNAESVAGFTPLHLSAS 446
              LL+N A VD       TP        K +I   LL++ A P+A +  G+TPLH+SA 
Sbjct: 480 VRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAR 539

Query: 447 EGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISV 485
           EG  D++++LLE GA  S A K+G T L +A K G + V
Sbjct: 540 EGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDV 578




Attaches integral membrane proteins to cytoskeletal elements. Also binds to cytoskeletal proteins. Required for coordinate assembly of Na/Ca exchanger, Na/K ATPase and InsP3 receptor at sarcoplasmic reticulum sites in cardiomyocytes. Required for the coordinated expression of the Na/K ATPase, Na/Ca exchanger and beta-2-spectrin (SPTBN1) in the inner segment of rod photoreceptors. Required for expression and targeting of SPTBN1 in neonatal cardiomyocytes and for the regulation of neonatal cardiomyocyte contraction rate.
Homo sapiens (taxid: 9606)
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|P16157|ANK1_HUMAN Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 Back     alignment and function description
>sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 Back     alignment and function description
>sp|Q4UMH6|Y381_RICFE Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=4 SV=1 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description
>sp|Q8BTI7|ANR52_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query529
320545676 4230 ankyrin 2, isoform P [Drosophila melanog 0.850 0.106 0.478 1e-116
320545662 4329 ankyrin 2, isoform S [Drosophila melanog 0.850 0.103 0.478 1e-116
161082081 4083 ankyrin 2, isoform L [Drosophila melanog 0.850 0.110 0.478 1e-116
320545674 4223 ankyrin 2, isoform T [Drosophila melanog 0.850 0.106 0.478 1e-115
320545672 4352 ankyrin 2, isoform Q [Drosophila melanog 0.850 0.103 0.478 1e-115
161082096 4114 ankyrin 2, isoform F [Drosophila melanog 0.850 0.109 0.478 1e-115
161082085 2404 ankyrin 2, isoform M [Drosophila melanog 0.850 0.187 0.478 1e-115
161082106 4189 ankyrin 2, isoform J [Drosophila melanog 0.850 0.107 0.478 1e-115
161082099 2532 ankyrin 2, isoform G [Drosophila melanog 0.850 0.177 0.478 1e-115
442630831 4373 ankyrin 2, isoform V [Drosophila melanog 0.852 0.103 0.477 1e-115
>gi|320545676|ref|NP_001189069.1| ankyrin 2, isoform P [Drosophila melanogaster] gi|318069164|gb|ADV37506.1| ankyrin 2, isoform P [Drosophila melanogaster] Back     alignment and taxonomy information
 Score =  424 bits (1089), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 244/510 (47%), Positives = 320/510 (62%), Gaps = 60/510 (11%)

Query: 2   GEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGA 61
           G+G+TSFLRAARAG+L++++EHLKNN+DINT+NANGLNALHLASKDGH+HVV+ELL RGA
Sbjct: 16  GDGNTSFLRAARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGA 75

Query: 62  NVDSATKKGNTALHIASLG--EFLVPVWLG-----DFKQGDGFTPLAVAMQQGHDKVVAV 114
            VDSATKKGNTALHIASL   E +V + L      + +  +GFTPL +A Q+ HD VV +
Sbjct: 76  IVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRL 135

Query: 115 LLENDTRG----KDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIAAKKDDTKAA 170
           LL N        +DGFTPLAVAMQQGHDKVVAVLLE+DTRGKVRLPALHIAAKKDD KAA
Sbjct: 136 LLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAA 195

Query: 171 KLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVAN 230
            LLL+                          N+HNPDVTSKSGFTPLHIASHYGN+ +AN
Sbjct: 196 TLLLD--------------------------NDHNPDVTSKSGFTPLHIASHYGNQNIAN 229

Query: 231 ILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARAN 290
           +L+ K ADVN+SAK  ++PLHVA+  G  N+V  LL+   N +  T  G TPLH AAR+ 
Sbjct: 230 LLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSG 289

Query: 291 QTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTAL 350
              ++ +LL  GA + A+ + G   L +A +  ++     L    R+ + +   +  TAL
Sbjct: 290 HEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARIL-LYHRAPVDEVTVDYLTAL 348

Query: 351 SIAQKLGYISVEESLKGVTETLIIAKGDGEKHK-NGLTPLHLCAQEDRVGVAELLLKNNA 409
            +A   G++        V + L+    D      NG TPLH+  +++R+ V ELLL++ A
Sbjct: 349 HVAAHCGHVR-------VAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGA 401

Query: 410 QVDTPTK--------------MDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAM 455
            +   T+              M+I   LL++ A P+  +V G TPLHL+A     D+  +
Sbjct: 402 SISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRI 461

Query: 456 LLEHGADVSHAAKEGHTALSIAQKLGYISV 485
           LL +GA V   A+E  T L IA +LG + +
Sbjct: 462 LLRNGAQVDARAREQQTPLHIASRLGNVDI 491




Source: Drosophila melanogaster

Species: Drosophila melanogaster

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|320545662|ref|NP_001189064.1| ankyrin 2, isoform S [Drosophila melanogaster] gi|318069159|gb|ADV37501.1| ankyrin 2, isoform S [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|161082081|ref|NP_729285.3| ankyrin 2, isoform L [Drosophila melanogaster] gi|158028463|gb|AAF50525.4| ankyrin 2, isoform L [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320545674|ref|NP_001189068.1| ankyrin 2, isoform T [Drosophila melanogaster] gi|318069163|gb|ADV37505.1| ankyrin 2, isoform T [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|320545672|ref|NP_001189067.1| ankyrin 2, isoform Q [Drosophila melanogaster] gi|318069162|gb|ADV37504.1| ankyrin 2, isoform Q [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|161082096|ref|NP_001097535.1| ankyrin 2, isoform F [Drosophila melanogaster] gi|158028467|gb|ABW08485.1| ankyrin 2, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|161082085|ref|NP_648148.2| ankyrin 2, isoform M [Drosophila melanogaster] gi|158028464|gb|AAN12046.2| ankyrin 2, isoform M [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|161082106|ref|NP_001097538.1| ankyrin 2, isoform J [Drosophila melanogaster] gi|158028469|gb|ABW08487.1| ankyrin 2, isoform J [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|161082099|ref|NP_001097536.1| ankyrin 2, isoform G [Drosophila melanogaster] gi|158028468|gb|ABW08486.1| ankyrin 2, isoform G [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|442630831|ref|NP_001261535.1| ankyrin 2, isoform V [Drosophila melanogaster] gi|440215440|gb|AGB94230.1| ankyrin 2, isoform V [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query529
ZFIN|ZDB-GENE-041010-165 3538 ank2b "ankyrin 2b, neuronal" [ 0.863 0.129 0.353 1.8e-62
UNIPROTKB|F1LM13 1783 Ank3 "Protein Ank3" [Rattus no 0.818 0.242 0.365 3.4e-62
UNIPROTKB|F1LPH6 1961 Ank3 "Protein Ank3" [Rattus no 0.818 0.220 0.365 4e-62
UNIPROTKB|F1PJ90 1782 ANK3 "Uncharacterized protein" 0.856 0.254 0.339 1.7e-61
UNIPROTKB|F1NG08 3694 Gga.53822 "Uncharacterized pro 0.863 0.123 0.350 4.7e-61
UNIPROTKB|K7GLA8 1847 ANK3 "Uncharacterized protein" 0.856 0.245 0.339 5.1e-61
UNIPROTKB|F1NJ80 1699 ANK3 "Uncharacterized protein" 0.848 0.264 0.341 5.8e-61
UNIPROTKB|F1NNX8 1737 ANK3 "Uncharacterized protein" 0.848 0.258 0.341 6.1e-61
UNIPROTKB|F1NNX6 1824 ANK3 "Uncharacterized protein" 0.848 0.246 0.341 6.7e-61
UNIPROTKB|F1NNX7 1915 ANK3 "Uncharacterized protein" 0.848 0.234 0.341 7.3e-61
ZFIN|ZDB-GENE-041010-165 ank2b "ankyrin 2b, neuronal" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 655 (235.6 bits), Expect = 1.8e-62, Sum P(2) = 1.8e-62
 Identities = 180/509 (35%), Positives = 270/509 (53%)

Query:     3 EGHTSFLRAARAGHLDKIIEHLKNNVDIXXXXXXXXXXXXXXSKDGHLHVVTELLSRGAN 62
             + +TSFLRAARAG++DK++E+LK  VDI              +K+GH+ +V ELL RG++
Sbjct:    31 DSNTSFLRAARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHVDLVQELLGRGSS 90

Query:    63 VDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTRG 122
             VDSATKKGNTALHIASL         G   QGD    + +  ++G +         + + 
Sbjct:    91 VDSATKKGNTALHIASLA--------G---QGD---VVKILSKRGANI--------NAQS 128

Query:   123 KDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRL-----P-ALHIXXXXXXXXXXXXXXEV 176
             ++GFTPL +A Q+ H  VV  LLEN     +       P A+ +              + 
Sbjct:   129 QNGFTPLYMASQENHLDVVRYLLENGGNQSIATEDGFTPLAIALQQGHNQVVSILLENDT 188

Query:   177 SCTVD-PASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDK 235
                V  PA  +++   +  +   L++N+HN DV SKSGFTPLHIA+HYGN  VA +LL++
Sbjct:   189 KGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNR 248

Query:   236 RADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDII 295
              A V+F+A++G+TPLHVAS  G  N+V  LL   A  D  T  G TPLH AAR+     +
Sbjct:   249 GAAVDFTARNGITPLHVASKRGNTNMVHLLLDRGAQIDAKTRDGLTPLHCAARSGHDTAV 308

Query:   296 RILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQK 355
              +LL  GA + AR + G + L +A +  ++   + L    ++ +     +  TAL +A  
Sbjct:   309 ELLLERGAPMLARTKNGLSPLHMAAQGDHVECVKHL-LQHKAPVDDVTLDYLTALHVAAH 367

Query:   356 LGYISVEESLKGVTETLIIAKGD-GEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTP 414
              G+  V       T+ L+  + +   +  NG TPLH+  +++RV V ELL+K  A +   
Sbjct:   368 CGHYRV-------TKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLIKYGAFIQAI 420

Query:   415 TK--------------MDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHG 460
             T+              ++I   LL+ GA P+  ++ G T LH++A  G  ++   LL +G
Sbjct:   421 TESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQMEVVRCLLRNG 480

Query:   461 ADVSHAAKEGHTALSIAQKLGYISVEESL 489
             A V   A+E  T L IA +LG   + + L
Sbjct:   481 AMVDARAREDQTPLHIASRLGKTEIVQLL 509


GO:0006508 "proteolysis" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0004190 "aspartic-type endopeptidase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|F1LM13 Ank3 "Protein Ank3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPH6 Ank3 "Protein Ank3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PJ90 ANK3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG08 Gga.53822 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLA8 ANK3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NJ80 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX8 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX6 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNX7 ANK3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query529
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-27
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-22
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 6e-21
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-20
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-19
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 9e-17
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-16
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-15
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 3e-15
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-14
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-13
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-13
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-13
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-12
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-12
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-12
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-11
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 2e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-11
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-11
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 5e-11
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 9e-11
PHA02875 413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-10
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-10
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-10
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 4e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-09
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 2e-09
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 2e-08
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-08
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-08
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 4e-08
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-08
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-08
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-07
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-07
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 5e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 8e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-07
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 2e-06
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 3e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 4e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-06
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 7e-06
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 8e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-05
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 1e-05
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 2e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 5e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-05
PHA02716764 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provi 7e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 8e-05
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 1e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 2e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-04
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 3e-04
PHA02989 494 PHA02989, PHA02989, ankyrin repeat protein; Provis 3e-04
smart0024830 smart00248, ANK, ankyrin repeats 3e-04
PHA02795 437 PHA02795, PHA02795, ankyrin-like protein; Provisio 3e-04
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-04
smart0024830 smart00248, ANK, ankyrin repeats 4e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 4e-04
PHA02917661 PHA02917, PHA02917, ankyrin-like protein; Provisio 4e-04
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 8e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 0.001
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.001
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 0.001
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.002
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 0.003
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 0.004
PHA02798 489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  118 bits (297), Expect = 1e-31
 Identities = 50/121 (41%), Positives = 75/121 (61%)

Query: 207 DVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLL 266
           +   + G TPLH+A+  G+  V  +LL+  ADVN     G TPLH+A+  G + IV  LL
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLL 60

Query: 267 QNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYIS 326
           +  A+ +     G TPLHLAAR    D++++LL++GA V+AR ++G T L +A K G++ 
Sbjct: 61  EKGADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLE 120

Query: 327 V 327
           V
Sbjct: 121 V 121


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165089 PHA02716, PHA02716, CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165157 PHA02795, PHA02795, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165231 PHA02917, PHA02917, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 529
KOG4177|consensus 1143 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
PHA02876 682 ankyrin repeat protein; Provisional 100.0
KOG4177|consensus 1143 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02730 672 ankyrin-like protein; Provisional 100.0
PHA02917 661 ankyrin-like protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
KOG0510|consensus 929 100.0
KOG0510|consensus 929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA03100 480 ankyrin repeat protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03095 471 ankyrin-like protein; Provisional 100.0
PHA02989 494 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG0508|consensus615 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02792 631 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02798 489 ankyrin-like protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
KOG4412|consensus226 100.0
PHA02875 413 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus 615 100.0
KOG4412|consensus226 100.0
KOG0509|consensus 600 99.98
KOG0509|consensus 600 99.97
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02859209 ankyrin repeat protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.96
KOG4369|consensus 2131 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.94
PLN03192823 Voltage-dependent potassium channel; Provisional 99.93
KOG0507|consensus 854 99.93
KOG0502|consensus296 99.92
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.92
KOG0502|consensus296 99.92
KOG4369|consensus 2131 99.9
PLN03192823 Voltage-dependent potassium channel; Provisional 99.9
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.9
KOG0505|consensus 527 99.9
KOG0507|consensus 854 99.9
KOG0505|consensus527 99.89
KOG0514|consensus452 99.87
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.85
KOG0514|consensus452 99.85
PHA02741169 hypothetical protein; Provisional 99.84
PHA02741169 hypothetical protein; Provisional 99.82
PHA02884300 ankyrin repeat protein; Provisional 99.82
PHA02884300 ankyrin repeat protein; Provisional 99.81
KOG0512|consensus228 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
KOG0512|consensus228 99.75
PHA02736154 Viral ankyrin protein; Provisional 99.74
KOG3676|consensus 782 99.74
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.72
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.7
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
KOG3676|consensus 782 99.68
KOG0195|consensus448 99.66
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.65
KOG4214|consensus117 99.64
KOG0195|consensus448 99.58
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.56
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.53
KOG4214|consensus117 99.52
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.49
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
KOG1710|consensus 396 99.44
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.4
KOG0515|consensus752 99.37
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.36
KOG1710|consensus396 99.34
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.32
KOG0515|consensus752 99.29
PF1360630 Ank_3: Ankyrin repeat 99.0
PF1360630 Ank_3: Ankyrin repeat 98.96
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.85
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.81
KOG0506|consensus622 98.8
KOG0818|consensus 669 98.77
KOG0506|consensus622 98.73
KOG0511|consensus516 98.69
KOG0818|consensus669 98.64
KOG2384|consensus 223 98.64
KOG0783|consensus 1267 98.64
KOG0783|consensus 1267 98.61
KOG0782|consensus1004 98.56
KOG0782|consensus1004 98.55
KOG0705|consensus749 98.4
KOG3609|consensus 822 98.36
KOG0511|consensus 516 98.3
KOG0705|consensus749 98.29
KOG0522|consensus 560 98.29
KOG0521|consensus785 98.21
KOG0522|consensus560 98.21
KOG3609|consensus 822 98.2
KOG2384|consensus223 97.99
KOG0521|consensus785 97.84
KOG0520|consensus975 97.46
KOG2505|consensus591 97.41
KOG0520|consensus975 97.32
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.29
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 97.2
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.1
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.04
KOG2505|consensus591 96.98
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 95.8
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 94.47
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 94.24
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.42
PLN03218 1060 maturation of RBCL 1; Provisional 88.95
PLN032181060 maturation of RBCL 1; Provisional 87.89
>KOG4177|consensus Back     alignment and domain information
Probab=100.00  E-value=2.9e-55  Score=436.26  Aligned_cols=515  Identities=34%  Similarity=0.507  Sum_probs=435.4

Q ss_pred             CCchhHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCChHHHHHHHcCChhHHHHHHHCCCCCCCCCCCCCchHHHHhhcC
Q psy2356           2 GEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGE   81 (529)
Q Consensus         2 ~~g~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~~~l~~a~~~~   81 (529)
                      .+|.||||.|++.|+.++++.|+..|+.++..+..|.||||.|+..|+.+++++|+..|+++++.++.|.||++++....
T Consensus        85 ~~~~~plh~a~~~~~a~~v~~ll~~ga~~~~~~~~~lTpLh~aa~~g~~~~~~~ll~~~a~~~~k~~~g~t~l~~a~~~~  164 (1143)
T KOG4177|consen   85 RNGITPLHVASKRGDAEMVKLLLCRGAQIDARDRDGLTPLHCAARKGHVQVIELLLQHGAPINIKTKNGLSPLHMAAQVA  164 (1143)
T ss_pred             ccCccHHHHHHhhcchhHHHHHHhccCchhhcccCCCcchhhhcccccHHHHHHHHHccCCCcccccCCCCchhhhcchh
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999999987511


Q ss_pred             cccc-------ccc-----------------------cccccCCCCCHHHHHHHcCcHHHHHHHhhcCCC----CCCCCc
Q psy2356          82 FLVP-------VWL-----------------------GDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTR----GKDGFT  127 (529)
Q Consensus        82 ~~~~-------~~~-----------------------~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~----~~~~~~  127 (529)
                      ....       .++                       ....+..+.||++.|+..+.+++++.++.+|.+    +..+.+
T Consensus       165 ~~~ll~~~~~~d~l~~~~~~~~~~~~~~~ll~~~~~~~~a~~~~~~tpl~~a~~~nri~~~eLll~~gadv~a~d~~gl~  244 (1143)
T KOG4177|consen  165 CARLLLEYKAPDYLRLHVAAHCGHARVAKLLLDKKADPNASALNGFTPLHIACKKNRIKVVELLLKHGADVSAKDESGLT  244 (1143)
T ss_pred             hhHHhhhcccchhhhhhHHhhcchHHHHhhhhcccCCccccccCCCCchhhhccccccceeeeeeeccCcCCcccccCcc
Confidence            1100       000                       123455688999999999999999999999877    888999


Q ss_pred             HHHHHHHcCcHHHHHHHHhcCCC----CCCCcCHHHHHhhCCChHHHHHHHhccCCCCCCc-------ccccccCCchhh
Q psy2356         128 PLAVAMQQGHDKVVAVLLENDTR----GKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPAS-------VLSSTTGNAATG  196 (529)
Q Consensus       128 ~l~~A~~~~~~~~v~~Ll~~~~~----~~~~~~~l~~a~~~~~~~~~~~ll~~~~~~~~~~-------~~~~~~~~~~~~  196 (529)
                      |+|.|+..|+.+++.+++.++..    +..+.||+|.|+..+..++++++++.|+.+....       -.....+...++
T Consensus       245 ~lh~a~~~g~~~i~~~l~~~ga~~~~~~vr~~tplh~AA~~~~~e~~~~ll~~ga~~~~~~~~~kt~l~~a~~~g~~~i~  324 (1143)
T KOG4177|consen  245 PLHVAAFMGHLDIVKLLLQHGASVNVSTVRGETPLHMAARAGQVEVCKLLLQNGADVLAKARDDQTPLHIASRLGHEEIV  324 (1143)
T ss_pred             HHHHHHhccchhHHHHHHhcccccCcccccccCcchhhhccchhhhHhhhhccCcccccccccccChhhhhcccchHHHH
Confidence            99999999999999999998765    4456799999999999999999999988766443       244555788899


Q ss_pred             HHHHhCCCCCCcCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCcccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCC
Q psy2356         197 GYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPT  276 (529)
Q Consensus       197 ~~l~~~~~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~g~~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~g~~~~~~~  276 (529)
                      .+.++.+..++..+..+.+++|+++..++.++..++...+..-...+..+.+|++.|+..|+.+.++.++..|.+++...
T Consensus       325 ~~~l~~~~~~~aar~~g~t~lHlaa~~~~~~~~~~l~~~~~~~~~a~~k~~~pl~la~~~g~~~~v~Lll~~ga~~~~~g  404 (1143)
T KOG4177|consen  325 HLLLQAGATPNAARTAGYTPLHLAAKEGQVEVAGALLEHGAQRRQAEEKGFTPLHLAVKSGRVSVVELLLEAGADPNSAG  404 (1143)
T ss_pred             HHHhhccCCccccCcCCcccccHhhhhhhHHHHHHhhccccccCcccccCCcchhhhcccCchhHHHhhhhccCCcccCC
Confidence            99999999999999999999999999999998888888888888888889999999999999999999999999999999


Q ss_pred             CCCCcHHHHHHHcCCHHHHHHHHHCCCCcccccccCCcHHHHHHHcC-ChhHHHHhhhhcccccccCCCCCCcHHHHHHH
Q psy2356         277 VRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLG-YISVEESLGAAERSQLKKRGREGHTALSIAQK  355 (529)
Q Consensus       277 ~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~a~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~~l~~a~~  355 (529)
                      ..|.||||.++.+++..+++.++++|++.+..+..|.|++|+|+..| +.++... +...+.+++.....|.||||.|+.
T Consensus       405 k~gvTplh~aa~~~~~~~v~l~l~~gA~~~~~~~lG~T~lhvaa~~g~~~~~~~~-l~~~g~~~n~~s~~G~T~Lhlaaq  483 (1143)
T KOG4177|consen  405 KNGVTPLHVAAHYGNPRVVKLLLKRGASPNAKAKLGYTPLHVAAKKGRYLQIARL-LLQYGADPNAVSKQGFTPLHLAAQ  483 (1143)
T ss_pred             CCCcceeeehhhccCcceEEEEeccCCChhhHhhcCCChhhhhhhcccHhhhhhh-HhhcCCCcchhccccCcchhhhhc
Confidence            99999999999999999999999999999999999999999999999 4444444 456677888899999999999999


Q ss_pred             hCchhHHHHhhhhhhHHHHhhcCCCCCCCCchHHHHHHHcCCHHHHHHHHhcCCCCCCC--------------chhHHHH
Q psy2356         356 LGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTP--------------TKMDIAT  421 (529)
Q Consensus       356 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~~~~~~~~--------------~~~~~~~  421 (529)
                      .|+.++++.+++..      ...+.....+.+++|.|...+...+++.++++|++.+..              .+..+++
T Consensus       484 ~Gh~~~~~llle~~------~~~~~~~~~~l~~lhla~~~~~v~~~~~l~~~ga~v~~~~~r~~TpLh~A~~~g~v~~Vk  557 (1143)
T KOG4177|consen  484 EGHTEVVQLLLEGG------ANDNLDAKKGLTPLHLAADEDTVKVAKILLEHGANVDLRTGRGYTPLHVAVHYGNVDLVK  557 (1143)
T ss_pred             cCCchHHHHhhhcC------CccCccchhccchhhhhhhhhhHHHHHHHhhcCCceehhcccccchHHHHHhcCCchHHH
Confidence            99999998884432      112344455666666666666666666666666665522              3456666


Q ss_pred             HHHHcCCCCCCcccCCCCHHHHHHHcCcHHHHHHHHhCCCCCcchhhcCCCHHHHHHHhCCchHHHHhhcccchhhhccC
Q psy2356         422 TLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTETLIIAKG  501 (529)
Q Consensus       422 ~L~~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~A~~~~~~~~~~~L~~~~~~~~~~~~  501 (529)
                      +|+++|+|++.++..|+||||.|+..|+.+++.+|+++|++++..|.+|.|||++|++.|+.++++.|+..+........
T Consensus       558 fLLe~gAdv~ak~~~G~TPLH~Aa~~G~~~i~~LLlk~GA~vna~d~~g~TpL~iA~~lg~~~~~k~l~~~~~~~~~~~~  637 (1143)
T KOG4177|consen  558 FLLEHGADVNAKDKLGYTPLHQAAQQGHNDIAELLLKHGASVNAADLDGFTPLHIAVRLGYLSVVKLLKVVTATPAATDP  637 (1143)
T ss_pred             HhhhCCccccccCCCCCChhhHHHHcChHHHHHHHHHcCCCCCcccccCcchhHHHHHhcccchhhHHHhccCccccccc
Confidence            66677888899999999999999999999999999999999999999999999999999999999999999998644445


Q ss_pred             CCCccccchhhhhhhcccccCc
Q psy2356         502 DGEKHKVVAPEIMQETFMSDSE  523 (529)
Q Consensus       502 ~~~~~~~~~~~~~~~~~~~~~~  523 (529)
                      ..+..+...|+.+.+.+..+..
T Consensus       638 ~~e~~~g~~p~~v~e~~~~~~~  659 (1143)
T KOG4177|consen  638 VKENRKGAVPEDVAEELDTDRQ  659 (1143)
T ss_pred             hhhhhcccChhhHHHHhhhhhh
Confidence            5666667777777777766543



>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query529
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 4e-52
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 9e-37
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-19
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 5e-13
2xeh_A157 Structural Determinants For Improved Thermal Stabil 7e-19
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-15
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 2e-18
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-14
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 8e-12
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-18
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 8e-12
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 2e-18
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 1e-14
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-12
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-18
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-13
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-18
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-15
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 3e-15
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-18
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 4e-16
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-12
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-18
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 8e-18
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 7e-13
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 1e-17
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 5e-14
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-13
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-17
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 2e-17
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-11
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-17
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 4e-13
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-17
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-12
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-17
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 3e-12
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 7e-17
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-08
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-16
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-16
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-13
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 7e-10
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 4e-16
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 9e-16
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-12
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 3e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-15
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-13
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-15
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-13
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-15
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-13
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 4e-15
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 5e-13
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 7e-13
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-14
1s70_B 299 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-05
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-14
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 7e-13
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-14
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-10
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 3e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 4e-13
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 5e-13
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 2e-07
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 7e-13
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 3e-10
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 3e-12
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 5e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 3e-12
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 1e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 5e-12
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 8e-10
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 1e-11
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 7e-08
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-11
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-09
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-11
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-11
1uoh_A226 Human Gankyrin Length = 226 2e-11
1uoh_A226 Human Gankyrin Length = 226 3e-08
1uoh_A226 Human Gankyrin Length = 226 2e-07
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-11
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 2e-11
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 1e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-11
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 2e-08
3uxg_A172 Crystal Structure Of Rfxank Length = 172 7e-11
3uxg_A172 Crystal Structure Of Rfxank Length = 172 2e-07
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 1e-10
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 3e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 4e-07
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-10
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 7e-09
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 1e-10
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 2e-08
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 4e-07
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-10
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-10
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-10
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-10
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-10
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 3e-10
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 2e-07
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 4e-10
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-07
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 6e-10
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 7e-10
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 7e-10
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 7e-10
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-09
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 9e-07
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 3e-09
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 7e-07
3so8_A162 Crystal Structure Of Ankra Length = 162 4e-09
3so8_A162 Crystal Structure Of Ankra Length = 162 6e-07
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 5e-09
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 7e-07
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 7e-09
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 2e-07
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-08
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 1e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-08
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-04
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-08
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 2e-06
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-08
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 2e-06
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-08
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 2e-04
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 6e-08
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 7e-08
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 5e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-07
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 4e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 3e-07
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 4e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 3e-07
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 4e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 3e-07
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-04
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 5e-07
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 9e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 6e-05
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 5e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 6e-07
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 1e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 6e-05
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 8e-07
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 8e-07
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 5e-05
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 9e-07
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 9e-07
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 1e-06
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 4e-05
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 1e-06
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 1e-06
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 1e-06
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 8e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 2e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 9e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 2e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 4e-05
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-06
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 2e-04
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 3e-06
1dcq_A278 Crystal Structure Of The Arf-Gap Domain And Ankyrin 6e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 6e-06
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 6e-05
2b0o_E301 Crystal Structure Of Uplc1 Gap Domain Length = 301 4e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 5e-05
3lvq_E497 The Crystal Structure Of Asap3 In Complex With Arf6 6e-05
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 6e-05
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 7e-05
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-04
3deo_A183 Structural Basis For Specific Substrate Recognition 1e-04
1ycs_B239 P53-53bp2 Complex Length = 239 2e-04
1ycs_B239 P53-53bp2 Complex Length = 239 5e-04
3ljn_A364 Ankyrin Repeat Protein From Leishmania Major Length 3e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 3e-04
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 5e-04
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 3e-04
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 3e-04
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 4e-04
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 4e-04
3t9k_A390 Crystal Structure Of Acap1 C-portion Mutant S554d F 5e-04
4f1p_A368 Crystal Structure Of Mutant S554d For Arfgap And An 5e-04
3jue_A368 Crystal Structure Of Arfgap And Ank Repeat Domain O 5e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 7e-04
1bi7_B156 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 8e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 202 bits (513), Expect = 4e-52, Method: Compositional matrix adjust. Identities = 158/501 (31%), Positives = 238/501 (47%), Gaps = 112/501 (22%) Query: 48 GHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGFTPLAVAMQQG 107 GHL +V LL RGA+ + + K T LH+A+ + G Sbjct: 25 GHLPIVKNLLQRGASPNVSNVKVETPLHMAA--------------------------RAG 58 Query: 108 HDKVVAVLLEN----DTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHIXXX 163 H +V LL+N + + KD TPL A + GH +V +LLEN+ + A H Sbjct: 59 HTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLH 118 Query: 164 XXXXXXXXXXXEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHY 223 +++ G+ T L++ E + +K GFTPLH+A+ Y Sbjct: 119 ----------------------IAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKY 156 Query: 224 GNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPL 283 G VA +LL++ A N + K+GLTPLHVA ++IV LL +P P G TPL Sbjct: 157 GKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPL 216 Query: 284 HLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGAAERSQLKKRG 343 H+AA+ NQ ++ R LL+ G +A + +G T L +A Sbjct: 217 HIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLA-----------------------A 253 Query: 344 REGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGE-KHKNGLTPLHLCAQEDRVGVAE 402 +EGH + L+ + +G +K+GLTPLHL AQE V VA+ Sbjct: 254 QEGHAEM------------------VALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVAD 295 Query: 403 LLLKNNAQVDTPTKM--------------DIATTLLEYGAKPNAESVAGFTPLHLSASEG 448 +L+K+ VD T+M + LL++ A NA++ G++PLH +A +G Sbjct: 296 VLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQG 355 Query: 449 HADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVT-ETLIIAKGDGEKHK 507 H D+ +LL++GA + + +G T L+IA++LGYISV + LK VT ET + D KH+ Sbjct: 356 HTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSD--KHR 413 Query: 508 VVAPEIMQETFMSDSEDENGE 528 + PE + E + SEDE E Sbjct: 414 MSFPETVDE-ILDVSEDEGEE 433
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 Back     alignment and structure
>pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1BI7|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structure Of The Cdk6-P16ink4a Tumor Suppressor Complex Length = 156 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query529
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-102
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-84
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-24
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-80
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-60
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-47
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-76
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-63
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-56
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 6e-47
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-26
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-25
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-60
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-53
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-50
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-41
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-16
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-60
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-57
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-56
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-33
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-21
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 3e-60
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-52
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-45
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-39
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-05
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-58
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 4e-55
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-53
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-31
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 5e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-58
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-50
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-46
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-56
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-55
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-53
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-45
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-55
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-55
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-42
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-30
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-24
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 7e-55
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-46
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-45
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-52
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-49
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 7e-44
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-41
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-36
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-52
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-51
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-51
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-45
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-42
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-49
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 9e-49
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-41
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-29
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-16
2rfa_A232 Transient receptor potential cation channel subfa 3e-45
2rfa_A232 Transient receptor potential cation channel subfa 2e-36
2rfa_A232 Transient receptor potential cation channel subfa 3e-32
2rfa_A232 Transient receptor potential cation channel subfa 2e-30
2rfa_A232 Transient receptor potential cation channel subfa 6e-25
2rfa_A232 Transient receptor potential cation channel subfa 6e-24
2rfa_A232 Transient receptor potential cation channel subfa 2e-14
2rfa_A232 Transient receptor potential cation channel subfa 3e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-44
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-43
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-39
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-35
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-44
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-43
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-41
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-40
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-40
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-29
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 5e-28
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-43
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-43
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 4e-41
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-31
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-42
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-33
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-31
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-25
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 7e-05
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-41
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-35
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-35
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-34
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 4e-23
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-15
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-08
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-41
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-34
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-32
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-31
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-27
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-17
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-40
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-35
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-31
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-30
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-28
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-28
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-38
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-36
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-34
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-34
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-30
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-27
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-38
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-36
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-35
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-35
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-34
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-23
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-37
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-37
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-36
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-34
3v31_A167 Ankyrin repeat family A protein 2; structural geno 3e-34
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-29
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-37
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 5e-29
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-29
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-37
3hra_A201 Ankyrin repeat family protein; structural protein; 5e-35
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-31
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-16
2pnn_A273 Transient receptor potential cation channel subfa 2e-34
2pnn_A273 Transient receptor potential cation channel subfa 6e-34
2pnn_A273 Transient receptor potential cation channel subfa 1e-31
2pnn_A273 Transient receptor potential cation channel subfa 7e-29
2pnn_A273 Transient receptor potential cation channel subfa 4e-22
2pnn_A273 Transient receptor potential cation channel subfa 3e-18
2pnn_A273 Transient receptor potential cation channel subfa 6e-13
2pnn_A273 Transient receptor potential cation channel subfa 6e-09
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-34
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 6e-28
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-24
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-23
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-33
3deo_A183 Signal recognition particle 43 kDa protein; chloro 4e-29
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-27
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-24
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-22
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-20
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-14
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-04
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-33
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-30
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-26
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-25
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-25
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-33
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-29
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-25
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-24
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-24
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-21
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 5e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-31
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-26
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-25
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-33
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-25
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-21
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-19
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-18
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-09
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-33
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-29
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-28
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-18
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-13
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-13
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-33
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-32
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-30
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 8e-27
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-26
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 9e-33
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-22
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-19
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-15
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 3e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-33
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-32
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-29
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-26
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-26
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-32
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-31
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-25
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 8e-22
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-21
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 4e-20
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-07
2etb_A256 Transient receptor potential cation channel subfam 3e-31
2etb_A256 Transient receptor potential cation channel subfam 1e-29
2etb_A256 Transient receptor potential cation channel subfam 3e-20
2etb_A256 Transient receptor potential cation channel subfam 4e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-31
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-26
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-23
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-22
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 7e-20
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-10
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 8e-10
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-30
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-30
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 7e-26
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-25
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-21
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 3e-07
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-30
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-19
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-18
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 5e-17
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-13
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-06
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-30
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-28
3jxi_A260 Vanilloid receptor-related osmotically activated p 8e-25
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-20
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-16
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-28
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-24
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 9e-23
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-15
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-27
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-23
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-21
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 9e-19
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-17
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-20
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-18
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-17
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-16
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-09
1sw6_A327 Regulatory protein SWI6; transcription regulation, 9e-24
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-23
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-17
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-17
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-21
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-19
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-16
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-15
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 2e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-19
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 9e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 5e-08
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-19
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-15
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-09
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-18
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-11
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-16
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 8e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 5e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  314 bits (806), Expect = e-102
 Identities = 161/526 (30%), Positives = 245/526 (46%), Gaps = 122/526 (23%)

Query: 28  VDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVW 87
           +       +GL  LH+AS  GHL +V  LL RGA+ + +  K  T LH+A+         
Sbjct: 5   ISGGGGGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAA--------- 55

Query: 88  LGDFKQGDGFTPLAVAMQQGHDKVVAVLLEN----DTRGKDGFTPLAVAMQQGHDKVVAV 143
                            + GH +V   LL+N    + + KD  TPL  A + GH  +V +
Sbjct: 56  -----------------RAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKL 98

Query: 144 LLEN----DTRGKVRLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYL 199
           LLEN    +         LHIAA++   +    LLE                        
Sbjct: 99  LLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEA--------------------- 137

Query: 200 IKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCM 259
                +    +K GFTPLH+A+ YG   VA +LL++ A  N + K+GLTPLHVA     +
Sbjct: 138 -----SQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNL 192

Query: 260 NIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIA 319
           +IV  LL    +P  P   G TPLH+AA+ NQ ++ R LL+ G   +A + +G T L +A
Sbjct: 193 DIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLA 252

Query: 320 QKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGD- 378
                                   +EGH                    +   L+  + + 
Sbjct: 253 -----------------------AQEGHAE------------------MVALLLSKQANG 271

Query: 379 GEKHKNGLTPLHLCAQEDRVGVAELLLKNNAQVDTPTK--------------MDIATTLL 424
              +K+GLTPLHL AQE  V VA++L+K+   VD  T+              + +   LL
Sbjct: 272 NLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLL 331

Query: 425 EYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKLGYIS 484
           ++ A  NA++  G++PLH +A +GH D+  +LL++GA  +  + +G T L+IA++LGYIS
Sbjct: 332 QHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYIS 391

Query: 485 VEESLKGVTE--TLIIAKGDGEKHKVVAPEIMQETFMSDSEDENGE 528
           V + LK VT+  + ++     +KH++  PE + E  +  SEDE  E
Sbjct: 392 VTDVLKVVTDETSFVLVS---DKHRMSFPETVDE-ILDVSEDEGEE 433


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query529
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
2etb_A256 Transient receptor potential cation channel subfam 100.0
2pnn_A273 Transient receptor potential cation channel subfa 100.0
2etb_A256 Transient receptor potential cation channel subfam 99.98
2pnn_A273 Transient receptor potential cation channel subfa 99.98
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.9
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.89
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.86
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.85
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.83
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.83
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.83
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.82
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.81
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.79
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.78
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.78
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.78
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.75
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.74
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=9e-65  Score=495.36  Aligned_cols=409  Identities=34%  Similarity=0.546  Sum_probs=294.2

Q ss_pred             CCchhHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCChHHHHHHHcCChhHHHHHHHCCCCCCCCCCCCCchHHHHhhcC
Q psy2356           2 GEGHTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGE   81 (529)
Q Consensus         2 ~~g~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~~~l~~a~~~~   81 (529)
                      ..|.||||.||..|++++|++|+++|++++..+..|.||||+|+..|+.+++++|+++|++++.++..|.          
T Consensus        12 ~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~~~~g~----------   81 (437)
T 1n11_A           12 ESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQ----------   81 (437)
T ss_dssp             ---CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSC----------
T ss_pred             CCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCCCCCCC----------
Confidence            5789999999999999999999999999999999999999999999999999999999999987766554          


Q ss_pred             ccccccccccccCCCCCHHHHHHHcCcHHHHHHHhhcCCC----CCCCCcHHHHHHHcCcHHHHHHHHhcCCCCCCCcCH
Q psy2356          82 FLVPVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTR----GKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPA  157 (529)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~----~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~  157 (529)
                                      |||++|+..|+.+++++|++++++    +..|.|||++|+..|+.+++++|++.+..       
T Consensus        82 ----------------t~L~~A~~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~-------  138 (437)
T 1n11_A           82 ----------------TPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS-------  138 (437)
T ss_dssp             ----------------CHHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCC-------
T ss_pred             ----------------CHHHHHHHCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCC-------
Confidence                            455567889999999999998765    66788888888888888888888876543       


Q ss_pred             HHHHhhCCChHHHHHHHhccCCCCCCcccccccCCchhhHHHHhCCCCCCcCCCCCCCHHHHHHHcCCHHHHHHHHhCCC
Q psy2356         158 LHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRA  237 (529)
Q Consensus       158 l~~a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~g~  237 (529)
                                                                      .+..+..|.||||+|+..|+.+++++|+++|+
T Consensus       139 ------------------------------------------------~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~g~  170 (437)
T 1n11_A          139 ------------------------------------------------QACMTKKGFTPLHVAAKYGKVRVAELLLERDA  170 (437)
T ss_dssp             ------------------------------------------------SCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTC
T ss_pred             ------------------------------------------------CcCCCCCCCCHHHHHHHcCCHHHHHHHHhCCC
Confidence                                                            12233345556666666666666666666666


Q ss_pred             CCcccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHCCCCcccccccCCcHHH
Q psy2356         238 DVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALS  317 (529)
Q Consensus       238 ~~~~~~~~~~~~l~~a~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~  317 (529)
                      +++..+..|.|||+.|+..++.+++++|++.|.+++..+..|.||||+|+..|+.+++++|+++|++++..+..|.||||
T Consensus       171 ~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~  250 (437)
T 1n11_A          171 HPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLH  250 (437)
T ss_dssp             CTTCCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHH
T ss_pred             CCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCCCHHH
Confidence            55555555666666666666666666666665555555555566666666666666666666666655555555666666


Q ss_pred             HHHHcCChhHHHHhhhhcccccccCCCCCCcHHHHHHHhCchhHHHHhhhhhhHHHHhhcCCCCCCCCchHHHHHHHcCC
Q psy2356         318 IAQKLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDR  397 (529)
Q Consensus       318 ~a~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~~~  397 (529)
                      +|+..|+.+++++|++. ..+.+..+..|.||||+|+..++.+++++|.+      .....+..+..|.||||+|+..|+
T Consensus       251 ~A~~~g~~~~v~~Ll~~-~~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~------~g~~~~~~~~~g~t~L~~A~~~g~  323 (437)
T 1n11_A          251 LAAQEGHAEMVALLLSK-QANGNLGNKSGLTPLHLVAQEGHVPVADVLIK------HGVMVDATTRMGYTPLHVASHYGN  323 (437)
T ss_dssp             HHHHTTCHHHHHHHHTT-TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHH------HTCCTTCCCSSCCCHHHHHHHSSC
T ss_pred             HHHHCCCHHHHHHHHhc-CCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHh------CCccCCCCCCCCCCHHHHHHHcCc
Confidence            66666666666655543 33445555556666666666666666665522      122335667789999999999999


Q ss_pred             HHHHHHHHhcCCCCCCCchhHHHHHHHHcCCCCCCcccCCCCHHHHHHHcCcHHHHHHHHhCCCCCcchhhcCCCHHHHH
Q psy2356         398 VGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIA  477 (529)
Q Consensus       398 ~~~~~~Ll~~~~~~~~~~~~~~~~~L~~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~A  477 (529)
                      .+++++|+++                   |+++|.++..|+||||+|+++|+.++|++|+++|++++.+|..|.||+++|
T Consensus       324 ~~~v~~Ll~~-------------------gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~g~t~l~~A  384 (437)
T 1n11_A          324 IKLVKFLLQH-------------------QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIA  384 (437)
T ss_dssp             SHHHHHHHHT-------------------TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHH
T ss_pred             HHHHHHHHhc-------------------CCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCCCCCCCCCCHHHHH
Confidence            9988888876                   556788888999999999999999999999999999999999999999999


Q ss_pred             HHhCCchHHHHhhcccchhhhccCCCCccccchhhhhhhcc
Q psy2356         478 QKLGYISVEESLKGVTETLIIAKGDGEKHKVVAPEIMQETF  518 (529)
Q Consensus       478 ~~~~~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  518 (529)
                      .+.|+.+++++|........... .....+...|+.+.+.+
T Consensus       385 ~~~g~~~~~~~l~~~~~~~~~~~-~~~~~~~~~~~~~~~~~  424 (437)
T 1n11_A          385 KRLGYISVTDVLKVVTDETSFVL-VSDKHRMSFPETVDEIL  424 (437)
T ss_dssp             HHTTCHHHHHHHHHHCCCCSSCC-----CCCCCCCCCCC--
T ss_pred             HHcCcHHHHHHHHhccccccccc-cchhcccCCccccchhh
Confidence            99999999999987765433221 12223334455555443



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 529
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-58
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-54
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-48
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-31
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-30
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-26
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-25
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-16
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-28
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-25
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-23
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-21
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-26
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-24
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-22
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-18
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 6e-15
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-26
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 1e-24
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-07
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-24
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-20
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-17
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-14
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-08
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-07
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 5e-05
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-21
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-21
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-18
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-17
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-12
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-19
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-18
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 6e-16
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 7e-16
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-18
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-13
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-10
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 6e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-18
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-17
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-10
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-06
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-17
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-15
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-12
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-11
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-11
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-10
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-05
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-12
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-06
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-06
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 9e-12
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 7e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-07
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-06
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.004
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 0.004
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-11
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-09
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-07
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 8e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-08
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-06
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 6e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 4e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 7e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.002
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-07
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 8e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 4e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.002
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  197 bits (500), Expect = 2e-58
 Identities = 143/487 (29%), Positives = 233/487 (47%), Gaps = 87/487 (17%)

Query: 38  LNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLVPVWLGDFKQGDGF 97
           L  LH+AS  GHL +V  LL RGA+ + +  K  T LH+A+                   
Sbjct: 1   LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAA------------------- 41

Query: 98  TPLAVAMQQGHDKVVAVLLEN----DTRGKDGFTPLAVAMQQGHDKVVAVLLENDTRGKV 153
                  + GH +V   LL+N    + + KD  TPL  A + GH  +V +LLEN+     
Sbjct: 42  -------RAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNAN--- 91

Query: 154 RLPALHIAAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSG 213
                                  +        +++  G+  T   L++ E +    +K G
Sbjct: 92  -------------------PNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKG 132

Query: 214 FTPLHIASHYGNEGVANILLDKRADVNFSAKSGLTPLHVASFMGCMNIVIYLLQNDANPD 273
           FTPLH+A+ YG   VA +LL++ A  N + K+GLTPLHVA     ++IV  LL    +P 
Sbjct: 133 FTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPH 192

Query: 274 IPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQKLGYISVEESLGA 333
            P   G TPLH+AA+ NQ ++ R LL+ G   +A + +G T L +A + G+  +      
Sbjct: 193 SPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVAL-LL 251

Query: 334 AERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGD--GEKHKNGLTPLHL 391
           ++++      + G T L +  + G++ V + L        I  G       + G TPLH+
Sbjct: 252 SKQANGNLGNKSGLTPLHLVAQEGHVPVADVL--------IKHGVMVDATTRMGYTPLHV 303

Query: 392 CAQEDRVGVAELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHAD 451
            +    + + + LL++ A V+  TK+                   G++PLH +A +GH D
Sbjct: 304 ASHYGNIKLVKFLLQHQADVNAKTKL-------------------GYSPLHQAAQQGHTD 344

Query: 452 MSAMLLEHGADVSHAAKEGHTALSIAQKLGYISVEESLKGVTE--TLIIAKGDGEKHKVV 509
           +  +LL++GA  +  + +G T L+IA++LGYISV + LK VT+  + ++     +KH++ 
Sbjct: 345 IVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVS---DKHRMS 401

Query: 510 APEIMQE 516
            PE + E
Sbjct: 402 FPETVDE 408


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query529
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.92
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.91
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.81
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=8.8e-54  Score=412.41  Aligned_cols=386  Identities=35%  Similarity=0.548  Sum_probs=293.1

Q ss_pred             hhHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCCChHHHHHHHcCChhHHHHHHHCCCCCCCCCCCCCchHHHHhhcCccc
Q psy2356           5 HTSFLRAARAGHLDKIIEHLKNNVDINTANANGLNALHLASKDGHLHVVTELLSRGANVDSATKKGNTALHIASLGEFLV   84 (529)
Q Consensus         5 ~t~L~~A~~~g~~~~v~~ll~~~~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~~~~~~~~~~l~~a~~~~~~~   84 (529)
                      .||||.||..|++++|++|+++|++++..|..|+||||+||..|+.++|++|+++|++++.++..|.|            
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~~~~g~t------------   68 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQT------------   68 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCCCTTSCC------------
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCCCCCCCC------------
Confidence            49999999999999999999999999999999999999999999999999999999999887766555            


Q ss_pred             cccccccccCCCCCHHHHHHHcCcHHHHHHHhhcCCC----CCCCCcHHHHHHHcCcHHHHHHHHhcCCCCCCCcCHHHH
Q psy2356          85 PVWLGDFKQGDGFTPLAVAMQQGHDKVVAVLLENDTR----GKDGFTPLAVAMQQGHDKVVAVLLENDTRGKVRLPALHI  160 (529)
Q Consensus        85 ~~~~~~~~~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~----~~~~~~~l~~A~~~~~~~~v~~Ll~~~~~~~~~~~~l~~  160 (529)
                                    ||++|+..|+.+++++|+.....    .....+++..+...+...........+            
T Consensus        69 --------------~L~~A~~~g~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------  122 (408)
T d1n11a_          69 --------------PLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKE------------  122 (408)
T ss_dssp             --------------HHHHHHHHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTT------------
T ss_pred             --------------HHHHHHHcCCHHHHHHHHHhhhccccccccccchhhhhhhhccccccccccccc------------
Confidence                          45566888999999999887554    334456666666666555544443322            


Q ss_pred             HhhCCChHHHHHHHhccCCCCCCcccccccCCchhhHHHHhCCCCCCcCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCc
Q psy2356         161 AAKKDDTKAAKLLLEVSCTVDPASVLSSTTGNAATGGYLIKNEHNPDVTSKSGFTPLHIASHYGNEGVANILLDKRADVN  240 (529)
Q Consensus       161 a~~~~~~~~~~~ll~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~A~~~~~~~~v~~Ll~~g~~~~  240 (529)
                                                                 ...+..+..+.++++.|+..++.+++++|+++|++++
T Consensus       123 -------------------------------------------~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~  159 (408)
T d1n11a_         123 -------------------------------------------ASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN  159 (408)
T ss_dssp             -------------------------------------------CCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT
T ss_pred             -------------------------------------------ccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCC
Confidence                                                       2233344555667777777777777777777777766


Q ss_pred             ccCCCCCcHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHHCCCCcccccccCCcHHHHHH
Q psy2356         241 FSAKSGLTPLHVASFMGCMNIVIYLLQNDANPDIPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREGHTALSIAQ  320 (529)
Q Consensus       241 ~~~~~~~~~l~~a~~~~~~~~v~~Ll~~g~~~~~~~~~~~t~l~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~a~  320 (529)
                      ..+..+.+||++|+..++.+++++|+++|++++..+..|.||+|.++.....++...|+..+......+..+.||+++|+
T Consensus       160 ~~~~~~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~a~  239 (408)
T d1n11a_         160 AAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAA  239 (408)
T ss_dssp             CCCSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHHHH
T ss_pred             cCCCcCchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHHHH
Confidence            66666677777777777777777777777776666666777777777777777777776666666666666667777777


Q ss_pred             HcCChhHHHHhhhhcccccccCCCCCCcHHHHHHHhCchhHHHHhhhhhhHHHHhhcCCCCCCCCchHHHHHHHcCCHHH
Q psy2356         321 KLGYISVEESLGAAERSQLKKRGREGHTALSIAQKLGYISVEESLKGVTETLIIAKGDGEKHKNGLTPLHLCAQEDRVGV  400 (529)
Q Consensus       321 ~~~~~~~~~~l~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~t~L~~A~~~~~~~~  400 (529)
                      ..++.++++++... .......+..|.+|++.++..++.++++++.      ....+.+..+..+.|||+.++..++.++
T Consensus       240 ~~~~~~~~~~~~~~-~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll------~~g~~~~~~~~~~~t~L~~~~~~~~~~~  312 (408)
T d1n11a_         240 QEGHAEMVALLLSK-QANGNLGNKSGLTPLHLVAQEGHVPVADVLI------KHGVMVDATTRMGYTPLHVASHYGNIKL  312 (408)
T ss_dssp             HTTCHHHHHHHHTT-TCCTTCCCTTCCCHHHHHHHHTCHHHHHHHH------HHTCCTTCCCSSCCCHHHHHHHSSCSHH
T ss_pred             HhCcHhHhhhhhcc-ccccccccCCCCChhhhhhhcCcHHHHHHHH------HCCCccccccccccccchhhcccCccee
Confidence            77777776666443 3445555666677777777777777766662      1223335566678899999999998888


Q ss_pred             HHHHHhcCCCCCCCchhHHHHHHHHcCCCCCCcccCCCCHHHHHHHcCcHHHHHHHHhCCCCCcchhhcCCCHHHHHHHh
Q psy2356         401 AELLLKNNAQVDTPTKMDIATTLLEYGAKPNAESVAGFTPLHLSASEGHADMSAMLLEHGADVSHAAKEGHTALSIAQKL  480 (529)
Q Consensus       401 ~~~Ll~~~~~~~~~~~~~~~~~L~~~g~~~~~~~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~l~~A~~~  480 (529)
                      +++++++                   |+++|.+|..|+||||+|+++|+.++|++|+++||+++.+|..|.|||++|++.
T Consensus       313 ~~~ll~~-------------------g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~  373 (408)
T d1n11a_         313 VKFLLQH-------------------QADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRL  373 (408)
T ss_dssp             HHHHHHT-------------------TCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHT
T ss_pred             eeeeccc-------------------cccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHc
Confidence            8877765                   567788999999999999999999999999999999999999999999999999


Q ss_pred             CCchHHHHhhcccchhh
Q psy2356         481 GYISVEESLKGVTETLI  497 (529)
Q Consensus       481 ~~~~~~~~L~~~~~~~~  497 (529)
                      |+.++|++|........
T Consensus       374 ~~~~iv~~L~~~~~~~~  390 (408)
T d1n11a_         374 GYISVTDVLKVVTDETS  390 (408)
T ss_dssp             TCHHHHHHHHHHCCCCS
T ss_pred             CCHHHHHHHHHHHhccc
Confidence            99999998865544333



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure