Psyllid ID: psy2507

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MLSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLRHNSTKRSPFLSSSHTLRTKCSLGDMDLKFHQNRMNHSEVLTKKVPIS
cccccEEEEccEEEEcccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccc
ccHHHHHHHcHHHHEccccccEEEEEEcccccccccHHcHHHHHHHHHHHHHHHccccccccHcccHcccccccccccccHHHHHHccccHHcHHHHHHHHHHHHHccccc
mlsekyelygfdilidsdlkpwllevnlspslgcdtpldTRLKSAMLADTLtlvgipaldpmlrhnstkrspflssshtlrtkcslgdmdlkfhqnrmnhsevltkkvpis
MLSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLRHNStkrspflssshtlrTKCSLGDMDLKfhqnrmnhsevltkkvpis
MLSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLRHNSTKRSPFLSSSHTLRTKCSLGDMDLKFHQNRMNHSEVLTKKVPIS
*****YELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDP**************************************************
*LSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALD********************************************TKKV***
MLSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLRHNSTKRSPFLSSSHTLRTKCSLGDMDLKFHQNRMNHSEVLTKKVPIS
MLSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPAL*********************************FH*NRMNHSEVLTKKVPIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLRHNSTKRSPFLSSSHTLRTKCSLGDMDLKFHQNRMNHSEVLTKKVPIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query111 2.2.26 [Sep-21-2011]
Q5R978 1299 Tubulin polyglutamylase T yes N/A 0.612 0.052 0.545 1e-18
Q6EMB2 1281 Tubulin polyglutamylase T yes N/A 0.612 0.053 0.545 1e-18
Q8CHB8 1328 Tubulin polyglutamylase T yes N/A 0.756 0.063 0.473 2e-18
Q6EEF3 1299 Tubulin polyglutamylase T N/A N/A 0.612 0.052 0.532 2e-18
Q09647601 Tubulin polyglutamylase t no N/A 0.513 0.094 0.516 7e-12
Q3SXZ7439 Probable tubulin polyglut no N/A 0.522 0.132 0.566 1e-11
Q641W7461 Probable tubulin polyglut no N/A 0.477 0.114 0.603 1e-11
Q3SZH6461 Probable tubulin polyglut no N/A 0.477 0.114 0.603 1e-11
Q80UG8 1193 Tubulin polyglutamylase T no N/A 0.918 0.085 0.366 1e-11
A2APC3461 Probable tubulin polyglut no N/A 0.477 0.114 0.603 1e-11
>sp|Q5R978|TTLL5_PONAB Tubulin polyglutamylase TTLL5 OS=Pongo abelii GN=TTLL5 PE=2 SV=1 Back     alignment and function desciption
 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/77 (54%), Positives = 55/77 (71%), Gaps = 9/77 (11%)

Query: 6   YELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLRH 65
           +ELYGFD+LIDS LKPWLLEVNLSPSL CD PLD ++K++M++D  T+VG    DP  R 
Sbjct: 347 FELYGFDVLIDSTLKPWLLEVNLSPSLACDAPLDLKIKASMISDMFTVVGFVCQDPAQRA 406

Query: 66  N---------STKRSPF 73
           +         S++R+PF
Sbjct: 407 STRPIYPTFESSRRNPF 423
Polyglutamylase which preferentially modifies alpha-tubulin. Involved in the side-chain initiation step of the polyglutamylation reaction rather than in the elongation step. Increases the effects of NCOA2 in glucocorticoid receptor-mediated repression and induction and in androgen receptor-mediated induction.
Pongo abelii (taxid: 9601)
EC: 6EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q6EMB2|TTLL5_HUMAN Tubulin polyglutamylase TTLL5 OS=Homo sapiens GN=TTLL5 PE=1 SV=3 Back     alignment and function description
>sp|Q8CHB8|TTLL5_MOUSE Tubulin polyglutamylase TTLL5 OS=Mus musculus GN=Ttll5 PE=2 SV=3 Back     alignment and function description
>sp|Q6EEF3|TTLL5_CHLAE Tubulin polyglutamylase TTLL5 OS=Chlorocebus aethiops GN=TTLL5 PE=2 SV=2 Back     alignment and function description
>sp|Q09647|TTLL4_CAEEL Tubulin polyglutamylase ttll-4 OS=Caenorhabditis elegans GN=ttll-4 PE=2 SV=3 Back     alignment and function description
>sp|Q3SXZ7|TTLL9_HUMAN Probable tubulin polyglutamylase TTLL9 OS=Homo sapiens GN=TTLL9 PE=2 SV=3 Back     alignment and function description
>sp|Q641W7|TTLL9_RAT Probable tubulin polyglutamylase TTLL9 OS=Rattus norvegicus GN=Ttll9 PE=2 SV=1 Back     alignment and function description
>sp|Q3SZH6|TTLL9_BOVIN Probable tubulin polyglutamylase TTLL9 OS=Bos taurus GN=TTLL9 PE=2 SV=1 Back     alignment and function description
>sp|Q80UG8|TTLL4_MOUSE Tubulin polyglutamylase TTLL4 OS=Mus musculus GN=Ttll4 PE=2 SV=3 Back     alignment and function description
>sp|A2APC3|TTLL9_MOUSE Probable tubulin polyglutamylase TTLL9 OS=Mus musculus GN=Ttll9 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
189238931 843 PREDICTED: similar to CG31108 CG31108-PA 0.738 0.097 0.678 4e-23
270009877 844 hypothetical protein TcasGA2_TC009196 [T 0.531 0.069 0.847 9e-23
340714092 807 PREDICTED: tubulin polyglutamylase TTLL5 0.702 0.096 0.675 1e-22
380026047 811 PREDICTED: tubulin polyglutamylase TTLL5 0.576 0.078 0.781 1e-22
328784992 811 PREDICTED: tubulin polyglutamylase TTLL5 0.576 0.078 0.781 1e-22
383863905 805 PREDICTED: tubulin polyglutamylase TTLL5 0.567 0.078 0.793 3e-22
350417501 681 PREDICTED: tubulin polyglutamylase TTLL5 0.567 0.092 0.793 3e-22
242013327 696 conserved hypothetical protein [Pediculu 0.540 0.086 0.783 1e-21
307206995 670 Tubulin polyglutamylase TTLL5 [Harpegnat 0.594 0.098 0.727 1e-21
345495418 807 PREDICTED: tubulin polyglutamylase TTLL5 0.567 0.078 0.746 3e-21
>gi|189238931|ref|XP_970924.2| PREDICTED: similar to CG31108 CG31108-PA [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  112 bits (279), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/84 (67%), Positives = 66/84 (78%), Gaps = 2/84 (2%)

Query: 6   YELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLR- 64
           +ELYGFDILID++LKPWLLEVNLSPSLGCD+PLD RLKSAML+D LTLVGIPA+DP+LR 
Sbjct: 410 FELYGFDILIDANLKPWLLEVNLSPSLGCDSPLDVRLKSAMLSDLLTLVGIPAVDPILRP 469

Query: 65  -HNSTKRSPFLSSSHTLRTKCSLG 87
             NS   +   SSS   R   + G
Sbjct: 470 TTNSLTSASIKSSSRCRRVHSADG 493

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270009877|gb|EFA06325.1| hypothetical protein TcasGA2_TC009196 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340714092|ref|XP_003395566.1| PREDICTED: tubulin polyglutamylase TTLL5-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380026047|ref|XP_003696773.1| PREDICTED: tubulin polyglutamylase TTLL5-like [Apis florea] Back     alignment and taxonomy information
>gi|328784992|ref|XP_397468.4| PREDICTED: tubulin polyglutamylase TTLL5-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383863905|ref|XP_003707420.1| PREDICTED: tubulin polyglutamylase TTLL5-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350417501|ref|XP_003491453.1| PREDICTED: tubulin polyglutamylase TTLL5-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|242013327|ref|XP_002427362.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511721|gb|EEB14624.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307206995|gb|EFN84818.1| Tubulin polyglutamylase TTLL5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345495418|ref|XP_001602304.2| PREDICTED: tubulin polyglutamylase TTLL5-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query111
FB|FBgn0051108 917 CG31108 [Drosophila melanogast 0.648 0.078 0.643 4.8e-19
UNIPROTKB|F6UZ25 1284 TTLL5 "Uncharacterized protein 0.675 0.058 0.56 8.3e-17
UNIPROTKB|F6UZ90 1287 TTLL5 "Uncharacterized protein 0.675 0.058 0.56 8.3e-17
UNIPROTKB|E2QU62 1333 TTLL5 "Uncharacterized protein 0.675 0.056 0.56 8.7e-17
UNIPROTKB|F1PTL6 1333 TTLL5 "Uncharacterized protein 0.675 0.056 0.56 8.7e-17
UNIPROTKB|G3V2J9 1281 TTLL5 "Tubulin polyglutamylase 0.675 0.058 0.56 1.4e-16
UNIPROTKB|Q6EMB2 1281 TTLL5 "Tubulin polyglutamylase 0.675 0.058 0.56 1.4e-16
UNIPROTKB|E1BD55 1331 TTLL5 "Uncharacterized protein 0.675 0.056 0.56 1.4e-16
MGI|MGI:2443657 1328 Ttll5 "tubulin tyrosine ligase 0.675 0.056 0.546 2.3e-16
UNIPROTKB|E1C5J7 1221 TTLL5 "Uncharacterized protein 0.567 0.051 0.634 3.4e-16
FB|FBgn0051108 CG31108 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 240 (89.5 bits), Expect = 4.8e-19, P = 4.8e-19
 Identities = 47/73 (64%), Positives = 58/73 (79%)

Query:     6 YELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLR- 64
             +ELYGFDILID+ LKPWLLE+NLSPS+G D+PLDT++KS ++AD LT VGIPA  P ++ 
Sbjct:   498 FELYGFDILIDNALKPWLLEINLSPSMGVDSPLDTKVKSCLMADLLTCVGIPAYSPEMKS 557

Query:    65 HNSTKRSPFLSSS 77
             H   K S F SSS
Sbjct:   558 HYDQKWSRFRSSS 570
GO:0004835 "tubulin-tyrosine ligase activity" evidence=ISS
GO:0006464 "cellular protein modification process" evidence=IEA
UNIPROTKB|F6UZ25 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6UZ90 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU62 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTL6 TTLL5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V2J9 TTLL5 "Tubulin polyglutamylase TTLL5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6EMB2 TTLL5 "Tubulin polyglutamylase TTLL5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BD55 TTLL5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2443657 Ttll5 "tubulin tyrosine ligase-like family, member 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5J7 TTLL5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6EMB2TTLL5_HUMAN6, ., -, ., -, ., -0.54540.61260.0530yesN/A
Q5R978TTLL5_PONAB6, ., -, ., -, ., -0.54540.61260.0523yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
pfam03133291 pfam03133, TTL, Tubulin-tyrosine ligase family 1e-18
>gnl|CDD|217380 pfam03133, TTL, Tubulin-tyrosine ligase family Back     alignment and domain information 
 Score = 78.1 bits (193), Expect = 1e-18
 Identities = 31/52 (59%), Positives = 36/52 (69%)

Query: 6   YELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIP 57
           +ELYGFD +ID +LKPWLLEVN SPSL   T LD RLK  ++ D L  V  P
Sbjct: 234 FELYGFDFMIDENLKPWLLEVNASPSLHSTTKLDARLKEQLIDDVLNSVVPP 285

Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL). The true physiological function of TTL has so far not been established. Tubulin-tyrosine ligase (TTL) catalyzes the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness. On the other hand, 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis. Bacterial homologs of TTL are predicted to form peptide tags. Some of these are fused to a 2-oxoglutarate Fe(II)-dependent dioxygenase domain. Length = 291

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 111
PF03133292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 99.73
KOG2157|consensus497 99.66
KOG2156|consensus662 99.42
PF14398262 ATPgrasp_YheCD: YheC/D like ATP-grasp 98.76
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 98.12
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 98.04
PRK14568343 vanB D-alanine--D-lactate ligase; Provisional 98.02
PRK14569296 D-alanyl-alanine synthetase A; Provisional 98.0
PRK14570364 D-alanyl-alanine synthetase A; Provisional 97.97
COG1181317 DdlA D-alanine-D-alanine ligase and related ATP-gr 97.81
TIGR01205315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 97.77
PRK14571299 D-alanyl-alanine synthetase A; Provisional 97.73
PRK14572347 D-alanyl-alanine synthetase A; Provisional 97.69
PRK14573809 bifunctional D-alanyl-alanine synthetase A/UDP-N-a 97.62
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 97.62
KOG2158|consensus565 97.48
TIGR02291317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 97.47
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 97.42
PRK10446300 ribosomal protein S6 modification protein; Provisi 97.28
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 97.15
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 96.72
PLN02257434 phosphoribosylamine--glycine ligase 96.55
PRK13789426 phosphoribosylamine--glycine ligase; Provisional 96.25
TIGR01161352 purK phosphoribosylaminoimidazole carboxylase, Pur 96.04
PF14397285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 95.98
PLN02941328 inositol-tetrakisphosphate 1-kinase 95.22
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 94.82
PF04174 330 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; In 94.75
TIGR00877423 purD phosphoribosylamine--glycine ligase. This enz 94.61
PRK06524493 biotin carboxylase-like protein; Validated 94.42
PRK00885420 phosphoribosylamine--glycine ligase; Provisional 94.35
PRK06849389 hypothetical protein; Provisional 94.27
KOG2158|consensus 565 94.03
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 93.99
PRK12767326 carbamoyl phosphate synthase-like protein; Provisi 93.78
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 93.63
PLN02948 577 phosphoribosylaminoimidazole carboxylase 93.53
PRK06019372 phosphoribosylaminoimidazole carboxylase ATPase su 93.3
TIGR01142380 purT phosphoribosylglycinamide formyltransferase 2 93.1
PRK06111450 acetyl-CoA carboxylase biotin carboxylase subunit; 93.04
TIGR00514449 accC acetyl-CoA carboxylase, biotin carboxylase su 92.87
PRK13790379 phosphoribosylamine--glycine ligase; Provisional 92.76
PRK08591451 acetyl-CoA carboxylase biotin carboxylase subunit; 92.66
PRK05586447 biotin carboxylase; Validated 92.14
PF05770307 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6- 91.9
COG1821307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 91.89
KOG2155|consensus631 91.66
PRK08462445 biotin carboxylase; Validated 91.55
PLN02735 1102 carbamoyl-phosphate synthase 90.63
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2 90.63
PRK07206416 hypothetical protein; Provisional 90.39
PRK07178472 pyruvate carboxylase subunit A; Validated 89.83
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 89.19
PRK14016 727 cyanophycin synthetase; Provisional 88.86
PRK12833467 acetyl-CoA carboxylase biotin carboxylase subunit; 88.67
TIGR01435737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 88.04
PRK06395435 phosphoribosylamine--glycine ligase; Provisional 87.84
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 87.09
PLN02735 1102 carbamoyl-phosphate synthase 86.21
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 86.2
PF02750203 Synapsin_C: Synapsin, ATP binding domain; InterPro 85.36
PRK02471752 bifunctional glutamate--cysteine ligase/glutathion 83.7
PRK05246316 glutathione synthetase; Provisional 83.52
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 80.91
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information 
Probab=99.73  E-value=4.6e-18  Score=132.58  Aligned_cols=57  Identities=51%  Similarity=0.958  Sum_probs=44.0

Q ss_pred             CCcceeEEeeeEEEeCCCCeEEEEeeCCCCCCCCChhhHHHHHHHHHHHHHhcCCCCCCCc
Q psy2507           2 LSEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPM   62 (111)
Q Consensus         2 ~~~~FEl~G~Df~lD~~~kpWLLEVN~~P~l~~~~~~~~~l~~~~l~d~l~lv~~~~~d~~   62 (111)
                      ..+|||+||+|||+|++++|||||||++|++..+++++..++.+|++|+++++    ++|.
T Consensus       232 ~~~~Fel~G~DfmlD~~~kpwLLEvN~~Psl~~~~~~~~~~~~~li~d~l~i~----v~~~  288 (292)
T PF03133_consen  232 RPNCFELFGFDFMLDEDLKPWLLEVNSNPSLSTSTPVDKELKPQLIDDLLKIV----VDPD  288 (292)
T ss_dssp             SSEE-EEEEEEEEEBTTS-EEEEEEESS------TTTHHHHHHHHHHHTTTTT----S---
T ss_pred             cccccceeeeEEEecCCCeEEEeeCCCCCCcccCCHhHHHHHHHHHHHHhEEE----eCCC
Confidence            46899999999999999999999999999999999999999999999999988    5654

This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL) []. Tubulin-tyrosine ligase (TTL) catalyses the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. The true physiological function of TTL has so far not been established. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness []. 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis [].; GO: 0004835 tubulin-tyrosine ligase activity, 0006464 protein modification process; PDB: 3TII_A 3TIN_A 3TIG_A.
>KOG2157|consensus Back     alignment and domain information
>KOG2156|consensus Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>COG1181 DdlA D-alanine-D-alanine ligase and related ATP-grasp enzymes [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK14573 bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>PF04174 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; InterPro: IPR007302 This is a domain of unknown function Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02948 phosphoribosylaminoimidazole carboxylase Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PF05770 Ins134_P3_kin: Inositol 1, 3, 4-trisphosphate 5/6-kinase; InterPro: IPR008656 This entry represents inositol-tetrakisphosphate 1-kinase which is also called inositol 1,3,4-trisphosphate 5/6-kinase Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>KOG2155|consensus Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PF02750 Synapsin_C: Synapsin, ATP binding domain; InterPro: IPR020898 The synapsins are a family of neuron-specific phosphoproteins that coat synaptic vesicles and are involved in the binding between these vesicles and the cytoskeleton (including actin filaments) Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
4i4t_F384 Crystal Structure Of Tubulin-rb3-ttl-zampanolide Co 2e-04
3tig_A380 Tubulin Tyrosine Ligase Length = 380 9e-04
>pdb|4I4T|F Chain F, Crystal Structure Of Tubulin-rb3-ttl-zampanolide Complex Length = 384 Back     alignment and structure 
Iteration: 1

 Score = 41.2 bits (95), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 8/55 (14%)
Query: 4   EKYELYGFDILIDSDLKPWLLEVNLSPSLG-------CDTPLDTRLKSAM-LADT 50
           + ++L+GFD ++D +LK WL+EVN +P+         C   +D  + S   LADT
Sbjct: 310 QSFQLFGFDFMVDEELKVWLIEVNGAPACAQKLYAELCQGIVDVAISSVFPLADT 364
>pdb|3TIG|A Chain A, Tubulin Tyrosine Ligase Length = 380 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query111
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 2e-14
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Length = 380 Back     alignment and structure
 Score = 66.6 bits (162), Expect = 2e-14
 Identities = 16/49 (32%), Positives = 29/49 (59%), Gaps = 2/49 (4%)

Query: 6   YELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLV 54
           ++L+GFD ++D +LK WL+EVN +P+      L   L   ++   ++ V
Sbjct: 315 FQLFGFDFMVDKNLKVWLIEVNGAPACA--QKLYAELCKGIVDLAISSV 361

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
3tig_A380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 99.56
4fu0_A357 D-alanine--D-alanine ligase 7; vancomycin resistan 98.38
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 98.05
3i12_A364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 98.01
3tqt_A372 D-alanine--D-alanine ligase; cell envelope; 1.88A 97.99
3k3p_A383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 97.93
3se7_A346 VANA; alpha-beta structure, D-alanine-D-lactate li 97.93
3e5n_A386 D-alanine-D-alanine ligase A; bacterial blight; 2. 97.91
1e4e_A343 Vancomycin/teicoplanin A-type resistance protein; 97.87
2i87_A364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 97.79
2q7d_A346 Inositol-tetrakisphosphate 1-kinase; inositol kina 97.76
1z2n_X324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 97.75
1iow_A306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 97.73
2fb9_A322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 97.69
1ehi_A377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 97.61
3r5x_A307 D-alanine--D-alanine ligase; alpha-beta structure, 97.58
3lwb_A373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 97.56
2pvp_A367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 97.17
2r85_A334 PURP protein PF1517; ATP-grAsp superfamily, unknow 97.16
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 96.98
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 96.92
3ax6_A380 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.66
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 96.62
2p0a_A344 Synapsin-3, synapsin III; neurotransmitter release 96.57
2z04_A365 Phosphoribosylaminoimidazole carboxylase ATPase su 96.4
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 96.13
3vot_A425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 96.08
3mjf_A431 Phosphoribosylamine--glycine ligase; structural ge 95.95
3k5i_A403 Phosphoribosyl-aminoimidazole carboxylase; purine 95.9
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 95.86
3df7_A305 Putative ATP-grAsp superfamily protein; putative p 95.74
4e4t_A419 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.6
2yw2_A424 Phosphoribosylamine--glycine ligase; glycinamide r 95.56
2xcl_A422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 95.5
1ulz_A451 Pyruvate carboxylase N-terminal domain; biotin car 95.49
1vkz_A412 Phosphoribosylamine--glycine ligase; TM1250, struc 95.48
2vpq_A451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 95.32
2ip4_A417 PURD, phosphoribosylamine--glycine ligase; GAR syn 95.27
1kjq_A391 GART 2, phosphoribosylglycinamide formyltransferas 95.23
2yrx_A451 Phosphoribosylglycinamide synthetase; glycinamide 95.05
3ouz_A446 Biotin carboxylase; structural genomics, center fo 95.0
3lp8_A442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 94.85
3aw8_A369 PURK, phosphoribosylaminoimidazole carboxylase, AT 94.8
2qk4_A452 Trifunctional purine biosynthetic protein adenosi; 94.76
2dwc_A433 PH0318, 433AA long hypothetical phosphoribosylglyc 94.46
4dim_A403 Phosphoribosylglycinamide synthetase; structural g 94.19
3glk_A540 Acetyl-COA carboxylase 2; ATP binding, alternative 94.12
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 93.69
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 93.36
2w70_A449 Biotin carboxylase; ligase, ATP-binding, fatty aci 93.3
3eth_A355 Phosphoribosylaminoimidazole carboxylase ATPase su 93.25
2pn1_A331 Carbamoylphosphate synthase large subunit; ZP_0053 93.07
2dzd_A461 Pyruvate carboxylase; biotin carboxylase, ligase; 92.01
3vmm_A474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 91.45
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 91.32
3ln6_A750 Glutathione biosynthesis bifunctional protein GSH; 91.23
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 91.05
3ln7_A757 Glutathione biosynthesis bifunctional protein GSH; 90.63
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 90.05
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 89.14
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 88.75
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 88.37
3t7a_A330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 86.58
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 85.99
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 82.11
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 81.64
2r7k_A361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 81.03
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
Probab=99.56  E-value=5.4e-15  Score=120.84  Aligned_cols=57  Identities=28%  Similarity=0.627  Sum_probs=50.4

Q ss_pred             CcceeEEeeeEEEeCCCCeEEEEeeCCCCCCCCChhhHHHHHHHHHHHHHhcCCCCCCCcCCCCCCC
Q psy2507           3 SEKYELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLKSAMLADTLTLVGIPALDPMLRHNSTK   69 (111)
Q Consensus         3 ~~~FEl~G~Df~lD~~~kpWLLEVN~~P~l~~~~~~~~~l~~~~l~d~l~lv~~~~~d~~~~~~~~~   69 (111)
                      .+|||+||+|||+|++++|||||||++|++..      .+.++|++++++++    +||.|+++...
T Consensus       312 ~~~FEl~G~D~lid~~l~~wllEVN~~P~~~q------~~i~~l~~~~~~ia----vdp~f~~~~~~  368 (380)
T 3tig_A          312 YHSFQLFGFDFMVDKNLKVWLIEVNGAPACAQ------KLYAELCKGIVDLA----ISSVFPLNEEN  368 (380)
T ss_dssp             SEECEEEEEEEEEBTTCCEEEEEEESSCCCCT------TTHHHHHHHHHHHT----TTTTSCCCC--
T ss_pred             CceEEEEeEEEEEcCCCcEEEEEEeCCCCccH------HhHHHHHHHHHHHh----cccccCCcccc
Confidence            47999999999999999999999999999974      38899999999999    89998876543
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query111
d1e4ea2211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 98.39
d1ehia2228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 98.26
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 98.24
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 97.86
d1vkza3220 Glycinamide ribonucleotide synthetase (GAR-syn), d 97.22
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 97.2
d1gsoa3224 Glycinamide ribonucleotide synthetase (GAR-syn), d 96.68
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 96.36
d2r7ka2238 5-formaminoimidazole-4-carboxamide ribonucleotide 96.05
d1w96a3267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 95.94
d2r85a2235 5-formaminoimidazole-4-carboxamide ribonucleotide 95.65
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 93.69
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 93.22
d3etja3198 N5-carboxyaminoimidazole ribonucleotide synthetase 92.93
d1a9xa6259 Carbamoyl phosphate synthetase (CPS), large subuni 85.94
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: ATP-binding domain of peptide synthetases
domain: D-alanine:D-lactate ligase VanA, C-domain
species: Enterococcus faecium [TaxId: 1352]

Probab=98.39  E-value=4.9e-07  Score=63.18  Aligned_cols=49  Identities=16%  Similarity=0.226  Sum_probs=39.1

Q ss_pred             eeEEeeeEEEeCCCCeEEEEeeCCCCCCCCChhhHHHH------HHHHHHHHHhc
Q psy2507           6 YELYGFDILIDSDLKPWLLEVNLSPSLGCDTPLDTRLK------SAMLADTLTLV   54 (111)
Q Consensus         6 FEl~G~Df~lD~~~kpWLLEVN~~P~l~~~~~~~~~l~------~~~l~d~l~lv   54 (111)
                      ....++||++|+++++|+||||+.|+++..+.+.....      ++|++.++++.
T Consensus       155 ~g~~~id~~~~~~g~~~viEiN~~pg~~~~s~~~~~~~~~G~~~~~li~~iv~~a  209 (211)
T d1e4ea2         155 RGLARVDMFLQDNGRIVLNEVNTLPGFTSYSRYPRMMAAAGISLPELIDRLIVLA  209 (211)
T ss_dssp             EEEEEEEEEECTTCCEEEEEEESSCCCSTTCHHHHHHHHTTCCHHHHHHHHHHHH
T ss_pred             CCeeEEEEEEcCCCCEEEEEEeCCCCCCCccHHHHHHHHcCCCHHHHHHHHHHHH
Confidence            45788999999999999999999999998877655432      46677766654
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3etja3 d.142.1.2 (A:79-276) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure