Psyllid ID: psy255

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70
MSSTRSEEIPKQVLIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV
cEEEccccHHHHHccccccccccHHHHcHHHHHHHHHHHHHHccccccccEEEEEEEccccccccEEEEc
ccccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccccccEEEE
msstrseeipkqvligkiepspadwlrDVDTRVAHGikygrdrkflnqgdpvivvtgwkkgagftntliv
msstrseeipkqvligkiepspadwlrdVDTRVAHGIkygrdrkflnqgdpvivvtgwkkgagftntliv
MSSTRSEEIPKQVLIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV
************VLIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTL**
MSSTRSEEIPKQVLIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV
**********KQVLIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV
MSSTRSEEIPKQVLIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSTRSEEIPKQVLIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query70 2.2.26 [Sep-21-2011]
O62619533 Pyruvate kinase OS=Drosop yes N/A 0.714 0.093 0.56 1e-11
P53657574 Pyruvate kinase isozymes yes N/A 1.0 0.121 0.441 2e-09
P30613574 Pyruvate kinase isozymes yes N/A 1.0 0.121 0.441 2e-09
P12928574 Pyruvate kinase isozymes yes N/A 1.0 0.121 0.441 2e-09
Q29536574 Pyruvate kinase isozymes yes N/A 1.0 0.121 0.428 5e-09
Q5NVN0531 Pyruvate kinase isozyme M yes N/A 0.742 0.097 0.480 2e-08
P00548530 Pyruvate kinase muscle is yes N/A 0.742 0.098 0.480 2e-08
P11974531 Pyruvate kinase isozymes no N/A 0.742 0.097 0.480 3e-08
P11979531 Pyruvate kinase isozyme M N/A N/A 0.742 0.097 0.480 4e-08
P14618531 Pyruvate kinase isozymes no N/A 0.742 0.097 0.480 5e-08
>sp|O62619|KPYK_DROME Pyruvate kinase OS=Drosophila melanogaster GN=PyK PE=2 SV=2 Back     alignment and function desciption
 Score = 68.6 bits (166), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 37/50 (74%)

Query: 19  EPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTL 68
           EP   DWL+DVD RV  G++ G+   F+  GD V+VVTGWK+G+GFTNT+
Sbjct: 478 EPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTI 527

Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: .EC: 4EC: 0
>sp|P53657|KPYR_MOUSE Pyruvate kinase isozymes R/L OS=Mus musculus GN=Pklr PE=2 SV=1 Back     alignment and function description
>sp|P30613|KPYR_HUMAN Pyruvate kinase isozymes R/L OS=Homo sapiens GN=PKLR PE=1 SV=2 Back     alignment and function description
>sp|P12928|KPYR_RAT Pyruvate kinase isozymes R/L OS=Rattus norvegicus GN=Pklr PE=2 SV=2 Back     alignment and function description
>sp|Q29536|KPYR_CANFA Pyruvate kinase isozymes R/L OS=Canis familiaris GN=PKLR PE=2 SV=2 Back     alignment and function description
>sp|Q5NVN0|KPYM_PONAB Pyruvate kinase isozyme M1/M2 OS=Pongo abelii GN=PKM PE=2 SV=3 Back     alignment and function description
>sp|P00548|KPYK_CHICK Pyruvate kinase muscle isozyme OS=Gallus gallus GN=PKM PE=2 SV=2 Back     alignment and function description
>sp|P11974|KPYM_RABIT Pyruvate kinase isozymes M1/M2 OS=Oryctolagus cuniculus GN=PKM PE=1 SV=4 Back     alignment and function description
>sp|P11979|KPYM_FELCA Pyruvate kinase isozyme M1/M2 OS=Felis catus GN=PKM PE=1 SV=2 Back     alignment and function description
>sp|P14618|KPYM_HUMAN Pyruvate kinase isozymes M1/M2 OS=Homo sapiens GN=PKM PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
328704551 567 PREDICTED: pyruvate kinase-like isoform 0.657 0.081 0.695 1e-13
193624987 519 PREDICTED: pyruvate kinase-like isoform 0.657 0.088 0.695 3e-13
312379540 551 hypothetical protein AND_08587 [Anophele 0.742 0.094 0.596 1e-12
347972245 518 AGAP004596-PA [Anopheles gambiae str. PE 0.714 0.096 0.58 2e-12
328786389 595 PREDICTED: pyruvate kinase-like [Apis me 0.714 0.084 0.62 7e-12
380021483 530 PREDICTED: pyruvate kinase-like [Apis fl 0.714 0.094 0.62 7e-12
321453279 539 hypothetical protein DAPPUDRAFT_334106 [ 0.971 0.126 0.44 8e-12
124487779133 pyruvate kinase-like protein [Maconellic 1.0 0.526 0.428 8e-12
357630834 469 hypothetical protein KGM_10007 [Danaus p 0.742 0.110 0.596 9e-12
307207885 619 Pyruvate kinase [Harpegnathos saltator] 0.914 0.103 0.507 2e-11
>gi|328704551|ref|XP_003242527.1| PREDICTED: pyruvate kinase-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score = 80.5 bits (197), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 32/46 (69%), Positives = 40/46 (86%)

Query: 23  ADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTL 68
           +DWL+DVDTRV H IK+G+ R F+  GDPV+VVTGWKKG+G+TNTL
Sbjct: 516 SDWLKDVDTRVVHAIKFGKARGFIKTGDPVVVVTGWKKGSGYTNTL 561

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193624987|ref|XP_001947630.1| PREDICTED: pyruvate kinase-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312379540|gb|EFR25781.1| hypothetical protein AND_08587 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347972245|ref|XP_315228.5| AGAP004596-PA [Anopheles gambiae str. PEST] gi|333469340|gb|EAA10555.6| AGAP004596-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328786389|ref|XP_624390.2| PREDICTED: pyruvate kinase-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380021483|ref|XP_003694594.1| PREDICTED: pyruvate kinase-like [Apis florea] Back     alignment and taxonomy information
>gi|321453279|gb|EFX64530.1| hypothetical protein DAPPUDRAFT_334106 [Daphnia pulex] Back     alignment and taxonomy information
>gi|124487779|gb|ABN11975.1| pyruvate kinase-like protein [Maconellicoccus hirsutus] Back     alignment and taxonomy information
>gi|357630834|gb|EHJ78694.1| hypothetical protein KGM_10007 [Danaus plexippus] Back     alignment and taxonomy information
>gi|307207885|gb|EFN85446.1| Pyruvate kinase [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query70
FB|FBgn0003178533 PyK "Pyruvate kinase" [Drosoph 0.771 0.101 0.563 1.4e-11
WB|WBGene00009126913 pyk-1 [Caenorhabditis elegans 0.657 0.050 0.586 5.8e-10
WB|WBGene00014001515 pyk-2 [Caenorhabditis elegans 0.642 0.087 0.555 6.8e-10
MGI|MGI:97604574 Pklr "pyruvate kinase liver an 0.957 0.116 0.459 5.9e-09
RGD|3336574 Pklr "pyruvate kinase, liver a 0.957 0.116 0.459 5.9e-09
UNIPROTKB|H9KUV7510 PKLR "Pyruvate kinase" [Canis 0.742 0.101 0.557 6.3e-09
UNIPROTKB|Q29536574 PKLR "Pyruvate kinase isozymes 0.742 0.090 0.557 7.6e-09
UNIPROTKB|P30613574 PKLR "Pyruvate kinase isozymes 0.742 0.090 0.557 7.6e-09
UNIPROTKB|H9KUV5586 PKLR "Pyruvate kinase" [Canis 0.742 0.088 0.557 7.8e-09
ZFIN|ZDB-GENE-040801-230605 pkmb "pyruvate kinase, muscle, 0.971 0.112 0.4 8.2e-09
FB|FBgn0003178 PyK "Pyruvate kinase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 167 (63.8 bits), Expect = 1.4e-11, P = 1.4e-11
 Identities = 31/55 (56%), Positives = 40/55 (72%)

Query:    14 LIGKIEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTL 68
             LI K EP   DWL+DVD RV  G++ G+   F+  GD V+VVTGWK+G+GFTNT+
Sbjct:   474 LIYK-EPGLGDWLKDVDVRVQFGLQVGKKNGFIKTGDSVVVVTGWKQGSGFTNTI 527
GO:0004743 "pyruvate kinase activity" evidence=ISS;IMP;NAS
GO:0016310 "phosphorylation" evidence=ISS
GO:0006096 "glycolysis" evidence=IEA;NAS
GO:0005829 "cytosol" evidence=IDA
GO:0000287 "magnesium ion binding" evidence=IEA
GO:0030955 "potassium ion binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
WB|WBGene00009126 pyk-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00014001 pyk-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:97604 Pklr "pyruvate kinase liver and red blood cell" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3336 Pklr "pyruvate kinase, liver and RBC" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H9KUV7 PKLR "Pyruvate kinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q29536 PKLR "Pyruvate kinase isozymes R/L" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P30613 PKLR "Pyruvate kinase isozymes R/L" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H9KUV5 PKLR "Pyruvate kinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-230 pkmb "pyruvate kinase, muscle, b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O62619KPYK_DROME2, ., 7, ., 1, ., 4, 00.560.71420.0938yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
cd00288480 cd00288, Pyruvate_Kinase, Pyruvate kinase (PK): La 4e-11
pfam02887117 pfam02887, PK_C, Pyruvate kinase, alpha/beta domai 3e-07
TIGR01064473 TIGR01064, pyruv_kin, pyruvate kinase 2e-05
>gnl|CDD|238178 cd00288, Pyruvate_Kinase, Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information 
 Score = 55.8 bits (135), Expect = 4e-11
 Identities = 22/71 (30%), Positives = 38/71 (53%), Gaps = 6/71 (8%)

Query: 4   TRSEEIPKQVLIGK-IEP-----SPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTG 57
           TR+E+  +Q+ + + + P         W  D D R+   +   +++  L +GD V+VV G
Sbjct: 405 TRNEQTARQLHLYRGVYPVLFEEPKPGWQEDTDARLKAAVNVAKEKGLLKKGDLVVVVQG 464

Query: 58  WKKGAGFTNTL 68
           W  G+G TNT+
Sbjct: 465 WPVGSGSTNTM 475

Like other allosteric enzymes, PK has a high substrate affinity R state and a low affinity T state. PK exists as several different isozymes, depending on organism and tissue type. In mammals, there are four PK isozymes: R, found in red blood cells, L, found in liver, M1, found in skeletal muscle, and M2, found in kidney, adipose tissue, and lung. PK forms a homotetramer, with each subunit containing three domains. The T state to R state transition of PK is more complex than in most allosteric enzymes, involving a concerted rotation of all 3 domains of each monomer in the homotetramer. Length = 480
>gnl|CDD|217269 pfam02887, PK_C, Pyruvate kinase, alpha/beta domain Back     alignment and domain information
>gnl|CDD|233257 TIGR01064, pyruv_kin, pyruvate kinase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 70
PF02887117 PK_C: Pyruvate kinase, alpha/beta domain; InterPro 99.87
PLN02762509 pyruvate kinase complex alpha subunit 99.75
PTZ00066513 pyruvate kinase; Provisional 99.74
PRK09206470 pyruvate kinase; Provisional 99.74
PRK06247476 pyruvate kinase; Provisional 99.73
PTZ00300454 pyruvate kinase; Provisional 99.72
PRK06354 590 pyruvate kinase; Provisional 99.71
cd00288480 Pyruvate_Kinase Pyruvate kinase (PK): Large allost 99.7
PLN02623581 pyruvate kinase 99.7
TIGR01064473 pyruv_kin pyruvate kinase. This enzyme is a homote 99.69
COG0469477 PykF Pyruvate kinase [Carbohydrate transport and m 99.68
PLN02461511 Probable pyruvate kinase 99.54
PLN02765526 pyruvate kinase 99.52
PRK05826465 pyruvate kinase; Provisional 99.51
KOG2323|consensus501 99.3
PF0854190 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (AC 91.05
PRK06816378 3-oxoacyl-(acyl carrier protein) synthase III; Rev 86.17
PRK1228176 rplX 50S ribosomal protein L24; Reviewed 85.93
COG0332323 FabH 3-oxoacyl-[acyl-carrier-protein] 85.44
smart0073928 KOW KOW (Kyprides, Ouzounis, Woese) motif. Motif i 85.14
CHL0014183 rpl24 ribosomal protein L24; Validated 82.74
TIGR0359569 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal 82.59
PLN02326379 3-oxoacyl-[acyl-carrier-protein] synthase III 82.18
CHL00203326 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Pr 82.04
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 81.29
TIGR0262093 cas_VVA1548 putative CRISPR-associated protein, VV 80.94
>PF02887 PK_C: Pyruvate kinase, alpha/beta domain; InterPro: IPR015795 Pyruvate kinase (2 Back     alignment and domain information 
Probab=99.87  E-value=5.2e-22  Score=109.72  Aligned_cols=70  Identities=30%  Similarity=0.493  Sum_probs=64.1

Q ss_pred             CeecCChhHHhhhcccc-eeeecCCCCC-CHHHHHHHHHHHHHhCCCCCCCCeEEEeecccCC-CCCCceEeC
Q psy255            1 MSSTRSEEIPKQVLIGK-IEPSPADWLR-DVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKG-AGFTNTLIV   70 (70)
Q Consensus         1 ~a~t~~~~~~r~l~l~~-v~~~~~~~~~-~~~~~~~~a~~~~~~~g~~~~GD~vv~~~g~~~~-~g~tn~l~v   70 (70)
                      ||+|++++++|||+|+| |+|+..+... +.++.++.+++.++++|++++||.||+++|.+.+ .|.||+|||
T Consensus        43 iavt~~~~~~r~l~l~~GV~p~~~~~~~~~~~~~~~~a~~~~~~~g~~~~gd~vVv~~g~~~~~~g~tn~~~v  115 (117)
T PF02887_consen   43 IAVTPNESVARQLSLYWGVYPVLIEEFDKDTEELIAEALEYAKERGLLKPGDKVVVVAGMPFGTPGGTNTIRV  115 (117)
T ss_dssp             EEEESSHHHHHHGGGSTTEEEEECSSHSHSHHHHHHHHHHHHHHTTSS-TTSEEEEEEESSTTTTSSEEEEEE
T ss_pred             EEEcCcHHHHhhhhcccceEEEEeccccccHHHHHHHHHHHHHHcCCCCCCCEEEEEeCCCCCCCCCCEEEEE
Confidence            58999999999999999 9998776665 8999999999999999999999999999998877 799999986

7.1.40 from EC) (PK) catalyses the final step in glycolysis [], the conversion of phosphoenolpyruvate to pyruvate with concomitant phosphorylation of ADP to ATP: ADP + phosphoenolpyruvate = ATP + pyruvate The enzyme, which is found in all living organisms, requires both magnesium and potassium ions for its activity. In vertebrates, there are four tissue-specific isozymes: L (liver), R (red cells), M1 (muscle, heart and brain), and M2 (early foetal tissue). In plants, PK exists as cytoplasmic and plastid isozymes, while most bacteria and lower eukaryotes have one form, except in certain bacteria, such as Escherichia coli, that have two isozymes. All isozymes appear to be tetramers of identical subunits of ~500 residues. PK helps control the rate of glycolysis, along with phosphofructokinase (IPR000023 from INTERPRO) and hexokinase (IPR001312 from INTERPRO). PK possesses allosteric sites for numerous effectors, yet the isozymes respond differently, in keeping with their different tissue distributions []. The activity of L-type (liver) PK is increased by fructose-1,6-bisphosphate (F1,6BP) and lowered by ATP and alanine (gluconeogenic precursor), therefore when glucose levels are high, glycolysis is promoted, and when levels are low, gluconeogenesis is promoted. L-type PK is also hormonally regulated, being activated by insulin and inhibited by glucagon, which covalently modifies the PK enzyme. M1-type (muscle, brain) PK is inhibited by ATP, but F1,6BP and alanine have no effect, which correlates with the function of muscle and brain, as opposed to the liver. The structure of several pyruvate kinases from various organisms have been determined [, ]. The protein comprises three-four domains: a small N-terminal helical domain (absent in bacterial PK), a beta/alpha-barrel domain, a beta-barrel domain (inserted within the beta/alpha-barrel domain), and a 3-layer alpha/beta/alpha sandwich domain. This entry represents the 3-layer alpha/beta/alpha sandwich domain. This domain has a similar topology to the archaeal hypothetical protein, MTH1675 from Methanobacterium thermoautotrophicum.; PDB: 3QTG_B 1VP8_A 1T57_C 3N25_A 1AQF_C 2G50_B 1F3X_G 1A5U_F 1A49_E 1F3W_C ....
>PLN02762 pyruvate kinase complex alpha subunit Back     alignment and domain information
>PTZ00066 pyruvate kinase; Provisional Back     alignment and domain information
>PRK09206 pyruvate kinase; Provisional Back     alignment and domain information
>PRK06247 pyruvate kinase; Provisional Back     alignment and domain information
>PTZ00300 pyruvate kinase; Provisional Back     alignment and domain information
>PRK06354 pyruvate kinase; Provisional Back     alignment and domain information
>cd00288 Pyruvate_Kinase Pyruvate kinase (PK): Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors Back     alignment and domain information
>PLN02623 pyruvate kinase Back     alignment and domain information
>TIGR01064 pyruv_kin pyruvate kinase Back     alignment and domain information
>COG0469 PykF Pyruvate kinase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02461 Probable pyruvate kinase Back     alignment and domain information
>PLN02765 pyruvate kinase Back     alignment and domain information
>PRK05826 pyruvate kinase; Provisional Back     alignment and domain information
>KOG2323|consensus Back     alignment and domain information
>PF08541 ACP_syn_III_C: 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III C terminal ; InterPro: IPR013747 This domain is found on 3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III 2 Back     alignment and domain information
>PRK06816 3-oxoacyl-(acyl carrier protein) synthase III; Reviewed Back     alignment and domain information
>PRK12281 rplX 50S ribosomal protein L24; Reviewed Back     alignment and domain information
>COG0332 FabH 3-oxoacyl-[acyl-carrier-protein] Back     alignment and domain information
>smart00739 KOW KOW (Kyprides, Ouzounis, Woese) motif Back     alignment and domain information
>CHL00141 rpl24 ribosomal protein L24; Validated Back     alignment and domain information
>TIGR03595 Obg_CgtA_exten Obg family GTPase CgtA, C-terminal extension Back     alignment and domain information
>PLN02326 3-oxoacyl-[acyl-carrier-protein] synthase III Back     alignment and domain information
>CHL00203 fabH 3-oxoacyl-acyl-carrier-protein synthase 3; Provisional Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>TIGR02620 cas_VVA1548 putative CRISPR-associated protein, VVA1548 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
2vgf_A528 Human Erythrocyte Pyruvate Kinase: T384m Mutant Len 1e-10
2vgg_A528 Human Erythrocyte Pyruvate Kinase: R479h Mutant Len 1e-10
2vgb_A528 Human Erythrocyte Pyruvate Kinase Length = 528 1e-10
4ip7_A543 Structure Of The S12d Variant Of Human Liver Pyruva 1e-10
4ima_A543 The Structure Of C436m-hlpyk In Complex With Citrat 1e-10
2vgi_A528 Human Erythrocyte Pyruvate Kinase: R486w Mutant Len 1e-10
3srf_C551 Human M1 Pyruvate Kinase Length = 551 2e-09
1f3w_A530 Recombinant Rabbit Muscle Pyruvate Kinase Length = 3e-09
1aqf_A530 Pyruvate Kinase From Rabbit Muscle With Mg, K, And 3e-09
1f3x_A530 S402p Mutant Of Rabbit Muscle Pyruvate Kinase Lengt 3e-09
3n25_A531 The Structure Of Muscle Pyruvate Kinase In Complex 3e-09
2g50_A530 The Location Of The Allosteric Amino Acid Binding S 3e-09
1pkm_A530 The Refined Three-Dimensional Structure Of Cat Musc 4e-09
1t5a_A567 Human Pyruvate Kinase M2 Length = 567 4e-09
3bjt_A530 Pyruvate Kinase M2 Is A Phosphotyrosine Binding Pro 4e-09
3u2z_A533 Activator-Bound Structure Of Human Pyruvate Kinase 4e-09
3bjf_A518 Pyruvate Kinase M2 Is A Phosphotyrosine Binding Pro 4e-09
4g1n_A518 Pkm2 In Complex With An Activator Length = 518 4e-09
3g2g_A533 S437y Mutant Of Human Muscle Pyruvate Kinase, Isofo 4e-09
3srd_A551 Human M2 Pyruvate Kinase In Complex With Fructose 1 4e-09
3gqy_A550 Activator-Bound Structure Of Human Pyruvate Kinase 4e-09
1zjh_A548 Structure Of Human Muscle Pyruvate Kinase (Pkm2) Le 4e-09
4b2d_D548 Human Pkm2 With L-serine And Fbp Bound Length = 548 4e-09
1pkn_A530 Structure Of Rabbit Muscle Pyruvate Kinase Complexe 2e-08
1a3w_A500 Pyruvate Kinase From Saccharomyces Cerevisiae Compl 2e-05
>pdb|2VGF|A Chain A, Human Erythrocyte Pyruvate Kinase: T384m Mutant Length = 528 Back     alignment and structure 
Iteration: 1

 Score = 61.2 bits (147), Expect = 1e-10,   Method: Composition-based stats.
 Identities = 34/77 (44%), Positives = 46/77 (59%), Gaps = 7/77 (9%)
Query: 1   MSSTRSEEIPKQVLIGK-------IEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVI 53
           ++ TRS +  +QV + +        EP  A W  DVD RV  GI+ G+ R FL  GD VI
Sbjct: 448 IAVTRSAQAARQVHLCRGVFPLLYREPPEAIWADDVDRRVQFGIESGKLRGFLRVGDLVI 507
Query: 54  VVTGWKKGAGFTNTLIV 70
           VVTGW+ G+G+TN + V
Sbjct: 508 VVTGWRPGSGYTNIMRV 524
>pdb|2VGG|A Chain A, Human Erythrocyte Pyruvate Kinase: R479h Mutant Length = 528 Back     alignment and structure
>pdb|2VGB|A Chain A, Human Erythrocyte Pyruvate Kinase Length = 528 Back     alignment and structure
>pdb|4IP7|A Chain A, Structure Of The S12d Variant Of Human Liver Pyruvate Kinase In Complex With Citrate And Fbp. Length = 543 Back     alignment and structure
>pdb|4IMA|A Chain A, The Structure Of C436m-hlpyk In Complex With Citrate/mn/atp/fru-1,6-bp Length = 543 Back     alignment and structure
>pdb|2VGI|A Chain A, Human Erythrocyte Pyruvate Kinase: R486w Mutant Length = 528 Back     alignment and structure
>pdb|3SRF|C Chain C, Human M1 Pyruvate Kinase Length = 551 Back     alignment and structure
>pdb|1F3W|A Chain A, Recombinant Rabbit Muscle Pyruvate Kinase Length = 530 Back     alignment and structure
>pdb|1AQF|A Chain A, Pyruvate Kinase From Rabbit Muscle With Mg, K, And L- Phospholactate Length = 530 Back     alignment and structure
>pdb|1F3X|A Chain A, S402p Mutant Of Rabbit Muscle Pyruvate Kinase Length = 530 Back     alignment and structure
>pdb|3N25|A Chain A, The Structure Of Muscle Pyruvate Kinase In Complex With Proline, Pyruvate, And Mn2+ Length = 531 Back     alignment and structure
>pdb|2G50|A Chain A, The Location Of The Allosteric Amino Acid Binding Site Of Muscle Pyruvate Kinase. Length = 530 Back     alignment and structure
>pdb|1PKM|A Chain A, The Refined Three-Dimensional Structure Of Cat Muscle (M1) Pyruvate Kinase, At A Resolution Of 2.6 Angstroms Length = 530 Back     alignment and structure
>pdb|1T5A|A Chain A, Human Pyruvate Kinase M2 Length = 567 Back     alignment and structure
>pdb|3BJT|A Chain A, Pyruvate Kinase M2 Is A Phosphotyrosine Binding Protein Length = 530 Back     alignment and structure
>pdb|3U2Z|A Chain A, Activator-Bound Structure Of Human Pyruvate Kinase M2 Length = 533 Back     alignment and structure
>pdb|3BJF|A Chain A, Pyruvate Kinase M2 Is A Phosphotyrosine Binding Protein Length = 518 Back     alignment and structure
>pdb|4G1N|A Chain A, Pkm2 In Complex With An Activator Length = 518 Back     alignment and structure
>pdb|3G2G|A Chain A, S437y Mutant Of Human Muscle Pyruvate Kinase, Isoform M2 Length = 533 Back     alignment and structure
>pdb|3SRD|A Chain A, Human M2 Pyruvate Kinase In Complex With Fructose 1-6 Bisphosphate And Oxalate. Length = 551 Back     alignment and structure
>pdb|3GQY|A Chain A, Activator-Bound Structure Of Human Pyruvate Kinase M2 Length = 550 Back     alignment and structure
>pdb|1ZJH|A Chain A, Structure Of Human Muscle Pyruvate Kinase (Pkm2) Length = 548 Back     alignment and structure
>pdb|4B2D|D Chain D, Human Pkm2 With L-serine And Fbp Bound Length = 548 Back     alignment and structure
>pdb|1PKN|A Chain A, Structure Of Rabbit Muscle Pyruvate Kinase Complexed With Mn2+, K+, And Pyruvate Length = 530 Back     alignment and structure
>pdb|1A3W|A Chain A, Pyruvate Kinase From Saccharomyces Cerevisiae Complexed With Fbp, Pg, Mn2+ And K+ Length = 500 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query70
3gr4_A550 Pyruvate kinase isozymes M1/M2; activator, acetyla 2e-12
1a3w_A500 Pyruvate kinase; allosteric regulation, tranferase 6e-12
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysi 1e-11
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 3e-11
3ma8_A534 Pyruvate kinase; parasitology, pyruvate kiase, gly 7e-10
3khd_A520 Pyruvate kinase; malaria, structural genomics, str 1e-09
3t05_A 606 Pyruvate kinase, PK; tetramer, glycolysis, transfe 2e-09
3gg8_A511 Pyruvate kinase; malaria, genomics, proteomics, gl 9e-09
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40 5e-08
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 1zjh_A 3g2g_A 1t5a_A* 3bjt_A 3bjf_A* 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* 1aqf_A* 1pkm_A 2g50_A* 1pkn_A 2vgb_A* 2vgf_A* 2vgg_A* ... Length = 550 Back     alignment and structure
 Score = 59.3 bits (144), Expect = 2e-12
 Identities = 25/52 (48%), Positives = 33/52 (63%)

Query: 19  EPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV 70
           +P    W  DVD RV   +  G+ R F  +GD VIV+TGW+ G+GFTNT+ V
Sbjct: 495 DPVQEAWAEDVDLRVNFAMNVGKARGFFKKGDVVIVLTGWRPGSGFTNTMRV 546
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase, transfer; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Length = 500 Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Length = 470 Back     alignment and structure
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Length = 499 Back     alignment and structure
>3ma8_A Pyruvate kinase; parasitology, pyruvate kiase, glycol kinase, magnesium, transferase, structural genomi structural genomics consortium; HET: CIT; 2.64A {Cryptosporidium parvum} Length = 534 Back     alignment and structure
>3khd_A Pyruvate kinase; malaria, structural genomics, structural GE consortium, SGC, transferase; 2.70A {Plasmodium falciparum 3D7} Length = 520 Back     alignment and structure
>3t05_A Pyruvate kinase, PK; tetramer, glycolysis, transferase; 3.05A {Staphylococcus aureus subsp} PDB: 3t07_A* Length = 606 Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, STRU genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Length = 511 Back     alignment and structure
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Length = 587 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
4drs_A526 Pyruvate kinase; glycolysis, allosteric EN transfe 99.84
3khd_A520 Pyruvate kinase; malaria, structural genomics, str 99.82
1e0t_A470 Pyruvate kinase, PK; phosphotransferase, glycolysi 99.81
3gg8_A511 Pyruvate kinase; malaria, genomics, proteomics, gl 99.81
3t05_A 606 Pyruvate kinase, PK; tetramer, glycolysis, transfe 99.8
3gr4_A550 Pyruvate kinase isozymes M1/M2; activator, acetyla 99.79
1a3w_A500 Pyruvate kinase; allosteric regulation, tranferase 99.79
3hqn_D499 Pyruvate kinase, PK; TIM barrel, T-state enzyme, t 99.78
2e28_A 587 Pyruvate kinase, PK; allosteric, transferase; 2.40 99.73
3qtg_A461 Pyruvate kinase, PK; TIM barrel, glycolysis, trans 99.47
3gwa_A365 3-oxoacyl-(acyl-carrier-protein) synthase III; str 87.94
3il6_A321 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 82.63
3il3_A323 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, 82.42
4dfe_A333 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgci 81.96
1vc3_B96 L-aspartate-alpha-decarboxylase heavy chain; tetra 80.37
>4drs_A Pyruvate kinase; glycolysis, allosteric EN transferase; 2.50A {Cryptosporidium parvum} PDB: 3ma8_A* Back     alignment and structure
Probab=99.84  E-value=4.1e-21  Score=125.88  Aligned_cols=70  Identities=16%  Similarity=0.367  Sum_probs=59.0

Q ss_pred             CeecCChhHHhhhcccc-eeeecCCCCCCHHHHHHHHHHHHHhCCCCCCCCeEEEeecccCC-CCCCceEeC
Q psy255            1 MSSTRSEEIPKQVLIGK-IEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKG-AGFTNTLIV   70 (70)
Q Consensus         1 ~a~t~~~~~~r~l~l~~-v~~~~~~~~~~~~~~~~~a~~~~~~~g~~~~GD~vv~~~g~~~~-~g~tn~l~v   70 (70)
                      ||+|++++++|||+|+| |+|++.++..+.|++++.|+++++++|++++||.||+++|.|.+ +|.||+|||
T Consensus       451 ~a~T~~~~~~r~l~L~wGV~p~~~~~~~~~d~~i~~a~~~~~~~g~~~~GD~vVi~~G~p~g~~G~TN~lrv  522 (526)
T 4drs_A          451 IACTAKPEVARGLKIARGVKTYVLNSIHHSEVVISNALALAKEESLIESGDFAIAVHGVKESCPGSCNLMKI  522 (526)
T ss_dssp             EEEESCHHHHHHGGGSTTEEEEECSCCCCHHHHHHHHHHHHHHTTSCCTTCEEEEEC----------CCEEE
T ss_pred             EEECCCHHHHHhhhccCCeEEEEeCCCCCHHHHHHHHHHHHHHCCCCCCcCEEEEEeccCCCCCCcceEEEE
Confidence            58999999999999999 99999988899999999999999999999999999999999988 899999986
>3khd_A Pyruvate kinase; malaria, structural genomics, structural GE consortium, SGC, transferase; 2.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1e0t_A Pyruvate kinase, PK; phosphotransferase, glycolysis, allostery; 1.8A {Escherichia coli} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1pky_A 1e0u_A Back     alignment and structure
>3gg8_A Pyruvate kinase; malaria, genomics, proteomics, glycolysis, magnesium, transferase, structural genomics, STRU genomics consortium, SGC; 2.21A {Toxoplasma gondii} PDB: 3eoe_A Back     alignment and structure
>3t05_A Pyruvate kinase, PK; tetramer, glycolysis, transferase; 3.05A {Staphylococcus aureus subsp} PDB: 3t07_A* 3t0t_A* Back     alignment and structure
>3gr4_A Pyruvate kinase isozymes M1/M2; activator, acetylation, allosteric enzyme, alternative splicing, glycolysis, magnesium, metal-binding; HET: FBP TLA DYY ADP; 1.60A {Homo sapiens} PDB: 3gqy_A* 3h6o_A* 3me3_A* 3srh_A 3srd_A 1zjh_A 4b2d_A* 4b2d_D* 3u2z_A* 3g2g_A 1t5a_A* 3bjt_A 4g1n_A* 3bjf_A* 3srf_C 1f3x_A 3n25_A 1f3w_A 1a49_A* 1a5u_A* ... Back     alignment and structure
>1a3w_A Pyruvate kinase; allosteric regulation, tranferase, transfer; HET: FBP; 3.00A {Saccharomyces cerevisiae} SCOP: b.58.1.1 c.1.12.1 c.49.1.1 PDB: 1a3x_A Back     alignment and structure
>3hqn_D Pyruvate kinase, PK; TIM barrel, T-state enzyme, transferase, allosteric enzyme, binding, glycolysis, magnesium, metal-binding, NUCL binding; 2.00A {Leishmania mexicana} PDB: 1pkl_A 3hqo_K* 3hqp_A* 3hqq_A* 3is4_A* 3ktx_A* 3qv6_A* 3qv7_D* 3qv8_D* 3srk_A* 3e0w_A 3e0v_A 3pp7_A* 3qv9_A* Back     alignment and structure
>2e28_A Pyruvate kinase, PK; allosteric, transferase; 2.40A {Geobacillus stearothermophilus} Back     alignment and structure
>3qtg_A Pyruvate kinase, PK; TIM barrel, glycolysis, transferase; 2.20A {Pyrobaculum aerophilum} Back     alignment and structure
>3gwa_A 3-oxoacyl-(acyl-carrier-protein) synthase III; structural genomics, synthetase; 1.60A {Burkholderia pseudomallei} PDB: 3gwe_A Back     alignment and structure
>3il6_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; HET: B83; 2.50A {Enterococcus faecalis} PDB: 3il5_A* 3il4_A* Back     alignment and structure
>3il3_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; FABH, fatty acid biosynthesis, antibiotic, acyltransferase, cytoplasm, lipid synthesis; 2.70A {Haemophilus influenzae} Back     alignment and structure
>4dfe_A 3-oxoacyl-[acyl-carrier-protein] synthase 3; ssgcid, seattle structural genomics center for infectious DI transferase; 2.35A {Burkholderia xenovorans} Back     alignment and structure
>1vc3_B L-aspartate-alpha-decarboxylase heavy chain; tetramer, pyruvoyl group, riken structural genomics/proteomi initiative, RSGI; 1.50A {Thermus thermophilus} PDB: 2eeo_B Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 70
d2vgba3134 c.49.1.1 (A:440-573) Pyruvate kinase, C-terminal d 1e-11
d1a3xa3134 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal d 2e-11
d1e0ta3117 c.49.1.1 (A:354-470) Pyruvate kinase, C-terminal d 2e-11
d1pkla3141 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal d 5e-11
d2g50a3135 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal d 5e-11
>d1a3xa3 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 134 Back     information, alignment and structure
>d1e0ta3 c.49.1.1 (A:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 117 Back     information, alignment and structure
>d1pkla3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana [TaxId: 5665]} Length = 141 Back     information, alignment and structure
>d2g50a3 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 135 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query70
d1e0ta3117 Pyruvate kinase, C-terminal domain {Escherichia co 99.92
d2g50a3135 Pyruvate kinase, C-terminal domain {Rabbit (Orycto 99.88
d1a3xa3134 Pyruvate kinase, C-terminal domain {Baker's yeast 99.88
d2vgba3134 Pyruvate kinase, C-terminal domain {Human (Homo sa 99.86
d1pkla3141 Pyruvate kinase, C-terminal domain {Leishmania mex 99.85
d1mzja2153 Priming beta-ketosynthase from the r1128 polyketid 91.88
d1ub7a2149 Ketoacyl-ACP synthase III (FabH) {Thermus thermoph 91.02
d1u6ea2148 Ketoacyl-ACP synthase III (FabH) {Mycobacterium tu 89.99
d1hnja2143 Ketoacyl-ACP synthase III (FabH) {Escherichia coli 89.86
d1u0ma2148 Putative polyketide synthase SCO1206 {Streptomyces 86.91
d2do3a162 Transcription elongation factor SPT5 {Human (Homo 83.02
>d1e0ta3 c.49.1.1 (A:354-470) Pyruvate kinase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Pyruvate kinase C-terminal domain-like
superfamily: PK C-terminal domain-like
family: Pyruvate kinase, C-terminal domain
domain: Pyruvate kinase, C-terminal domain
species: Escherichia coli [TaxId: 562]

Probab=99.92  E-value=5.9e-25  Score=119.63  Aligned_cols=70  Identities=24%  Similarity=0.329  Sum_probs=66.7

Q ss_pred             CeecCChhHHhhhcccc-eeeecCCCCCCHHHHHHHHHHHHHhCCCCCCCCeEEEeecccCCCCCCceEeC
Q psy255            1 MSSTRSEEIPKQVLIGK-IEPSPADWLRDVDTRVAHGIKYGRDRKFLNQGDPVIVVTGWKKGAGFTNTLIV   70 (70)
Q Consensus         1 ~a~t~~~~~~r~l~l~~-v~~~~~~~~~~~~~~~~~a~~~~~~~g~~~~GD~vv~~~g~~~~~g~tn~l~v   70 (70)
                      ||+|++++++|||+|+| |+|++.+...+.|+++..+.++++++|++++||+||+++|.+.+.|.||++||
T Consensus        44 ~a~T~~~~~~r~l~l~~GV~p~~~~~~~~~~~~~~~a~~~~~~~g~~~~GD~vVvv~G~~~~~g~tN~i~v  114 (117)
T d1e0ta3          44 LALTTNEKTAHQLVLSKGVVPQLVKEITSTDDFYRLGKELALQSGLAHKGDVVVMVSGALVPSGTTNTASV  114 (117)
T ss_dssp             EEEESCHHHHHHGGGSTTEEEEECSCCCSHHHHHHHHHHHHHHTSSSCTTCEEEEEECSSSCTTCCCEEEE
T ss_pred             eeecCCHHHHHHhcccCCeeecccCCcCCHHHHHHHHHHHHHHcCCCCCCCEEEEEccCCCCCCCCEEEEE
Confidence            58999999999999999 99999988889999999999999999999999999999999877899999986
>d2g50a3 c.49.1.1 (A:396-530) Pyruvate kinase, C-terminal domain {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1a3xa3 c.49.1.1 (A:367-500) Pyruvate kinase, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pkla3 c.49.1.1 (A:358-498) Pyruvate kinase, C-terminal domain {Leishmania mexicana [TaxId: 5665]} Back     information, alignment and structure
>d1mzja2 c.95.1.2 (A:184-336) Priming beta-ketosynthase from the r1128 polyketide biosynthetic pathway {Streptomyces sp. r1128 [TaxId: 140437]} Back     information, alignment and structure
>d1ub7a2 c.95.1.2 (A:174-322) Ketoacyl-ACP synthase III (FabH) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u6ea2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hnja2 c.95.1.2 (A:175-317) Ketoacyl-ACP synthase III (FabH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u0ma2 c.95.1.2 (A:202-349) Putative polyketide synthase SCO1206 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2do3a1 b.34.5.5 (A:462-523) Transcription elongation factor SPT5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure