Psyllid ID: psy2585

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSGPQESERGRLSTFAVSGDVAR
ccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcc
HHHHHHHHHHHHHHHccccHHHcHHHccccccccccccccccccccccccccccccccccccEccHHHcccccEEEcEEc
mkgrlfsypdthrhrlgpnylqlpvncpfatkvanyqrdgpmafnnqggapnyfpnsfsgpqesergrlstfavsgdvar
mkgrlfsypdthrhrlgpnylqlpVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSgpqesergrlstfavsgdvar
MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSGPQESERGRLSTFAVSGDVAR
************RHRLGPNYLQLPVNCPFATKVANYQR******************************************
MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSGPQESERGRLSTFAVSGDVAR
MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFS*********************
MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSGPQESERGRLSTFAVSGDVA*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSGPQESERGRLSTFAVSGDVAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query80 2.2.26 [Sep-21-2011]
Q9PWF7528 Catalase OS=Glandirana ru N/A N/A 1.0 0.151 0.740 1e-29
Q64405527 Catalase OS=Cavia porcell yes N/A 1.0 0.151 0.691 7e-28
Q9PT92526 Catalase OS=Danio rerio G yes N/A 1.0 0.152 0.716 5e-27
O62839527 Catalase OS=Sus scrofa GN yes N/A 1.0 0.151 0.666 2e-26
P00432527 Catalase OS=Bos taurus GN yes N/A 1.0 0.151 0.654 7e-26
P24270527 Catalase OS=Mus musculus yes N/A 1.0 0.151 0.629 7e-26
O97492527 Catalase OS=Canis familia yes N/A 1.0 0.151 0.654 1e-25
P04762527 Catalase OS=Rattus norveg yes N/A 1.0 0.151 0.641 2e-25
P17336506 Catalase OS=Drosophila me yes N/A 1.0 0.158 0.662 2e-25
P04040527 Catalase OS=Homo sapiens yes N/A 1.0 0.151 0.617 4e-25
>sp|Q9PWF7|CATA_GLARU Catalase OS=Glandirana rugosa GN=cat PE=2 SV=3 Back     alignment and function desciption
 Score =  128 bits (321), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1   MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAF-NNQGGAPNYFPNSFS 59
           ++GRLFSYPDTHRHRLG NYLQLPVNCP+  +VANYQRDGPM F +NQGGAPNYFPNSFS
Sbjct: 351 LQGRLFSYPDTHRHRLGANYLQLPVNCPYKARVANYQRDGPMCFSDNQGGAPNYFPNSFS 410

Query: 60  GPQESERGRLSTFAVSGDVAR 80
            P+     R S F VS DVAR
Sbjct: 411 APENQPAARESKFRVSADVAR 431
Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide.
Glandirana rugosa (taxid: 8410)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 6
>sp|Q64405|CATA_CAVPO Catalase OS=Cavia porcellus GN=CAT PE=2 SV=4 Back     alignment and function description
>sp|Q9PT92|CATA_DANRE Catalase OS=Danio rerio GN=cat PE=2 SV=1 Back     alignment and function description
>sp|O62839|CATA_PIG Catalase OS=Sus scrofa GN=CAT PE=1 SV=4 Back     alignment and function description
>sp|P00432|CATA_BOVIN Catalase OS=Bos taurus GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|P24270|CATA_MOUSE Catalase OS=Mus musculus GN=Cat PE=1 SV=4 Back     alignment and function description
>sp|O97492|CATA_CANFA Catalase OS=Canis familiaris GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|P04762|CATA_RAT Catalase OS=Rattus norvegicus GN=Cat PE=1 SV=3 Back     alignment and function description
>sp|P17336|CATA_DROME Catalase OS=Drosophila melanogaster GN=Cat PE=1 SV=2 Back     alignment and function description
>sp|P04040|CATA_HUMAN Catalase OS=Homo sapiens GN=CAT PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
9972788 528 RecName: Full=Catalase gi|5816708|dbj|BA 1.0 0.151 0.740 4e-28
29373129 528 catalase [Melopsittacus undulatus] 1.0 0.151 0.703 6e-28
60422777 527 LOC548403 protein, partial [Xenopus (Sil 1.0 0.151 0.728 7e-28
118403686 528 catalase, gene 2 [Xenopus (Silurana) tro 1.0 0.151 0.728 7e-28
399763006 528 catalase [Pelodiscus sinensis] 1.0 0.151 0.691 4e-27
193713906 504 PREDICTED: catalase-like [Acyrthosiphon 1.0 0.158 0.687 4e-27
148223641 528 catalase, gene 2 [Xenopus laevis] gi|328 1.0 0.151 0.716 5e-27
448278792 527 catalase, partial [Oryzias melastigma] 1.0 0.151 0.728 6e-27
432860337 527 PREDICTED: catalase-like isoform 1 [Oryz 1.0 0.151 0.728 6e-27
118136396 528 catalase [Xenopus laevis] 1.0 0.151 0.716 6e-27
>gi|9972788|sp|Q9PWF7.3|CATA_RANRU RecName: Full=Catalase gi|5816708|dbj|BAA83685.1| catalase [Glandirana rugosa] Back     alignment and taxonomy information
 Score =  128 bits (321), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 66/81 (81%), Gaps = 1/81 (1%)

Query: 1   MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAF-NNQGGAPNYFPNSFS 59
           ++GRLFSYPDTHRHRLG NYLQLPVNCP+  +VANYQRDGPM F +NQGGAPNYFPNSFS
Sbjct: 351 LQGRLFSYPDTHRHRLGANYLQLPVNCPYKARVANYQRDGPMCFSDNQGGAPNYFPNSFS 410

Query: 60  GPQESERGRLSTFAVSGDVAR 80
            P+     R S F VS DVAR
Sbjct: 411 APENQPAARESKFRVSADVAR 431

Source: Glandirana rugosa

Species: Glandirana rugosa

Genus: Glandirana

Family: Ranidae

Order: Anura

Class: Amphibia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|29373129|gb|AAO72713.1| catalase [Melopsittacus undulatus] Back     alignment and taxonomy information
>gi|60422777|gb|AAH90377.1| LOC548403 protein, partial [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|118403686|ref|NP_001072167.1| catalase, gene 2 [Xenopus (Silurana) tropicalis] gi|116063343|gb|AAI23049.1| hypothetical LOC548403 [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|399763006|gb|AFP50152.1| catalase [Pelodiscus sinensis] Back     alignment and taxonomy information
>gi|193713906|ref|XP_001943641.1| PREDICTED: catalase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|148223641|ref|NP_001080544.1| catalase, gene 2 [Xenopus laevis] gi|32822922|gb|AAH54964.1| Cat-prov protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|448278792|gb|AGE44248.1| catalase, partial [Oryzias melastigma] Back     alignment and taxonomy information
>gi|432860337|ref|XP_004069508.1| PREDICTED: catalase-like isoform 1 [Oryzias latipes] Back     alignment and taxonomy information
>gi|118136396|gb|ABK62836.1| catalase [Xenopus laevis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query80
UNIPROTKB|F1NGJ7528 CAT "Catalase" [Gallus gallus 1.0 0.151 0.679 1.2e-27
UNIPROTKB|Q64405527 CAT "Catalase" [Cavia porcellu 1.0 0.151 0.691 1.5e-27
UNIPROTKB|F1SGS9527 CAT "Catalase" [Sus scrofa (ta 1.0 0.151 0.679 2.6e-27
ZFIN|ZDB-GENE-000210-20526 cat "catalase" [Danio rerio (t 1.0 0.152 0.716 9.2e-27
UNIPROTKB|O62839527 CAT "Catalase" [Sus scrofa (ta 1.0 0.151 0.666 2.6e-26
UNIPROTKB|P00432527 CAT "Catalase" [Bos taurus (ta 1.0 0.151 0.654 9.2e-26
UNIPROTKB|O97492527 CAT "Catalase" [Canis lupus fa 1.0 0.151 0.654 2.6e-25
MGI|MGI:88271527 Cat "catalase" [Mus musculus ( 1.0 0.151 0.629 3.3e-25
RGD|2279527 Cat "catalase" [Rattus norvegi 1.0 0.151 0.641 3.3e-25
FB|FBgn0000261506 Cat "Catalase" [Drosophila mel 1.0 0.158 0.674 3.6e-25
UNIPROTKB|F1NGJ7 CAT "Catalase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 314 (115.6 bits), Expect = 1.2e-27, P = 1.2e-27
 Identities = 55/81 (67%), Positives = 68/81 (83%)

Query:     1 MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFN-NQGGAPNYFPNSFS 59
             ++GRLF+YPDTHRHRLGPNYLQ+PVNCP+  +VANYQRDGPM  + NQGGAPNY+PNSF+
Sbjct:   351 LQGRLFAYPDTHRHRLGPNYLQIPVNCPYRARVANYQRDGPMCVSDNQGGAPNYYPNSFT 410

Query:    60 GPQESERGRLSTFAVSGDVAR 80
             GP++    + S  +VSGDV R
Sbjct:   411 GPEDQPVLKESRMSVSGDVQR 431
GO:0046872 "metal ion binding" evidence=IEA
GO:0004096 "catalase activity" evidence=IEA
GO:0004046 "aminoacylase activity" evidence=IEA
GO:0005102 "receptor binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA
GO:0005778 "peroxisomal membrane" evidence=IEA
GO:0006641 "triglyceride metabolic process" evidence=IEA
GO:0008203 "cholesterol metabolic process" evidence=IEA
GO:0009060 "aerobic respiration" evidence=IEA
GO:0009650 "UV protection" evidence=IEA
GO:0014068 "positive regulation of phosphatidylinositol 3-kinase cascade" evidence=IEA
GO:0019899 "enzyme binding" evidence=IEA
GO:0020027 "hemoglobin metabolic process" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0032088 "negative regulation of NF-kappaB transcription factor activity" evidence=IEA
GO:0042744 "hydrogen peroxide catabolic process" evidence=IEA
GO:0042803 "protein homodimerization activity" evidence=IEA
GO:0043066 "negative regulation of apoptotic process" evidence=IEA
GO:0050661 "NADP binding" evidence=IEA
GO:0051092 "positive regulation of NF-kappaB transcription factor activity" evidence=IEA
GO:0051289 "protein homotetramerization" evidence=IEA
UNIPROTKB|Q64405 CAT "Catalase" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS9 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000210-20 cat "catalase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O62839 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P00432 CAT "Catalase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O97492 CAT "Catalase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:88271 Cat "catalase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2279 Cat "catalase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
FB|FBgn0000261 Cat "Catalase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P55306CATA_SCHPO1, ., 1, 1, ., 1, ., 60.62960.650.1015yesN/A
Q9Z598CATA_STRCO1, ., 1, 1, ., 1, ., 60.53160.950.1560yesN/A
Q64405CATA_CAVPO1, ., 1, 1, ., 1, ., 60.69131.00.1518yesN/A
Q5RF10CATA_PONAB1, ., 1, 1, ., 1, ., 60.61721.00.1518yesN/A
O97492CATA_CANFA1, ., 1, 1, ., 1, ., 60.65431.00.1518yesN/A
P24270CATA_MOUSE1, ., 1, 1, ., 1, ., 60.62961.00.1518yesN/A
P00432CATA_BOVIN1, ., 1, 1, ., 1, ., 60.65431.00.1518yesN/A
Q8CPD0CATA_STAES1, ., 1, 1, ., 1, ., 60.51420.80.1269yesN/A
Q8Y3P9CATA_LISMO1, ., 1, 1, ., 1, ., 60.5250.86250.1413yesN/A
O93662CATA_METBF1, ., 1, 1, ., 1, ., 60.51851.00.1584yesN/A
P17336CATA_DROME1, ., 1, 1, ., 1, ., 60.66261.00.1581yesN/A
Q5HPK8CATA_STAEQ1, ., 1, 1, ., 1, ., 60.51420.80.1269yesN/A
P04762CATA_RAT1, ., 1, 1, ., 1, ., 60.64191.00.1518yesN/A
O77229CATA_DICDI1, ., 1, 1, ., 1, ., 60.63851.00.1612yesN/A
Q2PUJ9CATA_STAEP1, ., 1, 1, ., 1, ., 60.51420.80.1269yesN/A
Q926X0CATA_LISIN1, ., 1, 1, ., 1, ., 60.51250.9750.1598yesN/A
Q59337CATA_DEIRA1, ., 1, 1, ., 1, ., 60.52110.81250.1212yesN/A
P04040CATA_HUMAN1, ., 1, 1, ., 1, ., 60.61721.00.1518yesN/A
O61235CATA2_CAEEL1, ., 1, 1, ., 1, ., 60.58751.00.1609yesN/A
O62839CATA_PIG1, ., 1, 1, ., 1, ., 60.66661.00.1518yesN/A
Q9PT92CATA_DANRE1, ., 1, 1, ., 1, ., 60.71601.00.1520yesN/A
Q2I6W4CATA_CALJA1, ., 1, 1, ., 1, ., 60.62961.00.1518yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
cd08156429 cd08156, catalase_clade_3, Clade 3 of the heme-bin 4e-39
smart01060373 smart01060, Catalase, Catalases are antioxidant en 2e-27
COG0753496 COG0753, KatE, Catalase [Inorganic ion transport a 3e-26
cd08154469 cd08154, catalase_clade_1, Clade 1 of the heme-bin 2e-25
pfam00199383 pfam00199, Catalase, Catalase 2e-24
cd08157451 cd08157, catalase_fungal, Fungal catalases similar 6e-24
cd00328433 cd00328, catalase, Catalase heme-binding enzyme 1e-21
PLN02609492 PLN02609, PLN02609, catalase 2e-20
cd08155443 cd08155, catalase_clade_2, Clade 2 of the heme-bin 9e-16
PRK11249 752 PRK11249, katE, hydroperoxidase II; Provisional 2e-12
>gnl|CDD|163712 cd08156, catalase_clade_3, Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information 
 Score =  133 bits (336), Expect = 4e-39
 Identities = 47/79 (59%), Positives = 48/79 (60%), Gaps = 2/79 (2%)

Query: 3   GRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAF-NNQGGAPNYFPNSFSGP 61
           GRLFSY D HR+RLG NY QLPVN P    V NYQRDG M    N GGAPNY PNSF GP
Sbjct: 286 GRLFSYADAHRYRLGVNYHQLPVNRPKC-PVNNYQRDGAMRVDGNGGGAPNYEPNSFGGP 344

Query: 62  QESERGRLSTFAVSGDVAR 80
            E          VSGD  R
Sbjct: 345 PEDPEYAEPPLPVSGDADR 363

Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 3 catalases are the most abundant subfamily and are found in all three kingdoms of life; they have a relatively small subunit size of 43 to 75 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. Clade 3 catalases also bind NADPH as a second redox-active cofactor. They form tetramers, and in eukaryotic cells, catalases are located in peroxisomes. Length = 429
>gnl|CDD|215003 smart01060, Catalase, Catalases are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects Back     alignment and domain information
>gnl|CDD|223824 COG0753, KatE, Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163710 cd08154, catalase_clade_1, Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|215783 pfam00199, Catalase, Catalase Back     alignment and domain information
>gnl|CDD|163713 cd08157, catalase_fungal, Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>gnl|CDD|163705 cd00328, catalase, Catalase heme-binding enzyme Back     alignment and domain information
>gnl|CDD|215328 PLN02609, PLN02609, catalase Back     alignment and domain information
>gnl|CDD|163711 cd08155, catalase_clade_2, Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|236886 PRK11249, katE, hydroperoxidase II; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 80
COG0753496 KatE Catalase [Inorganic ion transport and metabol 99.96
cd08156429 catalase_clade_3 Clade 3 of the heme-binding enzym 99.96
cd08154469 catalase_clade_1 Clade 1 of the heme-binding enzym 99.96
KOG0047|consensus505 99.95
PLN02609492 catalase 99.95
cd08155443 catalase_clade_2 Clade 2 of the heme-binding enzym 99.95
cd00328433 catalase Catalase heme-binding enzyme. Catalase is 99.93
PRK11249 752 katE hydroperoxidase II; Provisional 99.93
cd08157451 catalase_fungal Fungal catalases similar to yeast 99.92
PF00199384 Catalase: Catalase; InterPro: IPR011614 Catalases 99.85
>COG0753 KatE Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information 
Probab=99.96  E-value=2.2e-30  Score=205.07  Aligned_cols=78  Identities=49%  Similarity=0.700  Sum_probs=67.3

Q ss_pred             CCccCCCchHHHhhccCCCCCCCCCCCCCcccccccccCCcccccCCCCCCcccCCCCCCC---ccCCCCcCCccccCce
Q psy2585           1 MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSGP---QESERGRLSTFAVSGD   77 (80)
Q Consensus         1 LQgRlFsY~DtqryRlG~N~~qlPVN~P~~~~v~n~~rDG~m~~~~~~~~~nY~Pns~~~~---~~~~~~~~~~~~~~G~   77 (80)
                      ||||+|||+||||||||+||+|||||||+|+ |++|||||.|++....+.++|+||+++..   .+.+.+..++.+++|+
T Consensus       340 LQgRlFsY~DtqryRlG~N~~qlPvN~P~~p-~~~~qrDG~m~~~~~~g~~~y~Pn~~~~~~~~~~~~~~~~~~~~~~g~  418 (496)
T COG0753         340 LQGRLFSYGDTQRYRLGPNYHQIPVNRPKCP-VHNNQRDGQMRMGINTGPANYEPNSFGDNPEAPEQPGFVEPPERVEGD  418 (496)
T ss_pred             hhhccccchhhhHhhcCCCcccccCCCCCCc-ccccccCCccccccCCCCcccCccccccCccccccccccCCceeeccc
Confidence            8999999999999999999999999999996 99999999999884444599999999753   3345577788888887


Q ss_pred             ec
Q psy2585          78 VA   79 (80)
Q Consensus        78 ~~   79 (80)
                      +.
T Consensus       419 ~~  420 (496)
T COG0753         419 KQ  420 (496)
T ss_pred             hh
Confidence            64

>cd08156 catalase_clade_3 Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information
>cd08154 catalase_clade_1 Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>KOG0047|consensus Back     alignment and domain information
>PLN02609 catalase Back     alignment and domain information
>cd08155 catalase_clade_2 Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>cd00328 catalase Catalase heme-binding enzyme Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd08157 catalase_fungal Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>PF00199 Catalase: Catalase; InterPro: IPR011614 Catalases (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
3nwl_A527 The Crystal Structure Of The P212121 Form Of Bovine 5e-27
7cat_A506 The Nadph Binding Site On Beef Liver Catalase Lengt 6e-27
3rgp_A499 Structural And Kinetic Analysis Of The Beef Liver C 7e-27
1qqw_A527 Crystal Structure Of Human Erythrocyte Catalase Len 3e-26
1dgg_A497 Human Erythrocyte Catalse Cyanide Complex Length = 4e-26
1dgh_A498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 4e-26
1dgh_B498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 4e-26
2j2m_A491 Crystal Structure Analysis Of Catalase From Exiguob 6e-17
1si8_A484 Crystal Structure Of E. Faecalis Catalase Length = 8e-15
2xq1_A509 Crystal Structure Of Peroxisomal Catalase From The 3e-14
1a4e_A488 Catalase A From Saccharomyces Cerevisiae Length = 4 3e-12
1qwl_A505 Structure Of Helicobacter Pylori Catalase Length = 8e-11
2a9e_A505 Helicobacter Pylori Catalase Compound I Length = 50 5e-10
1m85_A484 Structure Of Proteus Mirabilis Catalase For The Nat 2e-09
1e93_A484 High Resolution Structure And Biochemical Propertie 2e-09
1h7k_A483 Formation Of A Tyrosyl Radical Intermediate In Prot 2e-09
1h6n_A484 Formation Of A Tyrosyl Radical Intermediate In Prot 2e-09
3hb6_A484 Inactive Mutant H54f Of Proteus Mirabilis Catalase 2e-09
1sy7_A 715 Crystal Structure Of The Catalase-1 From Neurospora 3e-08
1m7s_A484 Crystal Structure Analysis Of Catalase Catf Of Pseu 9e-07
2isa_A483 Crystal Structure Of Vibrio Salmonicida Catalase Le 3e-06
1qws_A 753 Structure Of The D181n Variant Of Catalase Hpii Fro 4e-06
1p81_A 753 Crystal Structure Of The D181e Variant Of Catalase 4e-06
3p9p_A 753 Structure Of I274v Variant Of E. Coli Kate Length = 4e-06
1iph_A 753 Structure Of Catalase Hpii From Escherichia Coli Le 4e-06
1p80_A 753 Crystal Structure Of The D181q Variant Of Catalase 4e-06
4ens_A 753 Structure Of E530q Variant Of E. Coli Kate Length = 4e-06
1cf9_A 753 Structure Of The Mutant Val169cys Of Catalase Hpii 4e-06
1p7y_A 753 Crystal Structure Of The D181a Variant Of Catalase 4e-06
1ggh_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-06
4env_A 753 Structure Of The S234i Variant Of E. Coli Kate Leng 4e-06
1qf7_A 753 Structure Of The Mutant His392gln Of Catalase Hpii 4e-06
1p7z_A 753 Crystal Structure Of The D181s Variant Of Catalase 4e-06
1ggj_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-06
4enp_A 753 Structure Of E530a Variant E. Coli Kate Length = 75 4e-06
4enq_A 753 Structure Of E530d Variant E. Coli Kate Length = 75 4e-06
3p9s_A 753 Structure Of I274a Variant Of E. Coli Kate Length = 4e-06
3p9r_A 753 Structure Of I274g Variant Of E. Coli Kate Length = 4e-06
4enr_A 753 Structure Of E530i Variant E. Coli Kate Length = 75 4e-06
1ggk_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-06
4enu_A 753 Structure Of The S234d Variant Of E. Coli Kate Leng 4e-06
4ent_A 753 Structure Of The S234a Variant Of E. Coli Kate Leng 4e-06
1gg9_A 753 Crystal Structure Of Catalase Hpii From Escherichia 4e-06
4enw_A 753 Structure Of The S234n Variant Of E. Coli Kate Leng 4e-06
3p9q_A 753 Structure Of I274c Variant Of E. Coli Kate Length = 4e-06
3ttt_A 753 Structure Of F413y Variant Of E. Coli Kate Length = 9e-06
3ttv_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 9e-06
3ttu_A 753 Structure Of F413y/h128n Double Variant Of E. Coli 9e-06
1ye9_E259 Crystal Structure Of Proteolytically Truncated Cata 9e-06
1hbz_A498 Catalase From Micrococcus Lysodeikticu Length = 498 2e-05
1gwh_A503 Atomic Resolution Structure Of Micrococcus Lysodeik 2e-05
3ttw_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 4e-05
3ttx_A 753 Structure Of The F413k Variant Of E. Coli Kate Leng 4e-05
1gwf_A503 Compound Ii Structure Of Micrococcus Lysodeikticus 1e-04
3ej6_A 688 Neurospora Crassa Catalase-3 Crystal Structure Leng 2e-04
2iuf_A 688 The Structures Of Penicillium Vitale Catalase: Rest 3e-04
2xf2_A 688 Pvc-At Length = 688 3e-04
>pdb|3NWL|A Chain A, The Crystal Structure Of The P212121 Form Of Bovine Liver Catalase Previously Characterized By Electron Microscopy Length = 527 Back     alignment and structure 
Iteration: 1

 Score =  115 bits (289), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 62/81 (76%), Gaps = 1/81 (1%)
Query: 1   MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMA-FNNQGGAPNYFPNSFS 59
           ++GRLF+YPDTHRHRLGPNYLQ+PVNCP+  +VANYQRDGPM   +NQGGAPNY+PNSFS
Sbjct: 351 LQGRLFAYPDTHRHRLGPNYLQIPVNCPYRARVANYQRDGPMCMMDNQGGAPNYYPNSFS 410
Query: 60  GPQESERGRLSTFAVSGDVAR 80
            P+            SGDV R
Sbjct: 411 APEHQPSALEHRTHFSGDVQR 431
>pdb|7CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase Length = 506 Back     alignment and structure
>pdb|3RGP|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase Complexed With Nitric Oxide Length = 499 Back     alignment and structure
>pdb|1QQW|A Chain A, Crystal Structure Of Human Erythrocyte Catalase Length = 527 Back     alignment and structure
>pdb|1DGG|A Chain A, Human Erythrocyte Catalse Cyanide Complex Length = 497 Back     alignment and structure
>pdb|1DGH|A Chain A, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|1DGH|B Chain B, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|2J2M|A Chain A, Crystal Structure Analysis Of Catalase From Exiguobacterium Oxidotolerans Length = 491 Back     alignment and structure
>pdb|1SI8|A Chain A, Crystal Structure Of E. Faecalis Catalase Length = 484 Back     alignment and structure
>pdb|2XQ1|A Chain A, Crystal Structure Of Peroxisomal Catalase From The Yeast Hansenula Polymorpha Length = 509 Back     alignment and structure
>pdb|1A4E|A Chain A, Catalase A From Saccharomyces Cerevisiae Length = 488 Back     alignment and structure
>pdb|1QWL|A Chain A, Structure Of Helicobacter Pylori Catalase Length = 505 Back     alignment and structure
>pdb|2A9E|A Chain A, Helicobacter Pylori Catalase Compound I Length = 505 Back     alignment and structure
>pdb|1M85|A Chain A, Structure Of Proteus Mirabilis Catalase For The Native Form Length = 484 Back     alignment and structure
>pdb|1E93|A Chain A, High Resolution Structure And Biochemical Properties Of A Recombinant Catalase Depleted In Iron Length = 484 Back     alignment and structure
>pdb|1H7K|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 483 Back     alignment and structure
>pdb|1H6N|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 484 Back     alignment and structure
>pdb|3HB6|A Chain A, Inactive Mutant H54f Of Proteus Mirabilis Catalase Length = 484 Back     alignment and structure
>pdb|1SY7|A Chain A, Crystal Structure Of The Catalase-1 From Neurospora Crassa, Native Structure At 1.75a Resolution. Length = 715 Back     alignment and structure
>pdb|1M7S|A Chain A, Crystal Structure Analysis Of Catalase Catf Of Pseudomonas Syringae Length = 484 Back     alignment and structure
>pdb|2ISA|A Chain A, Crystal Structure Of Vibrio Salmonicida Catalase Length = 483 Back     alignment and structure
>pdb|1QWS|A Chain A, Structure Of The D181n Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P81|A Chain A, Crystal Structure Of The D181e Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|3P9P|A Chain A, Structure Of I274v Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1IPH|A Chain A, Structure Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|1P80|A Chain A, Crystal Structure Of The D181q Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|4ENS|A Chain A, Structure Of E530q Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1CF9|A Chain A, Structure Of The Mutant Val169cys Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|1P7Y|A Chain A, Crystal Structure Of The D181a Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1GGH|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128ala Variant. Length = 753 Back     alignment and structure
>pdb|4ENV|A Chain A, Structure Of The S234i Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1QF7|A Chain A, Structure Of The Mutant His392gln Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P7Z|A Chain A, Crystal Structure Of The D181s Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1GGJ|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201ala Variant. Length = 753 Back     alignment and structure
>pdb|4ENP|A Chain A, Structure Of E530a Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENQ|A Chain A, Structure Of E530d Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9S|A Chain A, Structure Of I274a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9R|A Chain A, Structure Of I274g Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENR|A Chain A, Structure Of E530i Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGK|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201his Variant. Length = 753 Back     alignment and structure
>pdb|4ENU|A Chain A, Structure Of The S234d Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENT|A Chain A, Structure Of The S234a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GG9|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128asn Variant. Length = 753 Back     alignment and structure
>pdb|4ENW|A Chain A, Structure Of The S234n Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9Q|A Chain A, Structure Of I274c Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTT|A Chain A, Structure Of F413y Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTV|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTU|A Chain A, Structure Of F413y/h128n Double Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1YE9|E Chain E, Crystal Structure Of Proteolytically Truncated Catalase Hpii From E. Coli Length = 259 Back     alignment and structure
>pdb|1HBZ|A Chain A, Catalase From Micrococcus Lysodeikticu Length = 498 Back     alignment and structure
>pdb|1GWH|A Chain A, Atomic Resolution Structure Of Micrococcus Lysodeikticus Catalase Complexed With Nadph Length = 503 Back     alignment and structure
>pdb|3TTW|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTX|A Chain A, Structure Of The F413k Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GWF|A Chain A, Compound Ii Structure Of Micrococcus Lysodeikticus Catalase Length = 503 Back     alignment and structure
>pdb|3EJ6|A Chain A, Neurospora Crassa Catalase-3 Crystal Structure Length = 688 Back     alignment and structure
>pdb|2IUF|A Chain A, The Structures Of Penicillium Vitale Catalase: Resting State, Oxidised State (Compound I) And Complex With Aminotriazole Length = 688 Back     alignment and structure
>pdb|2XF2|A Chain A, Pvc-At Length = 688 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query80
1dgf_A497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 3e-40
1m7s_A484 Catalase; beta barrel, alpha helical domain, oxido 3e-39
2isa_A483 Catalase; peroxidase, heme, oxidoreductase, iron, 2e-38
1si8_A484 Catalase; N-terminal ARM, anti-parallel beta-barre 3e-38
1qwl_A505 KATA catalase; beta barrel, azide complex, oxyferr 1e-37
2j2m_A491 Catalase; functional class, oxidoreductase; HET: H 3e-37
1gwe_A503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 4e-37
1a4e_A488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 7e-35
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 1e-32
2xq1_A509 Peroxisomal catalase; oxidoreductase, hydrogen per 1e-32
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 2e-30
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 2e-29
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 5e-23
1u5u_A374 Allene oxide synthase-lipoxygenase protein; catala 2e-11
3e4w_A320 Putative uncharacterized protein; heme enzyme, cat 1e-08
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Length = 497 Back     alignment and structure
 Score =  136 bits (345), Expect = 3e-40
 Identities = 50/79 (63%), Positives = 59/79 (74%), Gaps = 1/79 (1%)

Query: 3   GRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFN-NQGGAPNYFPNSFSGP 61
           GRLF+YPDTHRHRLGPNYL +PVNCP+  +VANYQRDGPM    NQGGAPNY+PNSF  P
Sbjct: 349 GRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAP 408

Query: 62  QESERGRLSTFAVSGDVAR 80
           ++       +   SG+V R
Sbjct: 409 EQQPSALEHSIQYSGEVRR 427
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Length = 483 Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Length = 505 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Length = 491 Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Length = 503 Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Length = 488 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Length = 715 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Length = 509 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Length = 753 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Length = 688 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Length = 688 Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Length = 374 Back     alignment and structure
>3e4w_A Putative uncharacterized protein; heme enzyme, catalase, peroxidase, oxidoreductase; HET: HEM; 1.80A {Mycobacterium avium subsp} PDB: 3e4y_A* Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
1m7s_A484 Catalase; beta barrel, alpha helical domain, oxido 99.95
1si8_A484 Catalase; N-terminal ARM, anti-parallel beta-barre 99.94
2isa_A483 Catalase; peroxidase, heme, oxidoreductase, iron, 99.94
1gwe_A503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 99.94
1dgf_A497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 99.94
2j2m_A491 Catalase; functional class, oxidoreductase; HET: H 99.94
1qwl_A505 KATA catalase; beta barrel, azide complex, oxyferr 99.94
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 99.93
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 99.93
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 99.92
1a4e_A488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 99.92
2xq1_A509 Peroxisomal catalase; oxidoreductase, hydrogen per 99.91
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 99.9
1u5u_A374 Allene oxide synthase-lipoxygenase protein; catala 98.12
3e4w_A320 Putative uncharacterized protein; heme enzyme, cat 97.59
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Back     alignment and structure
Probab=99.95  E-value=3.8e-29  Score=197.28  Aligned_cols=78  Identities=36%  Similarity=0.591  Sum_probs=72.5

Q ss_pred             CCccCCCchHHHhhccCCCCCCCCCCCCCcccccccccCCcccccCCCCCCcccCCCCCCCccCCCCcCCccccCceec
Q psy2585           1 MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFNNQGGAPNYFPNSFSGPQESERGRLSTFAVSGDVA   79 (80)
Q Consensus         1 LQgRlFsY~DtqryRlG~N~~qlPVN~P~~~~v~n~~rDG~m~~~~~~~~~nY~Pns~~~~~~~~~~~~~~~~~~G~~~   79 (80)
                      ||+|+|||+||||||||+||+|||||||+|+ |+||+|||+|++++.++.+||+|||++++.+.+.+.++++.++|.+.
T Consensus       325 Lq~R~fsY~ds~r~Rlg~N~~qlPvN~P~~~-~~~~~rdG~m~~~~~~~~~~y~pn~~~~~~~~~~~~~~~~~~~g~~~  402 (484)
T 1m7s_A          325 LQGRVFSYADTQMYRLGANGLSLPVNQPKVA-VNNGNQDGALNTGHTTSGVNYEPSRLEPRPADDKARYSELPLSGTTQ  402 (484)
T ss_dssp             HHHHHHHHHHHHHHHTCTTGGGSGGGCCSSC-CCSSCCCCTTCCCCCCCSCCSSSCSSSCCCCCGGGCCCCCBCCSBEE
T ss_pred             HHHHHHHHHHHHHHhhcCCcccCCCCCCCCc-ccCccccCcccccCCCCCCCcCCCcCCCCCCCCCCCCCCeeccccee
Confidence            7999999999999999999999999999996 99999999999987788999999999988888888888889998754
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Back     alignment and structure
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Back     alignment and structure
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Back     alignment and structure
>3e4w_A Putative uncharacterized protein; heme enzyme, catalase, peroxidase, oxidoreductase; HET: HEM; 1.80A {Mycobacterium avium subsp} PDB: 3e4y_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 80
d1dgfa_497 e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [Tax 9e-29
d1si8a_474 e.5.1.1 (A:) Catalase I {Enterococcus faecalis [Ta 7e-27
d1m7sa_484 e.5.1.1 (A:) Catalase I {Pseudomonas syringae [Tax 7e-26
d1qwla_491 e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxI 3e-25
d1e93a_476 e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 4e-25
d1gwea_498 e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus 2e-24
d1a4ea_488 e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomy 8e-23
d1p80a2 571 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, 3e-22
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase I
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  104 bits (260), Expect = 9e-29
 Identities = 50/81 (61%), Positives = 62/81 (76%), Gaps = 1/81 (1%)

Query: 1   MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAF-NNQGGAPNYFPNSFS 59
           ++GRLF+YPDTHRHRLGPNYL +PVNCP+  +VANYQRDGPM   +NQGGAPNY+PNSF 
Sbjct: 347 LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFG 406

Query: 60  GPQESERGRLSTFAVSGDVAR 80
            P++       +   SG+V R
Sbjct: 407 APEQQPSALEHSIQYSGEVRR 427
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Length = 474 Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Length = 484 Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Length = 491 Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Length = 476 Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Length = 498 Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 488 Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Length = 571 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query80
d1dgfa_497 Catalase I {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1e93a_476 Catalase I {Proteus mirabilis [TaxId: 584]} 99.96
d1qwla_491 Catalase I {Helicobacter pylori [TaxId: 210]} 99.96
d1m7sa_484 Catalase I {Pseudomonas syringae [TaxId: 317]} 99.96
d1gwea_498 Catalase I {Micrococcus lysodeikticus [TaxId: 1270 99.96
d1si8a_474 Catalase I {Enterococcus faecalis [TaxId: 1351]} 99.96
d1a4ea_488 Catalase I {Baker's yeast (Saccharomyces cerevisia 99.94
d1p80a2 571 Catalase II {Escherichia coli, HPII [TaxId: 562]} 99.93
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase I
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1.9e-31  Score=208.42  Aligned_cols=79  Identities=62%  Similarity=1.227  Sum_probs=74.0

Q ss_pred             CCccCCCchHHHhhccCCCCCCCCCCCCCcccccccccCCccccc-CCCCCCcccCCCCCCCccCCCCcCCccccCceec
Q psy2585           1 MKGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRDGPMAFN-NQGGAPNYFPNSFSGPQESERGRLSTFAVSGDVA   79 (80)
Q Consensus         1 LQgRlFsY~DtqryRlG~N~~qlPVN~P~~~~v~n~~rDG~m~~~-~~~~~~nY~Pns~~~~~~~~~~~~~~~~~~G~~~   79 (80)
                      ||+|+|||+||||||||+||+|||||||++++|+||+|||+|+++ |.++.|||+|||++++.+++.+.++++.++|.+.
T Consensus       347 Lq~R~~aY~dsqr~RlG~N~~qlPvN~P~~~~~~n~~rdG~m~~~~~~g~~~nY~pns~~~~~~~~~~~~~~~~~~g~~~  426 (497)
T d1dgfa_         347 LQGRLFAYPDTHRHRLGPNYLHIPVNCPYRARVANYQRDGPMCMQDNQGGAPNYYPNSFGAPEQQPSALEHSIQYSGEVR  426 (497)
T ss_dssp             HHHHHHHHHHHHHHHTCTTGGGSGGGSCTTSCCCSSCCCCTTCCSCTTTTCCCSSSCSSCCCBCCGGGCCCCEECCSEEE
T ss_pred             hhhhhhhhHHHHhhccCCChhhCCcCCCCcCCcCCcccCChhcccCCCCCCCCccCCCCCCcccCCCcCCCCceeeeEEE
Confidence            799999999999999999999999999985459999999999998 8999999999999999999999999999999764
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure