Psyllid ID: psy2586

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-----
MGCSSAHPINNSRKQQGTDTFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRVKK
ccccccccccEEEEEEccccccccccccccccccccccccccccEEcEEEEcccccccHHHHHHHHcccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccc
cccccccccEEEEEEEcccHHHHHccccccccccccccccccccEEEEEEEEEEccccHHHHccccccccccccccEEEcccHHHHHHHHHHHHHHHHHccccHHHcHHHccccccccccccccc
mgcssahpinnsrkqqgtdtfgyndkalpletgnkvwphrefplievgqlvldknpsnyfaeveqiafspshlvpgiepspdkmlqgrlfsypdthrhrlgpnylqlpvncpfatkvanyQRVKK
mgcssahpinnsrkqqgtdtFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPDTHRHRLGPnylqlpvncpfatkvanyqrvkk
MGCSSAHPINNSRKQQGTDTFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRVKK
********************FGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVP*********LQGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANY*****
****SAH*INNSRKQQGTDTFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFATKV********
**********NSRKQQGTDTFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRVKK
**CSSAHPINNSRKQQGTDTFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFATK*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGCSSAHPINNSRKQQGTDTFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQRVKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query125 2.2.26 [Sep-21-2011]
Q64405 527 Catalase OS=Cavia porcell yes N/A 0.704 0.166 0.795 1e-39
Q9PWF7 528 Catalase OS=Glandirana ru N/A N/A 0.704 0.166 0.795 2e-39
P24270 527 Catalase OS=Mus musculus yes N/A 0.704 0.166 0.795 3e-39
P04762 527 Catalase OS=Rattus norveg yes N/A 0.704 0.166 0.784 3e-39
O97492 527 Catalase OS=Canis familia yes N/A 0.704 0.166 0.784 5e-39
Q9PT92 526 Catalase OS=Danio rerio G yes N/A 0.704 0.167 0.806 7e-39
P17336 506 Catalase OS=Drosophila me yes N/A 0.704 0.173 0.772 9e-39
Q2I6W4 527 Catalase OS=Callithrix ja yes N/A 0.704 0.166 0.784 9e-39
P00432 527 Catalase OS=Bos taurus GN yes N/A 0.704 0.166 0.784 2e-38
O62839 527 Catalase OS=Sus scrofa GN yes N/A 0.704 0.166 0.795 2e-38
>sp|Q64405|CATA_CAVPO Catalase OS=Cavia porcellus GN=CAT PE=2 SV=4 Back     alignment and function desciption
 Score =  161 bits (408), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 70/88 (79%), Positives = 83/88 (94%)

Query: 35  KVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPD 94
           K+WPH+++PLI VG+LVL++NP NYFAEVEQIAF PS++ PGIEPSPDKMLQGRLF+YPD
Sbjct: 301 KIWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEPSPDKMLQGRLFAYPD 360

Query: 95  THRHRLGPNYLQLPVNCPFATKVANYQR 122
           THRHRLGPNYLQ+PVNCP+ T+VANYQR
Sbjct: 361 THRHRLGPNYLQIPVNCPYRTRVANYQR 388
Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells.
Cavia porcellus (taxid: 10141)
EC: 1EC: .EC: 1EC: 1EC: .EC: 1EC: .EC: 6
>sp|Q9PWF7|CATA_GLARU Catalase OS=Glandirana rugosa GN=cat PE=2 SV=3 Back     alignment and function description
>sp|P24270|CATA_MOUSE Catalase OS=Mus musculus GN=Cat PE=1 SV=4 Back     alignment and function description
>sp|P04762|CATA_RAT Catalase OS=Rattus norvegicus GN=Cat PE=1 SV=3 Back     alignment and function description
>sp|O97492|CATA_CANFA Catalase OS=Canis familiaris GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|Q9PT92|CATA_DANRE Catalase OS=Danio rerio GN=cat PE=2 SV=1 Back     alignment and function description
>sp|P17336|CATA_DROME Catalase OS=Drosophila melanogaster GN=Cat PE=1 SV=2 Back     alignment and function description
>sp|Q2I6W4|CATA_CALJA Catalase OS=Callithrix jacchus GN=CAT PE=2 SV=3 Back     alignment and function description
>sp|P00432|CATA_BOVIN Catalase OS=Bos taurus GN=CAT PE=1 SV=3 Back     alignment and function description
>sp|O62839|CATA_PIG Catalase OS=Sus scrofa GN=CAT PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
359843258 521 catalase, partial [Schistocerca gregaria 0.704 0.168 0.840 5e-40
195022939 506 GH14374 [Drosophila grimshawi] gi|193899 0.704 0.173 0.840 1e-39
284159653 251 catalase [Chaoborus astictopus] 0.712 0.354 0.842 2e-39
409690331 508 catalase [Reticulitermes flavipes] 0.704 0.173 0.818 2e-39
194751781 506 GF23641 [Drosophila ananassae] gi|190625 0.704 0.173 0.818 2e-39
242014048 491 Catalase, putative [Pediculus humanus co 0.704 0.179 0.852 2e-39
125978909 506 GA19920 [Drosophila pseudoobscura pseudo 0.704 0.173 0.840 2e-39
195129721 506 GI11318 [Drosophila mojavensis] gi|19392 0.704 0.173 0.829 3e-39
289743347 505 putative catalase [Glossina morsitans mo 0.704 0.174 0.806 3e-39
195378516 506 GJ11574 [Drosophila virilis] gi|19415518 0.704 0.173 0.829 4e-39
>gi|359843258|gb|AEV89764.1| catalase, partial [Schistocerca gregaria] Back     alignment and taxonomy information
 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 83/88 (94%)

Query: 35  KVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPD 94
           KVWPH EFPLI VG++VL++NP NYFAEVEQIAFSP+H+VPGIEPSPDKMLQGRLFSY D
Sbjct: 314 KVWPHDEFPLIPVGKIVLNRNPKNYFAEVEQIAFSPAHMVPGIEPSPDKMLQGRLFSYSD 373

Query: 95  THRHRLGPNYLQLPVNCPFATKVANYQR 122
           THRHRLGPNYLQLPVNCP+ +K+ANYQR
Sbjct: 374 THRHRLGPNYLQLPVNCPYRSKIANYQR 401

Source: Schistocerca gregaria

Species: Schistocerca gregaria

Genus: Schistocerca

Family: Acrididae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195022939|ref|XP_001985666.1| GH14374 [Drosophila grimshawi] gi|193899148|gb|EDV98014.1| GH14374 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|284159653|gb|ADB80317.1| catalase [Chaoborus astictopus] Back     alignment and taxonomy information
>gi|409690331|gb|AFV36369.1| catalase [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|194751781|ref|XP_001958202.1| GF23641 [Drosophila ananassae] gi|190625484|gb|EDV41008.1| GF23641 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|242014048|ref|XP_002427710.1| Catalase, putative [Pediculus humanus corporis] gi|212512145|gb|EEB14972.1| Catalase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|125978909|ref|XP_001353487.1| GA19920 [Drosophila pseudoobscura pseudoobscura] gi|54642249|gb|EAL30998.1| GA19920 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195129721|ref|XP_002009303.1| GI11318 [Drosophila mojavensis] gi|193920912|gb|EDW19779.1| GI11318 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|289743347|gb|ADD20421.1| putative catalase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195378516|ref|XP_002048029.1| GJ11574 [Drosophila virilis] gi|194155187|gb|EDW70371.1| GJ11574 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query125
UNIPROTKB|Q64405 527 CAT "Catalase" [Cavia porcellu 0.816 0.193 0.691 1.3e-38
MGI|MGI:88271 527 Cat "catalase" [Mus musculus ( 0.792 0.187 0.711 1.6e-38
RGD|2279 527 Cat "catalase" [Rattus norvegi 0.792 0.187 0.701 1.6e-38
UNIPROTKB|O97492 527 CAT "Catalase" [Canis lupus fa 0.792 0.187 0.701 2.6e-38
UNIPROTKB|F1SGS9 527 CAT "Catalase" [Sus scrofa (ta 0.816 0.193 0.700 2.6e-38
UNIPROTKB|P00432 527 CAT "Catalase" [Bos taurus (ta 0.704 0.166 0.784 1.9e-37
ZFIN|ZDB-GENE-000210-20 526 cat "catalase" [Danio rerio (t 0.704 0.167 0.806 1.9e-37
UNIPROTKB|O62839 527 CAT "Catalase" [Sus scrofa (ta 0.816 0.193 0.691 2.4e-37
FB|FBgn0000261 506 Cat "Catalase" [Drosophila mel 0.776 0.191 0.705 3e-37
UNIPROTKB|P04040 527 CAT "Catalase" [Homo sapiens ( 0.792 0.187 0.692 3.9e-37
UNIPROTKB|Q64405 CAT "Catalase" [Cavia porcellus (taxid:10141)] Back     alignment and assigned GO terms
 Score = 413 (150.4 bits), Expect = 1.3e-38, P = 1.3e-38
 Identities = 74/107 (69%), Positives = 90/107 (84%)

Query:    16 QGTDTFGYNDKALPLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVP 75
             Q   +F +N    P +   K+WPH+++PLI VG+LVL++NP NYFAEVEQIAF PS++ P
Sbjct:   287 QQAQSFPFN----PFDL-TKIWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPP 341

Query:    76 GIEPSPDKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFATKVANYQR 122
             GIEPSPDKMLQGRLF+YPDTHRHRLGPNYLQ+PVNCP+ T+VANYQR
Sbjct:   342 GIEPSPDKMLQGRLFAYPDTHRHRLGPNYLQIPVNCPYRTRVANYQR 388
GO:0005778 "peroxisomal membrane" evidence=IDA
GO:0019166 "trans-2-enoyl-CoA reductase (NADPH) activity" evidence=IDA
MGI|MGI:88271 Cat "catalase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2279 Cat "catalase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O97492 CAT "Catalase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SGS9 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P00432 CAT "Catalase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000210-20 cat "catalase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|O62839 CAT "Catalase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0000261 Cat "Catalase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P04040 CAT "Catalase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O52762CATA_PSEAE1, ., 1, 1, ., 1, ., 60.67900.6240.1618yesN/A
P30265CATA_LACSK1, ., 1, 1, ., 1, ., 60.60220.6960.1820yesN/A
P55306CATA_SCHPO1, ., 1, 1, ., 1, ., 60.60220.6960.1699yesN/A
Q9Z598CATA_STRCO1, ., 1, 1, ., 1, ., 60.66660.7040.1806yesN/A
Q59714CATA_PSEPU1, ., 1, 1, ., 1, ., 60.60220.6960.1816yesN/A
P42321CATA_PROMI1, ., 1, 1, ., 1, ., 60.61530.6720.1735yesN/A
Q6G9M4CATA_STAAS1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
Q64405CATA_CAVPO1, ., 1, 1, ., 1, ., 60.79540.7040.1669yesN/A
Q7A5T2CATA_STAAN1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
P0A323CATA_BORPE1, ., 1, 1, ., 1, ., 60.71950.6320.1639yesN/A
P0A324CATA_BORBR1, ., 1, 1, ., 1, ., 60.71950.6320.1639yesN/A
P0A325CATA_BORPA1, ., 1, 1, ., 1, ., 60.71950.6320.1639yesN/A
P26901CATA_BACSU1, ., 1, 1, ., 1, ., 60.58090.7520.1946yesN/A
Q5HG86CATA_STAAC1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
Q5RF10CATA_PONAB1, ., 1, 1, ., 1, ., 60.77270.7040.1669yesN/A
Q6GH72CATA_STAAR1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
O97492CATA_CANFA1, ., 1, 1, ., 1, ., 60.78400.7040.1669yesN/A
P24270CATA_MOUSE1, ., 1, 1, ., 1, ., 60.79540.7040.1669yesN/A
P00432CATA_BOVIN1, ., 1, 1, ., 1, ., 60.78400.7040.1669yesN/A
Q8CPD0CATA_STAES1, ., 1, 1, ., 1, ., 60.58820.680.1686yesN/A
Q27487CATA1_CAEEL1, ., 1, 1, ., 1, ., 60.72720.7040.176yesN/A
Q2FYU7CATA_STAA81, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
P15202CATA_YEAST1, ., 1, 1, ., 1, ., 60.57290.7520.1825yesN/A
O93662CATA_METBF1, ., 1, 1, ., 1, ., 60.67040.7040.1742yesN/A
Q9L4S1CATA_STAAU1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
P17336CATA_DROME1, ., 1, 1, ., 1, ., 60.77270.7040.1739yesN/A
O68146CATA_VIBF11, ., 1, 1, ., 1, ., 60.64100.6240.1618yesN/A
P04762CATA_RAT1, ., 1, 1, ., 1, ., 60.78400.7040.1669yesN/A
O77229CATA_DICDI1, ., 1, 1, ., 1, ., 60.76660.7040.1774yesN/A
Q99UE2CATA_STAAM1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
Q8NWV5CATA_STAAW1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
P04040CATA_HUMAN1, ., 1, 1, ., 1, ., 60.77270.7040.1669yesN/A
P77872CATA_HELPY1, ., 1, 1, ., 1, ., 60.67070.6320.1564yesN/A
Q2YXT2CATA_STAAB1, ., 1, 1, ., 1, ., 60.58820.680.1683yesN/A
Q9ZKX5CATA_HELPJ1, ., 1, 1, ., 1, ., 60.65060.640.1584yesN/A
Q2I6W4CATA_CALJA1, ., 1, 1, ., 1, ., 60.78400.7040.1669yesN/A
Q9PT92CATA_DANRE1, ., 1, 1, ., 1, ., 60.80680.7040.1673yesN/A
O62839CATA_PIG1, ., 1, 1, ., 1, ., 60.79540.7040.1669yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.11.1.6LOW CONFIDENCE prediction!
3rd Layer1.11.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
cd08156 429 cd08156, catalase_clade_3, Clade 3 of the heme-bin 2e-63
smart01060373 smart01060, Catalase, Catalases are antioxidant en 2e-62
pfam00199383 pfam00199, Catalase, Catalase 1e-52
cd08157 451 cd08157, catalase_fungal, Fungal catalases similar 1e-52
COG0753 496 COG0753, KatE, Catalase [Inorganic ion transport a 5e-49
cd08154 469 cd08154, catalase_clade_1, Clade 1 of the heme-bin 3e-48
cd00328 433 cd00328, catalase, Catalase heme-binding enzyme 9e-46
PLN02609 492 PLN02609, PLN02609, catalase 4e-43
cd08155 443 cd08155, catalase_clade_2, Clade 2 of the heme-bin 4e-33
PRK11249 752 PRK11249, katE, hydroperoxidase II; Provisional 6e-29
cd08153295 cd08153, srpA_like, Catalase-like heme-binding pro 2e-07
cd08150283 cd08150, catalase_like, Catalase-like heme-binding 2e-07
>gnl|CDD|163712 cd08156, catalase_clade_3, Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information 
 Score =  198 bits (506), Expect = 2e-63
 Identities = 65/88 (73%), Positives = 73/88 (82%), Gaps = 1/88 (1%)

Query: 35  KVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPD 94
           KVWPH+++PLIEVG+L L++NP NYFAEVEQ AFSPS+LVPGI  SPDKMLQGRLFSY D
Sbjct: 234 KVWPHKDYPLIEVGKLELNRNPENYFAEVEQAAFSPSNLVPGIGFSPDKMLQGRLFSYAD 293

Query: 95  THRHRLGPNYLQLPVNCPFATKVANYQR 122
            HR+RLG NY QLPVN P    V NYQR
Sbjct: 294 AHRYRLGVNYHQLPVNRPKC-PVNNYQR 320

Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 3 catalases are the most abundant subfamily and are found in all three kingdoms of life; they have a relatively small subunit size of 43 to 75 kDa, and bind a protoheme IX (heme b) group buried deep inside the structure. Clade 3 catalases also bind NADPH as a second redox-active cofactor. They form tetramers, and in eukaryotic cells, catalases are located in peroxisomes. Length = 429
>gnl|CDD|215003 smart01060, Catalase, Catalases are antioxidant enzymes that catalyse the conversion of hydrogen peroxide to water and molecular oxygen, serving to protect cells from its toxic effects Back     alignment and domain information
>gnl|CDD|215783 pfam00199, Catalase, Catalase Back     alignment and domain information
>gnl|CDD|163713 cd08157, catalase_fungal, Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>gnl|CDD|223824 COG0753, KatE, Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|163710 cd08154, catalase_clade_1, Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|163705 cd00328, catalase, Catalase heme-binding enzyme Back     alignment and domain information
>gnl|CDD|215328 PLN02609, PLN02609, catalase Back     alignment and domain information
>gnl|CDD|163711 cd08155, catalase_clade_2, Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information
>gnl|CDD|236886 PRK11249, katE, hydroperoxidase II; Provisional Back     alignment and domain information
>gnl|CDD|163709 cd08153, srpA_like, Catalase-like heme-binding proteins similar to the uncharacterized srpA Back     alignment and domain information
>gnl|CDD|163706 cd08150, catalase_like, Catalase-like heme-binding proteins and protein domains Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 125
cd08155 443 catalase_clade_2 Clade 2 of the heme-binding enzym 100.0
cd00328 433 catalase Catalase heme-binding enzyme. Catalase is 100.0
cd08156 429 catalase_clade_3 Clade 3 of the heme-binding enzym 100.0
PLN02609 492 catalase 100.0
cd08154 469 catalase_clade_1 Clade 1 of the heme-binding enzym 100.0
COG0753 496 KatE Catalase [Inorganic ion transport and metabol 100.0
KOG0047|consensus 505 100.0
PRK11249 752 katE hydroperoxidase II; Provisional 100.0
cd08157 451 catalase_fungal Fungal catalases similar to yeast 100.0
PF00199384 Catalase: Catalase; InterPro: IPR011614 Catalases 100.0
cd08153295 srpA_like Catalase-like heme-binding proteins simi 99.91
cd08150283 catalase_like Catalase-like heme-binding proteins 99.86
cd08151328 AOS Allene oxide synthase. Allene oxide synthase c 99.84
cd08152305 y4iL_like Catalase-like heme-binding proteins simi 99.82
>cd08155 catalase_clade_2 Clade 2 of the heme-binding enzyme catalase Back     alignment and domain information 
Probab=100.00  E-value=3.6e-41  Score=290.79  Aligned_cols=110  Identities=45%  Similarity=0.777  Sum_probs=105.6

Q ss_pred             cccccCc-ceeecC----CCCCC------CCCCccccCCCCcCcEEeEEEEEccCCCCchhhhhhhhcCCCccCCCcCCC
Q psy2586          12 SRKQQGT-DTFGYN----DKALP------LETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPS   80 (125)
Q Consensus        12 ~r~~~gp-~~f~~~----~~gD~------i~DpTk~WP~d~r~~v~lG~LtLnrn~~n~~~e~eqi~FdP~~lv~GIe~S   80 (125)
                      .|+++|+ .+|++.    .+||.      ++|+||+||+++||+|++|+||||+|++|+|++|||++|+|++||+||++|
T Consensus       207 ~~I~~G~~p~w~l~vQv~~~~d~~~~~f~~~D~Tk~WP~~~~p~i~~G~l~Ln~np~n~f~e~eq~aF~P~~lvpGI~~S  286 (443)
T cd08155         207 EAIESGDYPEWELGVQLIDEEDEFKFDFDILDPTKLIPEELVPVQRVGKMVLNRNPDNFFAETEQVAFCPANVVPGIDFS  286 (443)
T ss_pred             HHHhcCCCceEEEEEEEcCHHHHhcCCCCCCcCCCcCCccccceEEeEEEEEecCCcchhhhhhhhcccCcCCCCCccCC
Confidence            4788999 999988    68998      999999999998999999999999999999999999999999999999999


Q ss_pred             CCcccccccccchhhhhhcc-CCCCcccCCCCCCCccccccee
Q psy2586          81 PDKMLQGRLFSYPDTHRHRL-GPNYLQLPVNCPFATKVANYQR  122 (125)
Q Consensus        81 dDPlLq~R~~aYadS~~~Rl-g~n~~~lpvn~p~~~~~~~~~r  122 (125)
                      +|||||+|+|||+|||+||+ |+||+|||||||+++ |+||+|
T Consensus       287 ~DpmLq~R~faY~ds~r~RlgG~N~~qlPvN~P~~~-v~n~~r  328 (443)
T cd08155         287 NDPLLQGRLFSYLDTQLSRLGGPNFHELPINRPVCP-VHNNQR  328 (443)
T ss_pred             CCcccccccccchHhhhccCCCCChhhCccccccCC-cCCCCc
Confidence            99999999999999999999 799999999999987 999987

Catalase is a ubiquitous enzyme found in both prokaryotes and eukaryotes, which is involved in the protection of cells from the toxic effects of peroxides. It catalyzes the conversion of hydrogen peroxide to water and molecular oxygen. Catalases also utilize hydrogen peroxide to oxidize various substrates such as alcohol or phenols. Clade 2 catalases are mostly found in bacteria and fungi; they have a large subunit size of 75 to 84 kDa, and bind a heme d group buried deep inside the structure. They appear to form tetramers. In eukaryotic cells, catalases are located in peroxisomes.
>cd00328 catalase Catalase heme-binding enzyme Back     alignment and domain information
>cd08156 catalase_clade_3 Clade 3 of the heme-binding enzyme catalase Back     alignment and domain information
>PLN02609 catalase Back     alignment and domain information
>cd08154 catalase_clade_1 Clade 1 of the heme-binding enzyme catalase Back     alignment and domain information
>COG0753 KatE Catalase [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0047|consensus Back     alignment and domain information
>PRK11249 katE hydroperoxidase II; Provisional Back     alignment and domain information
>cd08157 catalase_fungal Fungal catalases similar to yeast catalases A and T Back     alignment and domain information
>PF00199 Catalase: Catalase; InterPro: IPR011614 Catalases (1 Back     alignment and domain information
>cd08153 srpA_like Catalase-like heme-binding proteins similar to the uncharacterized srpA Back     alignment and domain information
>cd08150 catalase_like Catalase-like heme-binding proteins and protein domains Back     alignment and domain information
>cd08151 AOS Allene oxide synthase Back     alignment and domain information
>cd08152 y4iL_like Catalase-like heme-binding proteins similar to the uncharacterized y4iL Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
3nwl_A 527 The Crystal Structure Of The P212121 Form Of Bovine 1e-39
3rgp_A 499 Structural And Kinetic Analysis Of The Beef Liver C 2e-39
7cat_A 506 The Nadph Binding Site On Beef Liver Catalase Lengt 2e-39
1qqw_A 527 Crystal Structure Of Human Erythrocyte Catalase Len 4e-39
1dgh_A 498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 5e-39
1dgh_B 498 Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole C 6e-39
1dgg_A 497 Human Erythrocyte Catalse Cyanide Complex Length = 6e-39
2xq1_A 509 Crystal Structure Of Peroxisomal Catalase From The 8e-32
3hb6_A 484 Inactive Mutant H54f Of Proteus Mirabilis Catalase 1e-27
1h7k_A 483 Formation Of A Tyrosyl Radical Intermediate In Prot 1e-27
1h6n_A 484 Formation Of A Tyrosyl Radical Intermediate In Prot 1e-27
1e93_A 484 High Resolution Structure And Biochemical Propertie 1e-27
1m85_A 484 Structure Of Proteus Mirabilis Catalase For The Nat 1e-27
2isa_A 483 Crystal Structure Of Vibrio Salmonicida Catalase Le 1e-27
1qwl_A 505 Structure Of Helicobacter Pylori Catalase Length = 3e-27
1si8_A 484 Crystal Structure Of E. Faecalis Catalase Length = 6e-27
2a9e_A 505 Helicobacter Pylori Catalase Compound I Length = 50 6e-27
2j2m_A 491 Crystal Structure Analysis Of Catalase From Exiguob 7e-27
1a4e_A 488 Catalase A From Saccharomyces Cerevisiae Length = 4 7e-27
1m7s_A 484 Crystal Structure Analysis Of Catalase Catf Of Pseu 1e-22
4aue_A 717 Crystal Structure, Recombinant Expression And Mutag 2e-19
4aul_A 719 Crystal Structure, Recombinant Expression And Mutag 2e-19
4aum_A 719 Crystal Structure, Recombinant Expression And Mutag 2e-19
4aun_A 719 Crystal Structure, Recombinant Expression And Mutag 2e-19
1qf7_A 753 Structure Of The Mutant His392gln Of Catalase Hpii 9e-19
3p9q_A 753 Structure Of I274c Variant Of E. Coli Kate Length = 9e-19
1gwh_A 503 Atomic Resolution Structure Of Micrococcus Lysodeik 1e-18
4ent_A 753 Structure Of The S234a Variant Of E. Coli Kate Leng 1e-18
3p9s_A 753 Structure Of I274a Variant Of E. Coli Kate Length = 1e-18
1ggh_A 753 Crystal Structure Of Catalase Hpii From Escherichia 1e-18
4enr_A 753 Structure Of E530i Variant E. Coli Kate Length = 75 1e-18
1gwf_A 503 Compound Ii Structure Of Micrococcus Lysodeikticus 1e-18
1cf9_A 753 Structure Of The Mutant Val169cys Of Catalase Hpii 1e-18
1p7y_A 753 Crystal Structure Of The D181a Variant Of Catalase 1e-18
4enp_A 753 Structure Of E530a Variant E. Coli Kate Length = 75 1e-18
4enq_A 753 Structure Of E530d Variant E. Coli Kate Length = 75 1e-18
3p9r_A 753 Structure Of I274g Variant Of E. Coli Kate Length = 1e-18
4ens_A 753 Structure Of E530q Variant Of E. Coli Kate Length = 1e-18
3p9p_A 753 Structure Of I274v Variant Of E. Coli Kate Length = 1e-18
1p80_A 753 Crystal Structure Of The D181q Variant Of Catalase 1e-18
1p7z_A 753 Crystal Structure Of The D181s Variant Of Catalase 1e-18
1ggj_A 753 Crystal Structure Of Catalase Hpii From Escherichia 1e-18
1iph_A 753 Structure Of Catalase Hpii From Escherichia Coli Le 1e-18
1hbz_A 498 Catalase From Micrococcus Lysodeikticu Length = 498 1e-18
1p81_A 753 Crystal Structure Of The D181e Variant Of Catalase 1e-18
1gg9_A 753 Crystal Structure Of Catalase Hpii From Escherichia 1e-18
4enu_A 753 Structure Of The S234d Variant Of E. Coli Kate Leng 1e-18
1qws_A 753 Structure Of The D181n Variant Of Catalase Hpii Fro 1e-18
4enw_A 753 Structure Of The S234n Variant Of E. Coli Kate Leng 1e-18
4env_A 753 Structure Of The S234i Variant Of E. Coli Kate Leng 1e-18
1ggk_A 753 Crystal Structure Of Catalase Hpii From Escherichia 1e-18
3ttv_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 3e-18
3ttt_A 753 Structure Of F413y Variant Of E. Coli Kate Length = 3e-18
3ttu_A 753 Structure Of F413y/h128n Double Variant Of E. Coli 3e-18
3ej6_A 688 Neurospora Crassa Catalase-3 Crystal Structure Leng 4e-18
1ye9_E 259 Crystal Structure Of Proteolytically Truncated Cata 5e-18
2iuf_A 688 The Structures Of Penicillium Vitale Catalase: Rest 5e-18
2xf2_A 688 Pvc-At Length = 688 6e-18
3ttx_A 753 Structure Of The F413k Variant Of E. Coli Kate Leng 1e-17
3ttw_A 753 Structure Of The F413e Variant Of E. Coli Kate Leng 1e-17
1sy7_A 715 Crystal Structure Of The Catalase-1 From Neurospora 4e-17
>pdb|3NWL|A Chain A, The Crystal Structure Of The P212121 Form Of Bovine Liver Catalase Previously Characterized By Electron Microscopy Length = 527 Back     alignment and structure 
Iteration: 1

 Score =  157 bits (397), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%)
Query: 35  KVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPD 94
           KVWPH ++PLI VG+LVL++NP NYFAEVEQ+AF PS++ PGIEPSPDKMLQGRLF+YPD
Sbjct: 301 KVWPHGDYPLIPVGKLVLNRNPVNYFAEVEQLAFDPSNMPPGIEPSPDKMLQGRLFAYPD 360
Query: 95  THRHRLGPNYLQLPVNCPFATKVANYQR 122
           THRHRLGPNYLQ+PVNCP+  +VANYQR
Sbjct: 361 THRHRLGPNYLQIPVNCPYRARVANYQR 388
>pdb|3RGP|A Chain A, Structural And Kinetic Analysis Of The Beef Liver Catalase Complexed With Nitric Oxide Length = 499 Back     alignment and structure
>pdb|7CAT|A Chain A, The Nadph Binding Site On Beef Liver Catalase Length = 506 Back     alignment and structure
>pdb|1QQW|A Chain A, Crystal Structure Of Human Erythrocyte Catalase Length = 527 Back     alignment and structure
>pdb|1DGH|A Chain A, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|1DGH|B Chain B, Human Erythrocyte Catalase 3-Amino-1,2,4-Triazole Complex Length = 498 Back     alignment and structure
>pdb|1DGG|A Chain A, Human Erythrocyte Catalse Cyanide Complex Length = 497 Back     alignment and structure
>pdb|2XQ1|A Chain A, Crystal Structure Of Peroxisomal Catalase From The Yeast Hansenula Polymorpha Length = 509 Back     alignment and structure
>pdb|3HB6|A Chain A, Inactive Mutant H54f Of Proteus Mirabilis Catalase Length = 484 Back     alignment and structure
>pdb|1H7K|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 483 Back     alignment and structure
>pdb|1H6N|A Chain A, Formation Of A Tyrosyl Radical Intermediate In Proteus Mirabilis Catalase By Directed Mutagenesis And Consequences For Nucleotide Reactivity Length = 484 Back     alignment and structure
>pdb|1E93|A Chain A, High Resolution Structure And Biochemical Properties Of A Recombinant Catalase Depleted In Iron Length = 484 Back     alignment and structure
>pdb|1M85|A Chain A, Structure Of Proteus Mirabilis Catalase For The Native Form Length = 484 Back     alignment and structure
>pdb|2ISA|A Chain A, Crystal Structure Of Vibrio Salmonicida Catalase Length = 483 Back     alignment and structure
>pdb|1QWL|A Chain A, Structure Of Helicobacter Pylori Catalase Length = 505 Back     alignment and structure
>pdb|1SI8|A Chain A, Crystal Structure Of E. Faecalis Catalase Length = 484 Back     alignment and structure
>pdb|2A9E|A Chain A, Helicobacter Pylori Catalase Compound I Length = 505 Back     alignment and structure
>pdb|2J2M|A Chain A, Crystal Structure Analysis Of Catalase From Exiguobacterium Oxidotolerans Length = 491 Back     alignment and structure
>pdb|1A4E|A Chain A, Catalase A From Saccharomyces Cerevisiae Length = 488 Back     alignment and structure
>pdb|1M7S|A Chain A, Crystal Structure Analysis Of Catalase Catf Of Pseudomonas Syringae Length = 484 Back     alignment and structure
>pdb|4AUE|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 717 Back     alignment and structure
>pdb|4AUL|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|4AUM|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|4AUN|A Chain A, Crystal Structure, Recombinant Expression And Mutagenesis Studies Of The Bifunctional Catalase-phenol Oxidase From Scytalidium Thermophilum Length = 719 Back     alignment and structure
>pdb|1QF7|A Chain A, Structure Of The Mutant His392gln Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|3P9Q|A Chain A, Structure Of I274c Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GWH|A Chain A, Atomic Resolution Structure Of Micrococcus Lysodeikticus Catalase Complexed With Nadph Length = 503 Back     alignment and structure
>pdb|4ENT|A Chain A, Structure Of The S234a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9S|A Chain A, Structure Of I274a Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGH|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128ala Variant. Length = 753 Back     alignment and structure
>pdb|4ENR|A Chain A, Structure Of E530i Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GWF|A Chain A, Compound Ii Structure Of Micrococcus Lysodeikticus Catalase Length = 503 Back     alignment and structure
>pdb|1CF9|A Chain A, Structure Of The Mutant Val169cys Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|1P7Y|A Chain A, Crystal Structure Of The D181a Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|4ENP|A Chain A, Structure Of E530a Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENQ|A Chain A, Structure Of E530d Variant E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9R|A Chain A, Structure Of I274g Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENS|A Chain A, Structure Of E530q Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3P9P|A Chain A, Structure Of I274v Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1P80|A Chain A, Crystal Structure Of The D181q Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1P7Z|A Chain A, Crystal Structure Of The D181s Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1GGJ|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201ala Variant. Length = 753 Back     alignment and structure
>pdb|1IPH|A Chain A, Structure Of Catalase Hpii From Escherichia Coli Length = 753 Back     alignment and structure
>pdb|1HBZ|A Chain A, Catalase From Micrococcus Lysodeikticu Length = 498 Back     alignment and structure
>pdb|1P81|A Chain A, Crystal Structure Of The D181e Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|1GG9|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, His128asn Variant. Length = 753 Back     alignment and structure
>pdb|4ENU|A Chain A, Structure Of The S234d Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1QWS|A Chain A, Structure Of The D181n Variant Of Catalase Hpii From E. Coli Length = 753 Back     alignment and structure
>pdb|4ENW|A Chain A, Structure Of The S234n Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|4ENV|A Chain A, Structure Of The S234i Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1GGK|A Chain A, Crystal Structure Of Catalase Hpii From Escherichia Coli, Asn201his Variant. Length = 753 Back     alignment and structure
>pdb|3TTV|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTT|A Chain A, Structure Of F413y Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTU|A Chain A, Structure Of F413y/h128n Double Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3EJ6|A Chain A, Neurospora Crassa Catalase-3 Crystal Structure Length = 688 Back     alignment and structure
>pdb|1YE9|E Chain E, Crystal Structure Of Proteolytically Truncated Catalase Hpii From E. Coli Length = 259 Back     alignment and structure
>pdb|2IUF|A Chain A, The Structures Of Penicillium Vitale Catalase: Resting State, Oxidised State (Compound I) And Complex With Aminotriazole Length = 688 Back     alignment and structure
>pdb|2XF2|A Chain A, Pvc-At Length = 688 Back     alignment and structure
>pdb|3TTX|A Chain A, Structure Of The F413k Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|3TTW|A Chain A, Structure Of The F413e Variant Of E. Coli Kate Length = 753 Back     alignment and structure
>pdb|1SY7|A Chain A, Crystal Structure Of The Catalase-1 From Neurospora Crassa, Native Structure At 1.75a Resolution. Length = 715 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query125
1dgf_A 497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 2e-65
2isa_A 483 Catalase; peroxidase, heme, oxidoreductase, iron, 4e-64
1a4e_A 488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 2e-63
1si8_A 484 Catalase; N-terminal ARM, anti-parallel beta-barre 3e-63
2xq1_A 509 Peroxisomal catalase; oxidoreductase, hydrogen per 3e-63
1qwl_A 505 KATA catalase; beta barrel, azide complex, oxyferr 8e-63
2j2m_A 491 Catalase; functional class, oxidoreductase; HET: H 8e-63
1gwe_A 503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 1e-62
1m7s_A 484 Catalase; beta barrel, alpha helical domain, oxido 7e-60
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 2e-57
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 3e-55
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 4e-55
3e4w_A320 Putative uncharacterized protein; heme enzyme, cat 5e-48
1u5u_A374 Allene oxide synthase-lipoxygenase protein; catala 1e-44
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 4e-37
3dy5_A 1066 Allene oxide synthase-lipoxygenase protein; fusion 1e-14
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Length = 497 Back     alignment and structure
 Score =  205 bits (523), Expect = 2e-65
 Identities = 68/88 (77%), Positives = 80/88 (90%)

Query: 35  KVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPD 94
           KVWPH+++PLI VG+LVL++NP NYFAEVEQIAF PS++ PGIE SPDKMLQGRLF+YPD
Sbjct: 297 KVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPD 356

Query: 95  THRHRLGPNYLQLPVNCPFATKVANYQR 122
           THRHRLGPNYL +PVNCP+  +VANYQR
Sbjct: 357 THRHRLGPNYLHIPVNCPYRARVANYQR 384
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Length = 483 Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Length = 488 Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Length = 509 Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Length = 505 Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Length = 491 Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Length = 503 Back     alignment and structure
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Length = 484 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Length = 715 Back     alignment and structure
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Length = 753 Back     alignment and structure
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Length = 688 Back     alignment and structure
>3e4w_A Putative uncharacterized protein; heme enzyme, catalase, peroxidase, oxidoreductase; HET: HEM; 1.80A {Mycobacterium avium subsp} PDB: 3e4y_A* Length = 320 Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Length = 374 Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Length = 688 Back     alignment and structure
>3dy5_A Allene oxide synthase-lipoxygenase protein; fusion protein, BI-functional enzyme, dioxygenase, fatty ACI biosynthesis, heme, iron; HET: HEM; 3.51A {Plexaura homomalla} Length = 1066 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
3ej6_A 688 Catalase-3; heme, hydrogen iron, metal-binding, ox 100.0
3ttv_A 753 Catalase HPII; heme orientation, oxidoreductase; H 100.0
1gwe_A 503 Catalase; oxidoreductase, hdyrogen-peroxide:hydrog 100.0
2isa_A 483 Catalase; peroxidase, heme, oxidoreductase, iron, 100.0
2j2m_A 491 Catalase; functional class, oxidoreductase; HET: H 100.0
1qwl_A 505 KATA catalase; beta barrel, azide complex, oxyferr 100.0
1a4e_A 488 Catalase A; oxidoreductase, peroxidase; HET: HEM; 100.0
1dgf_A 497 Catalase; heme, NADPH, hydrogen peroxide, oxidored 100.0
2iuf_A 688 Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Pen 100.0
1si8_A 484 Catalase; N-terminal ARM, anti-parallel beta-barre 100.0
1m7s_A 484 Catalase; beta barrel, alpha helical domain, oxido 100.0
1sy7_A 715 Catalase 1; heme oxidation, singlet oxygen, oxidor 100.0
2xq1_A 509 Peroxisomal catalase; oxidoreductase, hydrogen per 100.0
3e4w_A320 Putative uncharacterized protein; heme enzyme, cat 99.96
1u5u_A374 Allene oxide synthase-lipoxygenase protein; catala 99.93
3dy5_A 1066 Allene oxide synthase-lipoxygenase protein; fusion 99.79
>3ej6_A Catalase-3; heme, hydrogen iron, metal-binding, oxidoreductase, peroxidase; HET: NAG HEM; 2.30A {Neurospora crassa} Back     alignment and structure
Probab=100.00  E-value=3.5e-38  Score=282.12  Aligned_cols=109  Identities=42%  Similarity=0.732  Sum_probs=102.5

Q ss_pred             ccccCcc-eeecC----CCCC------CCCCCccccCCCCcCcEEeEEEEEccCCCCchhhhhhhhcCCCccCCCcCCCC
Q psy2586          13 RKQQGTD-TFGYN----DKAL------PLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSP   81 (125)
Q Consensus        13 r~~~gp~-~f~~~----~~gD------~i~DpTk~WP~d~r~~v~lG~LtLnrn~~n~~~e~eqi~FdP~~lv~GIe~Sd   81 (125)
                      |+++|+. +|+|.    .++|      +++|+||+||++++|++++|+||||+|++|+|++|||++|+|+++|+||++|+
T Consensus       268 ~I~~G~~p~w~l~vQv~~~~d~~~~~f~~~D~Tk~WPe~~~P~i~VG~l~Lnrnp~n~fae~Eq~aF~P~~lvpGI~~S~  347 (688)
T 3ej6_A          268 AIESGNAPSWELAVQLIDEDKAQAYGFDLLDPTKFLPEEFAPLQVLGEMTLNRNPMNYFAETEQISFQPGHIVRGVDFTE  347 (688)
T ss_dssp             HHHTTCCCEEEEEEEEECGGGSSCSSSCTTCTTCCCCTTTSCCEEEEEEEEEECCSCHHHHTTTCCCCTTCCCTTEECCC
T ss_pred             HHhcCCCceEEEEEEEechhhhhhcCCCCCcCCeecCCccCcceEEEEEEEcCCccchhhhhhhcccCccccCCCcCCCC
Confidence            5677874 88887    5677      58999999999989999999999999999999999999999999999999999


Q ss_pred             Ccccccccccchhhhhhcc-CCCCcccCCCCCCCccccccee
Q psy2586          82 DKMLQGRLFSYPDTHRHRL-GPNYLQLPVNCPFATKVANYQR  122 (125)
Q Consensus        82 DPlLq~R~~aYadS~~~Rl-g~n~~~lpvn~p~~~~~~~~~r  122 (125)
                      |||||+|+|||+|||++|+ |+||+|||||||+|+ |+||||
T Consensus       348 DplLq~R~fsY~dtqr~Rl~G~N~~qlPvN~p~~~-~~~~~r  388 (688)
T 3ej6_A          348 DPLLQGRLYSYLDTQLNRHRGPNFEQLPINRPVSG-VHNNHR  388 (688)
T ss_dssp             CHHHHHHHHHHHHHHHHHHSSSCGGGSTTTCCSSC-CCSSCC
T ss_pred             ChHhhhhhhhhHHHHHhhccCCChhhCCCCCCCCC-cCCcCc
Confidence            9999999999999999997 999999999999998 999997
>3ttv_A Catalase HPII; heme orientation, oxidoreductase; HET: HEM; 1.45A {Escherichia coli} PDB: 3ttt_A* 1gge_A* 1iph_A* 4ens_A* 3ttu_A* 3p9p_A* 4enq_A* 1p81_A* 3ttx_A* 4enw_A* 3ttw_A* 4ent_A* 1qws_A* 1cf9_A* 1p80_A* 1qf7_A* 4enu_A* 4enp_A* 1gg9_A* 1ggf_A* ... Back     alignment and structure
>1gwe_A Catalase; oxidoreductase, hdyrogen-peroxide:hydrogen peroxide oxidoreductase; HET: HEM; 0.88A {Micrococcus luteus} SCOP: e.5.1.1 PDB: 1gwh_A* 1hbz_A* 1gwf_A* Back     alignment and structure
>2isa_A Catalase; peroxidase, heme, oxidoreductase, iron, hydrogen peroxide; HET: OMT HEM; 1.97A {Vibrio salmonicida} PDB: 1m85_A* 1mqf_A* 1nm0_A* 2cag_A* 2cah_A* 1e93_A* 1h7k_A* 1h6n_A* 3hb6_A* Back     alignment and structure
>2j2m_A Catalase; functional class, oxidoreductase; HET: HEM; 2.4A {Exiguobacterium oxidotolerans} Back     alignment and structure
>1qwl_A KATA catalase; beta barrel, azide complex, oxyferryl complex, oxidoreductas; HET: HEM; 1.60A {Helicobacter pylori} SCOP: e.5.1.1 PDB: 1qwm_A* 2a9e_A* 2iqf_A* Back     alignment and structure
>1a4e_A Catalase A; oxidoreductase, peroxidase; HET: HEM; 2.40A {Saccharomyces cerevisiae} SCOP: e.5.1.1 Back     alignment and structure
>1dgf_A Catalase; heme, NADPH, hydrogen peroxide, oxidoreductase; HET: HEM NDP; 1.50A {Homo sapiens} SCOP: e.5.1.1 PDB: 1dgg_A* 1f4j_A* 1qqw_A* 1dgh_A* 1dgb_A* 3rgp_A* 3re8_A* 3rgs_A* 3nwl_A* 4blc_A* 1th2_A* 1th3_A* 1th4_A* 1tgu_A* 7cat_A* 8cat_A* Back     alignment and structure
>2iuf_A Catalase; oxidoreductase; HET: HDD NAG; 1.71A {Penicillium janthinellum} PDB: 2xf2_A* Back     alignment and structure
>1si8_A Catalase; N-terminal ARM, anti-parallel beta-barrel, wrapping region, terminal helical region, tetramer, heme group, oxidoreducta; HET: HEM; 2.30A {Enterococcus faecalis} SCOP: e.5.1.1 Back     alignment and structure
>1m7s_A Catalase; beta barrel, alpha helical domain, oxidoreductase; HET: HEM; 1.80A {Pseudomonas syringae} SCOP: e.5.1.1 Back     alignment and structure
>1sy7_A Catalase 1; heme oxidation, singlet oxygen, oxidoreductase; HET: HDD HEM; 1.75A {Neurospora crassa} SCOP: c.23.16.3 Back     alignment and structure
>2xq1_A Peroxisomal catalase; oxidoreductase, hydrogen peroxide detoxification, PTS1; HET: HEM; 2.90A {Pichia angusta} Back     alignment and structure
>3e4w_A Putative uncharacterized protein; heme enzyme, catalase, peroxidase, oxidoreductase; HET: HEM; 1.80A {Mycobacterium avium subsp} PDB: 3e4y_A* Back     alignment and structure
>1u5u_A Allene oxide synthase-lipoxygenase protein; catalase, heme, eicosanoid, fusion PR lyase; HET: HEM; 2.00A {Plexaura homomalla} SCOP: e.5.1.2 Back     alignment and structure
>3dy5_A Allene oxide synthase-lipoxygenase protein; fusion protein, BI-functional enzyme, dioxygenase, fatty ACI biosynthesis, heme, iron; HET: HEM; 3.51A {Plexaura homomalla} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 125
d1dgfa_ 497 e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [Tax 3e-40
d1si8a_ 474 e.5.1.1 (A:) Catalase I {Enterococcus faecalis [Ta 8e-40
d1e93a_ 476 e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 3e-39
d1qwla_ 491 e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxI 7e-38
d1a4ea_ 488 e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomy 9e-38
d1gwea_ 498 e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus 3e-37
d1p80a2 571 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, 1e-34
d1m7sa_ 484 e.5.1.1 (A:) Catalase I {Pseudomonas syringae [Tax 1e-32
d1u5ua_366 e.5.1.2 (A:) Allene oxide synthase-lipoxygenase pr 7e-26
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase I
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  137 bits (347), Expect = 3e-40
 Identities = 68/88 (77%), Positives = 80/88 (90%)

Query: 35  KVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSPDKMLQGRLFSYPD 94
           KVWPH+++PLI VG+LVL++NP NYFAEVEQIAF PS++ PGIE SPDKMLQGRLF+YPD
Sbjct: 297 KVWPHKDYPLIPVGKLVLNRNPVNYFAEVEQIAFDPSNMPPGIEASPDKMLQGRLFAYPD 356

Query: 95  THRHRLGPNYLQLPVNCPFATKVANYQR 122
           THRHRLGPNYL +PVNCP+  +VANYQR
Sbjct: 357 THRHRLGPNYLHIPVNCPYRARVANYQR 384
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Length = 474 Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Length = 476 Back     information, alignment and structure
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Length = 491 Back     information, alignment and structure
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 488 Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Length = 498 Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Length = 571 Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Length = 484 Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query125
d1a4ea_ 488 Catalase I {Baker's yeast (Saccharomyces cerevisia 100.0
d1qwla_ 491 Catalase I {Helicobacter pylori [TaxId: 210]} 100.0
d1gwea_ 498 Catalase I {Micrococcus lysodeikticus [TaxId: 1270 100.0
d1e93a_ 476 Catalase I {Proteus mirabilis [TaxId: 584]} 100.0
d1si8a_ 474 Catalase I {Enterococcus faecalis [TaxId: 1351]} 100.0
d1m7sa_ 484 Catalase I {Pseudomonas syringae [TaxId: 317]} 100.0
d1dgfa_ 497 Catalase I {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1p80a2 571 Catalase II {Escherichia coli, HPII [TaxId: 562]} 100.0
d1u5ua_366 Allene oxide synthase-lipoxygenase protein, N-term 99.83
>d1a4ea_ e.5.1.1 (A:) Catalase I {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Heme-dependent catalase-like
superfamily: Heme-dependent catalase-like
family: Heme-dependent catalases
domain: Catalase I
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=2.1e-40  Score=284.70  Aligned_cols=110  Identities=48%  Similarity=0.809  Sum_probs=102.1

Q ss_pred             ccccCc-ceeecC----CCCC------CCCCCccccCCCCcCcEEeEEEEEccCCCCchhhhhhhhcCCCccCCCcCCCC
Q psy2586          13 RKQQGT-DTFGYN----DKAL------PLETGNKVWPHREFPLIEVGQLVLDKNPSNYFAEVEQIAFSPSHLVPGIEPSP   81 (125)
Q Consensus        13 r~~~gp-~~f~~~----~~gD------~i~DpTk~WP~d~r~~v~lG~LtLnrn~~n~~~e~eqi~FdP~~lv~GIe~Sd   81 (125)
                      |.++|+ .+|+|.    .++|      +++|+||+||++++|++++|+||||++++|+|++|||++|+|++||+||++|+
T Consensus       251 ~i~~g~~p~w~l~vQl~~~~d~~~~~~~i~D~Tk~WPe~~~P~i~vG~l~ln~~~~n~f~e~Eq~aF~P~~lvpGI~~S~  330 (488)
T d1a4ea_         251 AIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVWPQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASA  330 (488)
T ss_dssp             HHHTTCCCEEEEEEEEECHHHHHTSSSCTTCTTCCCCTTTSCCEEEEEEEEEECCSCHHHHTTTCCCCTTCCCTTEEECS
T ss_pred             HHHcCCCceEEEEEEeeCHhHhhcCCCCCcCCceeeccccCcceeeeEEEeccCccccchhhhcccccccccCCcccCCC
Confidence            456676 688877    5676      79999999999988999999999999999999999999999999999999999


Q ss_pred             CcccccccccchhhhhhccCCCCcccCCCCCCCc-cccccee
Q psy2586          82 DKMLQGRLFSYPDTHRHRLGPNYLQLPVNCPFAT-KVANYQR  122 (125)
Q Consensus        82 DPlLq~R~~aYadS~~~Rlg~n~~~lpvn~p~~~-~~~~~~r  122 (125)
                      |||||+|+|||+|||++|||+||+|||||||+|+ +++||||
T Consensus       331 Dp~Lq~R~faY~dt~r~RlG~N~~qlPvN~P~~~~~~n~~~r  372 (488)
T d1a4ea_         331 DPVLQARLFSYADAHRYRLGPNFHQIPVNCPYASKFFNPAIR  372 (488)
T ss_dssp             CHHHHHHHHHHHHHHHHHTCTTGGGSGGGSCTTSCCCCTTSC
T ss_pred             CccccccccchHHHhhcccCcChhhcccCCCCCccccCcccc
Confidence            9999999999999999999999999999999998 4788887
>d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gwea_ e.5.1.1 (A:) Catalase I {Micrococcus lysodeikticus [TaxId: 1270]} Back     information, alignment and structure
>d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1si8a_ e.5.1.1 (A:) Catalase I {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1m7sa_ e.5.1.1 (A:) Catalase I {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Back     information, alignment and structure
>d1u5ua_ e.5.1.2 (A:) Allene oxide synthase-lipoxygenase protein, N-terminal domain {Black sea rod (Plexaura homomalla) [TaxId: 47982]} Back     information, alignment and structure