Psyllid ID: psy2680

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------18

MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICNNLDLNAHLPKPPPEEKEEKEKEEKKEGDKEAETEK

cEEEEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHccHHHHHHHHHHHHcccccccHHcccccccccccccccccccHHHHHHHHHccHHHHHcc

cccHccccHHHHHccEEcHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccHHHHHHccccccccccccccHHHHHHHHHccccccHHcccc

mswrtkypdnvIKGYKVNLQHalgtripnglLNFFFKFNyvrkgtkkvkaqgigvhkpeeieeFGKNDLKVLADMLgdkafffgeepttlDVVAFAHIAQIYCidkdvefplrdylETTHSNLVAHINRiknrcfpdwddicnnldlnahlpkpppeekeeKEKEEKkegdkeaetek

mswrtkypdnviKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKkvkaqgigvhkpeeieefgKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICNNLDLnahlpkpppeekeekekeekkegdkeaetek

MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICNNLDLNAHLpkpppeekeekekeekkegdkeaetek

******YPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICNNLDLNA*****************************

MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDI*************************************

MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICNNLDLNAHLPKP************************

MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICNNLDLNA*****************************

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICNNLDLNAHLPKPPPEEKEEKEKEEKKEGDKEAETEK

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		178	2.2.26 [Sep-21-2011]
Q95RI5		418	Failed axon connections O	yes	N/A	0.983	0.418	0.629	4e-64
F7E235		406	Failed axon connections h	yes	N/A	0.522	0.229	0.305	8e-07
D3ZAT9		409	Failed axon connections h	yes	N/A	0.544	0.237	0.306	1e-06
Q3UMF9		409	Failed axon connections h	yes	N/A	0.544	0.237	0.306	1e-06
Q5TGI0		409	Failed axon connections h	yes	N/A	0.544	0.237	0.306	1e-06
O88441		263	Metaxin-2 OS=Mus musculus	no	N/A	0.573	0.387	0.272	7e-05
P47802		317	Metaxin-1 OS=Mus musculus	no	N/A	0.696	0.391	0.288	0.0001
Q27HK4		317	Metaxin-1 OS=Sus scrofa G	no	N/A	0.685	0.384	0.28	0.0003
Q13505		466	Metaxin-1 OS=Homo sapiens	no	N/A	0.589	0.225	0.310	0.0006
Q4R3I0		317	Metaxin-1 OS=Macaca fasci	N/A	N/A	0.674	0.378	0.294	0.0006

>sp\|Q95RI5\|FAXC_DROME Failed axon connections OS=Drosophila melanogaster GN=fax PE=2 SV=1	Back alignment and function desciption

 Score =  243 bits (621), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 112/178 (62%), Positives = 143/178 (80%), Gaps = 3/178 (1%)

Query: 3   WRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRK---GTKKVKAQGIGVHKPE 59
           WR KYPDNV+KGYKVNLQHALG R+PN +LNFFFK  + RK   GTKK+KA GIGVH  E
Sbjct: 212 WRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAE 271

Query: 60  EIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETT 119
           EIEEFGK+DLKVL++ML  K FFFG+EPTTLDVVAFA ++Q++ + KD+ +PLRDY+   
Sbjct: 272 EIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEK 331

Query: 120 HSNLVAHINRIKNRCFPDWDDICNNLDLNAHLPKPPPEEKEEKEKEEKKEGDKEAETE 177
             NL+ H++R+K++CFPDWD+IC  LDLNAH+PKP PE KE KE  E+++ +++  TE
Sbjct: 332 CPNLIGHVSRMKDKCFPDWDEICTKLDLNAHIPKPEPETKEGKEGGEQEKSNEQEGTE 389

Together with Abl, involved in embryonic axonal development.
Drosophila melanogaster (taxid: 7227)

>sp\|F7E235\|FAXC_XENTR Failed axon connections homolog OS=Xenopus tropicalis GN=faxc PE=3 SV=1	Back alignment and function description

>sp\|D3ZAT9\|FAXC_RAT Failed axon connections homolog OS=Rattus norvegicus GN=Faxc PE=2 SV=1	Back alignment and function description

>sp\|Q3UMF9\|FAXC_MOUSE Failed axon connections homolog OS=Mus musculus GN=Faxc PE=2 SV=1	Back alignment and function description

>sp\|Q5TGI0\|FAXC_HUMAN Failed axon connections homolog OS=Homo sapiens GN=FAXC PE=2 SV=2	Back alignment and function description

>sp\|O88441\|MTX2_MOUSE Metaxin-2 OS=Mus musculus GN=Mtx2 PE=1 SV=1	Back alignment and function description

>sp\|P47802\|MTX1_MOUSE Metaxin-1 OS=Mus musculus GN=Mtx1 PE=1 SV=1	Back alignment and function description

>sp\|Q27HK4\|MTX1_PIG Metaxin-1 OS=Sus scrofa GN=MTX1 PE=2 SV=1	Back alignment and function description

>sp\|Q13505\|MTX1_HUMAN Metaxin-1 OS=Homo sapiens GN=MTX1 PE=1 SV=2	Back alignment and function description

>sp\|Q4R3I0\|MTX1_MACFA Metaxin-1 OS=Macaca fascicularis GN=MTX1 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		178
270003072		376	hypothetical protein TcasGA2_TC000100 [T	0.983	0.465	0.68	3e-66
189235487		379	PREDICTED: similar to failed axon connec	0.983	0.461	0.668	1e-64
62472216		415	failed axon connections, isoform C [Dros	0.983	0.421	0.64	4e-64
195590815		415	GD12471 [Drosophila simulans] gi\|1941971	0.983	0.421	0.64	4e-64
195328133		415	GM24402 [Drosophila sechellia] gi\|194119	0.983	0.421	0.64	5e-64
442632820		271	failed axon connections, isoform E [Dros	0.983	0.645	0.64	6e-64
255982983		315	RE69123p [Drosophila melanogaster]	0.983	0.555	0.64	7e-64
62472205		279	failed axon connections, isoform D [Dros	0.983	0.627	0.64	7e-64
170038082		299	failed axon connections protein [Culex q	0.971	0.578	0.640	8e-64
157136461		300	failed axon connections protein, putativ	0.971	0.576	0.635	9e-64

>gi\|270003072\|gb\|EEZ99519.1\| hypothetical protein TcasGA2_TC000100 [Tribolium castaneum]	Back alignment and taxonomy information

 Score =  256 bits (653), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (81%)

Query: 1   MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEE 60
           M WRTKYP+ V+KGYKVNLQHALGTRIPNG+LNFFFKF + RKGTKKVKAQGIGVH  +E
Sbjct: 169 MWWRTKYPELVLKGYKVNLQHALGTRIPNGILNFFFKFAFGRKGTKKVKAQGIGVHSADE 228

Query: 61  IEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTH 120
           I  FG+ DLKVL+DML DK FFFG+EPTTLDVV FA +AQIY IDK+V + LRDY+  + 
Sbjct: 229 INAFGQGDLKVLSDMLADKPFFFGDEPTTLDVVVFAQLAQIYFIDKEVSYALRDYMTESC 288

Query: 121 SNLVAHINRIKNRCFPDWDDICNNLDLNAHLPKPPPEEKEEKEKEEKKEGDKEAE 175
            NLV  +NR+K RCFPDWDDIC+ LDLN+HLPKP   +  ++  +++KEGD+E E
Sbjct: 289 PNLVGLVNRMKERCFPDWDDICSTLDLNSHLPKPEEAKDNKEGGKDEKEGDQEKE 343

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|189235487\|ref\|XP_968396.2\| PREDICTED: similar to failed axon connections protein [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|62472216\|ref\|NP_001014587.1\| failed axon connections, isoform C [Drosophila melanogaster] gi\|61678457\|gb\|AAX52742.1\| failed axon connections, isoform C [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|195590815\|ref\|XP_002085140.1\| GD12471 [Drosophila simulans] gi\|194197149\|gb\|EDX10725.1\| GD12471 [Drosophila simulans]	Back alignment and taxonomy information

>gi\|195328133\|ref\|XP_002030771.1\| GM24402 [Drosophila sechellia] gi\|194119714\|gb\|EDW41757.1\| GM24402 [Drosophila sechellia]	Back alignment and taxonomy information

>gi\|442632820\|ref\|NP_001261945.1\| failed axon connections, isoform E [Drosophila melanogaster] gi\|440215892\|gb\|AGB94638.1\| failed axon connections, isoform E [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|255982983\|gb\|ACU45759.1\| RE69123p [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|62472205\|ref\|NP_001014586.1\| failed axon connections, isoform D [Drosophila melanogaster] gi\|61678458\|gb\|AAX52743.1\| failed axon connections, isoform D [Drosophila melanogaster]	Back alignment and taxonomy information

>gi\|170038082\|ref\|XP_001846882.1\| failed axon connections protein [Culex quinquefasciatus] gi\|167881502\|gb\|EDS44885.1\| failed axon connections protein [Culex quinquefasciatus]	Back alignment and taxonomy information

>gi\|157136461\|ref\|XP_001656838.1\| failed axon connections protein, putative [Aedes aegypti] gi\|108881007\|gb\|EAT45232.1\| AAEL003453-PA [Aedes aegypti]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		178
FB\|FBgn0014163		418	fax "failed axon connections"	0.837	0.356	0.657	9.9e-55
UNIPROTKB\|Q47WD3		239	CPS_4239 "Putative uncharacter	0.578	0.430	0.323	2.3e-10
TIGR_CMR\|CPS_4239		239	CPS_4239 "conserved hypothetic	0.578	0.430	0.323	2.3e-10
WB\|WBGene00016116		275	C25H3.7 [Caenorhabditis elegan	0.685	0.443	0.296	1.6e-09
DICTYBASE\|DDB_G0276899		293	DDB_G0276899 "thioredoxin fold	0.702	0.426	0.282	2.6e-08
UNIPROTKB\|Q5TGI0		409	FAXC "Failed axon connections	0.556	0.242	0.323	2.3e-07
MGI\|MGI:1923382		409	Faxc "failed axon connections	0.556	0.242	0.323	2.3e-07
RGD\|1562449		409	Faxc "failed axon connections"	0.556	0.242	0.323	2.3e-07
MGI\|MGI:103025		317	Mtx1 "metaxin 1" [Mus musculus	0.601	0.337	0.330	6.6e-07
UNIPROTKB\|H0Y6Y5		316	MTX1 "Metaxin-1" [Homo sapiens	0.584	0.329	0.321	1.4e-06

FB\|FBgn0014163 fax "failed axon connections" [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 565 (203.9 bits), Expect = 9.9e-55, P = 9.9e-55
 Identities = 100/152 (65%), Positives = 125/152 (82%)

Query:     3 WRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRK---GTKKVKAQGIGVHKPE 59
             WR KYPDNV+KGYKVNLQHALG R+PN +LNFFFK  + RK   GTKK+KA GIGVH  E
Sbjct:   212 WRAKYPDNVLKGYKVNLQHALGLRLPNSILNFFFKITFGRKWFQGTKKLKAHGIGVHSAE 271

Query:    60 EIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETT 119
             EIEEFGK+DLKVL++ML  K FFFG+EPTTLDVVAFA ++Q++ + KD+ +PLRDY+   
Sbjct:   272 EIEEFGKDDLKVLSEMLDCKPFFFGDEPTTLDVVAFAVLSQLHYLSKDIAYPLRDYMTEK 331

Query:   120 HSNLVAHINRIKNRCFPDWDDICNNLDLNAHL 151
               NL+ H++R+K++CFPDWD+IC  LDLNAH+
Sbjct:   332 CPNLIGHVSRMKDKCFPDWDEICTKLDLNAHI 363

GO:0007409 "axonogenesis" evidence=IGI;TAS

GO:0022008 "neurogenesis" evidence=IMP

UNIPROTKB\|Q47WD3 CPS_4239 "Putative uncharacterized protein" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_4239 CPS_4239 "conserved hypothetical protein" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

WB\|WBGene00016116 C25H3.7 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0276899 DDB_G0276899 "thioredoxin fold domain-containing protein" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

UNIPROTKB\|Q5TGI0 FAXC "Failed axon connections homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1923382 Faxc "failed axon connections homolog (Drosophila)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1562449 Faxc "failed axon connections" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:103025 Mtx1 "metaxin 1" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|H0Y6Y5 MTX1 "Metaxin-1" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
Q95RI5	FAXC_DROME	No assigned EC number	0.6292	0.9831	0.4186	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		178
cd03193		88	cd03193, GST_C_Metaxin, C-terminal, alpha helical	7e-23
cd03212		137	cd03212, GST_C_Metaxin1_3, C-terminal, alpha helic	8e-10
pfam13410		69	pfam13410, GST_C_2, Glutathione S-transferase, C-t	1e-06
cd03211		126	cd03211, GST_C_Metaxin2, C-terminal, alpha helical	1e-05

>gnl\|CDD\|198302 cd03193, GST_C_Metaxin, C-terminal, alpha helical domain of Metaxin and related proteins	Back alignment and domain information

 Score = 86.5 bits (215), Expect = 7e-23
 Identities = 30/72 (41%), Positives = 42/72 (58%), Gaps = 2/72 (2%)

Query: 60  EIEEFGKNDLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETT 119
           EI E    DL+ L+ +LGDK F FG++PT++D   FAH+A I    +D   PL   L  +
Sbjct: 19  EIYELALEDLEALSTLLGDKKFLFGDKPTSVDATVFAHLASILYPPEDS--PLLRVLVAS 76

Query: 120 HSNLVAHINRIK 131
             NLV +  RI+
Sbjct: 77  SPNLVEYCERIR 88

Glutathione S-transferase (GST) C-terminal domain family, Metaxin subfamily; composed of metaxins and related proteins. Metaxin 1 is a component of a preprotein import complex of the mitochondrial outer membrane. It extends to the cytosol and is anchored to the mitochondrial membrane through its C-terminal domain. In mice, metaxin is required for embryonic development. In humans, alterations in the metaxin gene may be associated with Gaucher disease. Metaxin 2 binds to metaxin 1 and may also play a role in protein translocation into the mitochondria. Genome sequencing shows that a third metaxin gene also exists in zebrafish, Xenopus, chicken, and mammals. Sequence analysis suggests that all three metaxins share a common ancestry and that they possess similarity to GSTs. Also included in the subfamily are uncharacterized proteins with similarity to metaxins, including a novel GST from Rhodococcus with toluene o-monooxygenase and glutamylcysteine synthetase activities. Other members are the cadmium-inducible lysosomal protein CDR-1 and its homologs from C. elegans, and the failed axon connections (fax) protein from Drosophila. CDR-1 is an integral membrane protein that functions to protect against cadmium toxicity and may also have a role in osmoregulation to maintain salt balance in C. elegans. The fax gene of Drosophila was identified as a genetic modifier of Abelson (Abl) tyrosine kinase. The fax protein is localized in cellular membranes and is expressed in embryonic mesoderm and axons of the central nervous system. Length = 88

>gnl\|CDD\|198321 cd03212, GST_C_Metaxin1_3, C-terminal, alpha helical domain of Metaxin 1, Metaxin 3, and similar proteins	Back alignment and domain information

>gnl\|CDD\|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain	Back alignment and domain information

>gnl\|CDD\|198320 cd03211, GST_C_Metaxin2, C-terminal, alpha helical domain of Metaxin 2	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		178
cd03211		126	GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me	99.93
cd03212		137	GST_C_Metaxin1_3 GST_C family, Metaxin subfamily,	99.89
KOG4244\|consensus		281		99.83
KOG3028\|consensus		313		99.83
KOG3027\|consensus		257		99.81
PF13410		69	GST_C_2: Glutathione S-transferase, C-terminal dom	99.33
cd03196		115	GST_C_5 GST_C family, unknown subfamily 5; compose	99.25
cd03193		88	GST_C_Metaxin GST_C family, Metaxin subfamily; com	99.23
PF14497		99	GST_C_3: Glutathione S-transferase, C-terminal dom	99.2
PF00043		95	GST_C: Glutathione S-transferase, C-terminal domai	99.17
PF11801		168	Tom37_C: Tom37 C-terminal domain; InterPro: IPR019	99.16
PLN02473		214	glutathione S-transferase	99.15
cd03187		118	GST_C_Phi GST_C family, Class Phi subfamily; compo	99.14
cd03180		110	GST_C_2 GST_C family, unknown subfamily 2; compose	99.13
cd03209		121	GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar	99.11
cd03177		118	GST_C_Delta_Epsilon GST_C family, Class Delta and	99.11
cd03188		114	GST_C_Beta GST_C family, Class Beta subfamily; GST	99.11
cd03198		134	GST_C_CLIC GST_C family, Chloride Intracellular Ch	99.1
cd03201		121	GST_C_DHAR GST_C family, Dehydroascorbate Reductas	99.08
cd03186		107	GST_C_SspA GST_N family, Stringent starvation prot	99.08
cd03181		123	GST_C_EFB1gamma GST_C family, Gamma subunit of Elo	99.07
cd03207		103	GST_C_8 GST_C family, unknown subfamily 8; compose	99.07
cd03202		124	GST_C_etherase_LigE GST_C family, Beta etherase Li	99.06
cd03206		100	GST_C_7 GST_C family, unknown subfamily 7; compose	99.05
cd03190		142	GST_C_ECM4_like GST_C family, ECM4-like subfamily;	99.05
cd03189		119	GST_C_GTT1_like GST_C family, Saccharomyces cerevi	99.04
cd03185		126	GST_C_Tau GST_C family, Class Tau subfamily; GSTs	99.04
KOG0867\|consensus		226		99.03
cd03178		113	GST_C_Ure2p_like GST_C family, Ure2p-like subfamil	99.03
cd03210		126	GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar	99.03
cd03204		111	GST_C_GDAP1 GST_C family, Ganglioside-induced diff	99.01
PLN02395		215	glutathione S-transferase	99.01
cd03183		126	GST_C_Theta GST_C family, Class Theta subfamily; c	99.0
cd03184		124	GST_C_Omega GST_C family, Class Omega subfamily; G	98.99
cd03208		137	GST_C_Alpha GST_C family, Class Alpha subfamily; G	98.99
PRK13972		215	GSH-dependent disulfide bond oxidoreductase; Provi	98.98
cd03182		117	GST_C_GTT2_like GST_C family, Saccharomyces cerevi	98.98
cd03203		120	GST_C_Lambda GST_C family, Class Lambda subfamily;	98.94
cd00299		100	GST_C_family Glutathione S-transferase (GST) famil	98.94
cd03191		121	GST_C_Zeta GST_C family, Class Zeta subfamily; GST	98.94
PRK09481		211	sspA stringent starvation protein A; Provisional	98.91
PRK10542		201	glutathionine S-transferase; Provisional	98.89
PTZ00057		205	glutathione s-transferase; Provisional	98.89
PRK10387		210	glutaredoxin 2; Provisional	98.87
TIGR01262		210	maiA maleylacetoacetate isomerase. Maleylacetoacet	98.85
cd03200		96	GST_C_JTV1 GST_C family, JTV-1 subfamily; composed	98.82
cd03179		105	GST_C_1 GST_C family, unknown subfamily 1; compose	98.81
cd03192		104	GST_C_Sigma_like GST_C family, Class Sigma_like; c	98.79
cd03195		114	GST_C_4 GST_C family, unknown subfamily 4; compose	98.76
PLN02378		213	glutathione S-transferase DHAR1	98.74
PRK11752		264	putative S-transferase; Provisional	98.74
TIGR00862		236	O-ClC intracellular chloride channel protein. Thes	98.7
cd03194		114	GST_C_3 GST_C family, unknown subfamily 3; compose	98.68
PRK10357		202	putative glutathione S-transferase; Provisional	98.67
cd03197		149	GST_C_mPGES2 GST_C family; microsomal Prostaglandi	98.66
COG0625		211	Gst Glutathione S-transferase [Posttranslational m	98.65
PLN02817		265	glutathione dehydrogenase (ascorbate)	98.65
TIGR02182		209	GRXB Glutaredoxin, GrxB family. This model include	98.62
PRK15113		214	glutathione S-transferase; Provisional	98.6
cd03205		98	GST_C_6 GST_C family, unknown subfamily 6; compose	98.49
KOG0406\|consensus		231		98.35
PLN02907		722	glutamate-tRNA ligase	98.34
KOG4420\|consensus		325		98.03
COG0435		324	ECM4 Predicted glutathione S-transferase [Posttran	98.03
KOG1695\|consensus		206		97.76
KOG0868\|consensus		217		97.58
KOG2903\|consensus		319		97.47
KOG3029\|consensus		370		96.89
KOG1422\|consensus		221		96.65
PF04399		132	Glutaredoxin2_C: Glutaredoxin 2, C terminal domain	96.64
PF14834		117	GST_C_4: Glutathione S-transferase, C-terminal dom	96.52
cd03199		128	GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub	95.9
KOG1147\|consensus		712		93.07
KOG1668\|consensus		231		80.8

>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait	Back alignment and domain information

Probab=99.93  E-value=1.9e-25  Score=167.72  Aligned_cols=121  Identities=26%  Similarity=0.371  Sum_probs=100.8

Q ss_pred             CcccCcCchhhhhhhhhhhhhhhccCCCchhHHHHHHHHHHHHHhhhhhhccCCCCCHHHHHHHHHhHHHHHHHhhCCCc
Q psy2680           1 MSWRTKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKA   80 (178)
Q Consensus         1 ~~~~~~~~~~~~~~~~v~~~~~~~~~lP~~~~~~l~~~~~rr~~~~~l~~~Gig~~~~eei~~~~~~~L~~Le~~L~~~~   80 (178)
                      .|+|..|...+.+.+       |++.+|+|++ .++++.+|+.+.+.|.+||+|+++.+++++.+.++|++||++||+++
T Consensus         6 ~w~d~~~~~~~~~~~-------~~~~~p~~l~-~~~~~~~r~~~~~~l~~~G~gr~~~ee~~~~~~~~l~aLs~~Lg~~~   77 (126)
T cd03211           6 SWCDEETYDEVTKPR-------YGSPYPWPLN-HILPYQKQREARRKLKAIGWDDKTLDQVIEEVDQCCQALSQRLGTQP   77 (126)
T ss_pred             hccCcchHHHHhHHH-------HccCCCHHHH-HHHHHHHHHHHHHHHHhcCCCCCCHHHHHHHHHHHHHHHHHHHCCCC
Confidence            366666555565544       4448999955 55566699999999999999999999999999999999999999999


Q ss_pred             cccCCCcchhhhhHHHHHHHHHhhccCCCchhhHHHhhcCHHHHHHHHHHH
Q psy2680          81 FFFGEEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIK  131 (178)
Q Consensus        81 yl~Gd~pT~aDa~vf~~L~~~~~~~~~~~~~l~~~l~~~~PnL~~y~eR~~  131 (178)
                      ||+||+||++||++|++++.+...++ .++++...+ ++||||++||+||.
T Consensus        78 ~l~Gd~pT~~Da~vf~~la~~~~~~~-~~~~l~~~~-~~~pnL~~y~~Ri~  126 (126)
T cd03211          78 YFFGDQPTELDALVFGHLFTILTTQL-PNDELAEKV-KKYSNLLAFCRRIE  126 (126)
T ss_pred             CCCCCCCcHHHHHHHHHHHHHHhcCC-CChHHHHHH-HhCcHHHHHHHhcC
Confidence            99999999999999999999986532 234665544 89999999999983

Metaxin 2 shares sequence similarity with metaxin 1 but does not contain a C-terminal mitochondrial outer membrane signal-anchor domain. It associates with mitochondrial membranes through its interaction with metaxin 1, which is a component of the mitochondrial preprotein import complex of the outer membrane. The biological function of metaxin 2 is unknown. It is likely that it also plays a role in protein translocation into the mitochondria. However, this has not been experimentally validated. In a recent proteomics study, it has been shown that metaxin 2 is overexpressed in response to lipopolysaccharide-induced liver injury.

>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins	Back alignment and domain information

>KOG4244\|consensus	Back alignment and domain information

>KOG3028\|consensus	Back alignment and domain information

>KOG3027\|consensus	Back alignment and domain information

>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B	Back alignment and domain information

>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins	Back alignment and domain information

>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B	Back alignment and domain information

>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione	Back alignment and domain information

>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space	Back alignment and domain information

>PLN02473 glutathione S-transferase	Back alignment and domain information

>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins	Back alignment and domain information

>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins	Back alignment and domain information

>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant	Back alignment and domain information

>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E	Back alignment and domain information

>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis	Back alignment and domain information

>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor	Back alignment and domain information

>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4	Back alignment and domain information

>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>KOG0867\|consensus	Back alignment and domain information

>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs	Back alignment and domain information

>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells	Back alignment and domain information

>PLN02395 glutathione S-transferase	Back alignment and domain information

>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase	Back alignment and domain information

>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional	Back alignment and domain information

>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S	Back alignment and domain information

>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs	Back alignment and domain information

>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress	Back alignment and domain information

>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress	Back alignment and domain information

>PRK09481 sspA stringent starvation protein A; Provisional	Back alignment and domain information

>PRK10542 glutathionine S-transferase; Provisional	Back alignment and domain information

>PTZ00057 glutathione s-transferase; Provisional	Back alignment and domain information

>PRK10387 glutaredoxin 2; Provisional	Back alignment and domain information

>TIGR01262 maiA maleylacetoacetate isomerase	Back alignment and domain information

>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene	Back alignment and domain information

>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs	Back alignment and domain information

>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha	Back alignment and domain information

>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>PLN02378 glutathione S-transferase DHAR1	Back alignment and domain information

>PRK11752 putative S-transferase; Provisional	Back alignment and domain information

>TIGR00862 O-ClC intracellular chloride channel protein	Back alignment and domain information

>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs	Back alignment and domain information

>PRK10357 putative glutathione S-transferase; Provisional	Back alignment and domain information

>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2	Back alignment and domain information

>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN02817 glutathione dehydrogenase (ascorbate)	Back alignment and domain information

>TIGR02182 GRXB Glutaredoxin, GrxB family	Back alignment and domain information

>PRK15113 glutathione S-transferase; Provisional	Back alignment and domain information

>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs	Back alignment and domain information

>KOG0406\|consensus	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>KOG4420\|consensus	Back alignment and domain information

>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG1695\|consensus	Back alignment and domain information

>KOG0868\|consensus	Back alignment and domain information

>KOG2903\|consensus	Back alignment and domain information

>KOG3029\|consensus	Back alignment and domain information

>KOG1422\|consensus	Back alignment and domain information

>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors	Back alignment and domain information

>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A	Back alignment and domain information

>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E	Back alignment and domain information

>KOG1147\|consensus	Back alignment and domain information

>KOG1668\|consensus	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		178
3ubk_A		242	Glutathione transferase; GSH binding; 1.95A {Lepto	2e-05
3lxz_A		229	Glutathione S-transferase family protein; structur	7e-05
3niv_A		222	Glutathione S-transferase; structural genomics, PS	8e-05
2c4j_A		218	Glutathione S-transferase MU 2; glutathione transf	2e-04
1bg5_A		254	MAB, fusion protein of alpha-Na,K-ATPase with glut	2e-04
2c3n_A		247	Glutathione S-transferase theta 1; glutathione tra	2e-04
2cvd_A		198	Glutathione-requiring prostaglandin D synthase; gl	2e-04
1r5a_A		218	Glutathione transferase; glutathione S-transferase	2e-04
1gsu_A		219	GST, CGSTM1-1, class-MU glutathione S-transferase;	2e-04
2a2r_A		210	Glutathione S-transferase P; detoxification, nitri	3e-04
1yy7_A		213	SSPA, stringent starvation protein A; GST fold, tr	4e-04
3ir4_A		218	Glutaredoxin 2; glutathione, IDP00895, structural	5e-04
2gsq_A		202	Squid GST, glutathione S-transferase; squid digest	5e-04
4dej_A		231	Glutathione S-transferase related protein; transfe	5e-04
1n2a_A		201	Glutathione S-transferase; HET: GTS; 1.90A {Escher	6e-04
2vo4_A		219	2,4-D inducible glutathione S-transferase; herbici	7e-04
3lyp_A		215	Stringent starvation protein A; structural genomic	7e-04
3cbu_A		214	Probable GST-related protein; thioredoxin fold, GS	7e-04
3gtu_B		224	Glutathione S-transferase; conjugation, detoxifica	8e-04
1gwc_A		230	Glutathione S-transferase TSI-1; herbicide detoxif	8e-04
1b8x_A		280	Protein (AML-1B); nuclear matrix targeting signal	9e-04

>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242	Back alignment and structure

 Score = 42.4 bits (100), Expect = 2e-05
 Identities = 15/81 (18%), Positives = 32/81 (39%), Gaps = 7/81 (8%)

Query: 57  KPEEIEEFGKN---DLKVLADMLGDKAFFFGEEPTTLDVVAFAHIAQIYCIDKDV-EFPL 112
            PE +EE        +K L  ++    +  G   T  D   FAH++    +D+++  F  
Sbjct: 118 SPEIVEEVHSTLVKGIKALQRVVRFSPYIAGNVFTLADCSGFAHLS---VLDEELRPFYP 174

Query: 113 RDYLETTHSNLVAHINRIKNR 133
            ++     +    +   +K +
Sbjct: 175 NNHPLDLLNGWKEYFVFMKTK 195

PyMOL of 3ubk

>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229	Back alignment and structure

>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222	Back alignment and structure

>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218	Back alignment and structure

>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254	Back alignment and structure

>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247	Back alignment and structure

>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198	Back alignment and structure

>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218	Back alignment and structure

>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219	Back alignment and structure

>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210	Back alignment and structure

>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213	Back alignment and structure

>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218	Back alignment and structure

>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202	Back alignment and structure

>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231	Back alignment and structure

>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201	Back alignment and structure

>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219	Back alignment and structure

>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215	Back alignment and structure

>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214	Back alignment and structure

>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224	Back alignment and structure

>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230	Back alignment and structure

>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		178
4hi7_A		228	GI20122; GST, glutathione S-transferase, enzyme fu	99.41
3vk9_A		216	Glutathione S-transferase delta; glutathione bindi	99.33
4ikh_A		244	Glutathione S-transferase; enzyme function initiat	99.31
3lxz_A		229	Glutathione S-transferase family protein; structur	99.27
3ein_A		209	GST class-theta, glutathione S-transferase 1-1; de	99.27
3tou_A		226	Glutathione S-transferase protein; GSH binding sit	99.26
1aw9_A		216	Glutathione S-transferase III; herbicide detoxific	99.25
1gnw_A		211	Glutathione S-transferase; herbicide detoxificatio	99.25
4glt_A		225	Glutathione S-transferase-like protein; structural	99.25
1nhy_A		219	EF-1-gamma 1, elongation factor 1-gamma 1; protein	99.23
1axd_A		209	Glutathione S-transferase I; transferase, herbicid	99.23
2imi_A		221	Epsilon-class glutathione S-transferase; HET: GSH;	99.2
3n5o_A		235	Glutathione transferase; seattle structural genomi	99.2
3gx0_A		215	GST-like protein YFCG; transferase, glutathione, g	99.2
1ljr_A		244	HGST T2-2, glutathione S-transferase; HET: GSH; 3.	99.2
1r5a_A		218	Glutathione transferase; glutathione S-transferase	99.19
3m8n_A		225	Possible glutathione S-transferase; PSI-II, struct	99.17
3ibh_A		233	GST-II, saccharomyces cerevisiae GTT2; glutathione	99.17
3f6d_A		219	Adgstd4-4, glutathione transferase GST1-4; HET: GT	99.17
1pn9_A		209	GST class-delta, glutathione S-transferase 1-6; pr	99.16
3m3m_A		210	Glutathione S-transferase; PSI-II, structural geno	99.16
3ubk_A		242	Glutathione transferase; GSH binding; 1.95A {Lepto	99.16
4hz4_A		217	Glutathione-S-transferase; enzyme function initiat	99.16
3ay8_A		216	Glutathione S-transferase; GST fold, GST binding,	99.15
4exj_A		238	Uncharacterized protein; transferase-like protein,	99.15
3lsz_A		225	Glutathione S-transferase; xenobiotic, biodegradat	99.15
1dug_A		234	Chimera of glutathione S-transferase-synthetic lin	99.13
1v2a_A		210	Glutathione transferase GST1-6; glutathione S-tran	99.13
3niv_A		222	Glutathione S-transferase; structural genomics, PS	99.12
2cvd_A		198	Glutathione-requiring prostaglandin D synthase; gl	99.12
2x64_A		207	Glutathione-S-transferase; detoxification enzyme;	99.12
3iso_A		218	Putative glutathione transferase; GST; HET: GSH; 1	99.11
3qav_A		243	RHO-class glutathione S-transferase; cytosol; 2.10	99.11
2c4j_A		218	Glutathione S-transferase MU 2; glutathione transf	99.11
3cbu_A		214	Probable GST-related protein; thioredoxin fold, GS	99.11
1gsu_A		219	GST, CGSTM1-1, class-MU glutathione S-transferase;	99.11
4gci_A		211	Glutathione S-transferase; GST, enzyme function in	99.11
2fhe_A		216	GST, glutathione S-transferase; transferase-substr	99.11
4hz2_A		230	Glutathione S-transferase domain; glutathione,enzy	99.1
1yq1_A		208	Glutathione S-transferase; nematoda, structural ge	99.1
3q18_A		239	GSTO-2, glutathione S-transferase omega-2; glutath	99.1
4iel_A		229	Glutathione S-transferase, N-terminal domain PROT;	99.1
2pvq_A		201	Glutathione S-transferase; xenobiotics detoxificat	99.09
3gtu_B		224	Glutathione S-transferase; conjugation, detoxifica	99.09
3ik7_A		222	Glutathione S-transferase A4; human GST A4-4, enzy	99.08
2on7_A		206	Nagst-1, Na glutathione S-transferase 1; hookworm;	99.08
1n2a_A		201	Glutathione S-transferase; HET: GTS; 1.90A {Escher	99.08
2gsq_A		202	Squid GST, glutathione S-transferase; squid digest	99.08
2c3n_A		247	Glutathione S-transferase theta 1; glutathione tra	99.08
4ecj_A		244	Glutathione S-transferase; transferase-like protei	99.07
2uz8_A		174	Eukaryotic translation elongation factor 1 epsilon	99.06
3lyp_A		215	Stringent starvation protein A; structural genomic	99.06
2on5_A		206	Nagst-2, Na glutathione S-transferase 2; hookworm;	99.06
1tw9_A		206	Glutathione S-transferase 2; 1.71A {Heligmosomoide	99.05
3m0f_A		213	Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu	99.05
2v6k_A		214	Maleylpyruvate isomerase; glutathione-S-transferas	99.05
2dsa_A		203	Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu	99.05
1k3y_A		221	GSTA1-1, glutathione S-transferase A1; S-hexyl glu	99.04
4gf0_A		215	Glutathione S-transferase; GST, enzyme function in	99.04
3lyk_A		216	Stringent starvation protein A homolog; structural	99.04
1zl9_A		207	GST class-sigma, glutathione S-transferase 5; glut	99.04
4g0i_A		328	Protein YQJG; glutathionyl-hydroquinone reductase,	99.03
1pmt_A		203	PMGST, GST B1-1, glutathione transferase; glutathi	99.03
3r2q_A		202	Uncharacterized GST-like protein YIBF; transferase	99.02
2wb9_A		211	Glutathione transferase sigma class; thioredoxin f	99.02
2ycd_A		230	Glutathione S-transferase; SOIL bacteria, herbicid	99.02
2vo4_A		219	2,4-D inducible glutathione S-transferase; herbici	99.02
4g10_A		265	Glutathione S-transferase homolog; thioredoxin fol	99.01
1f2e_A		201	Glutathione S-transferase; GST complexed with glut	99.01
2a2r_A		210	Glutathione S-transferase P; detoxification, nitri	99.01
3uar_A		227	Glutathione S-transferase; GSH binding site; HET:	99.01
2hnl_A		225	Glutathione S-transferase 1; prostaglandin synthas	99.0
4hoj_A		210	REGF protein; GST, glutathione S-transferase, enzy	99.0
1vf1_A		229	Glutathione S-transferase 3; detoxification; HET:	98.99
1tu7_A		208	Glutathione S-transferase 2; HET: GSH; 1.50A {Onch	98.99
1okt_A		211	Glutathione S-transferase; GST; 1.9A {Plasmodium f	98.99
1b48_A		221	GST, mgsta4-4, protein (glutathione S-transferase)	98.98
3vln_A		241	GSTO-1, glutathione S-transferase omega-1; GST fol	98.98
3c8e_A		288	YGHU, glutathione S-transferase homologue; glutath	98.97
2cz2_A		223	Maleylacetoacetate isomerase; structural genomics,	98.97
4fqu_A		313	Putative glutathione transferase; glutathionyl-hyd	98.97
3h1n_A		252	Probable glutathione S-transferase; APC84167, bord	98.97
1m0u_A		249	GST2 gene product; flight muscle protein, sigma, t	98.97
3bby_A		215	Uncharacterized GST-like protein YFCF; NP_416804.1	98.96
1e6b_A		221	Glutathione S-transferase; 1.65A {Arabidopsis thal	98.95
1oe8_A		211	Glutathione S-transferase; schistosomiasis, detoxi	98.93
3fy7_A		250	Chloride intracellular channel protein 3; GST, glu	98.93
2hra_A		209	Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l	98.92
1b8x_A		280	Protein (AML-1B); nuclear matrix targeting signal	98.92
1gwc_A		230	Glutathione S-transferase TSI-1; herbicide detoxif	98.92
1yy7_A		213	SSPA, stringent starvation protein A; GST fold, tr	98.9
4dej_A		231	Glutathione S-transferase related protein; transfe	98.9
1k0m_A		241	CLIC1, NCC27, chloride intracellular channel prote	98.89
3rbt_A		246	Glutathione transferase O1; glutathione S-transfer	98.88
3ic8_A		310	Uncharacterized GST-like proteinprotein; glutathio	98.86
2r4v_A		247	XAP121, chloride intracellular channel protein 2;	98.85
1oyj_A		231	Glutathione S-transferase; herbicide detoxificatio	98.85
2ws2_A		204	NU-class GST, glutathione S-transferase; parasite,	98.84
2ahe_A		267	Chloride intracellular channel protein 4; glutathi	98.84
4id0_A		214	Glutathione S-transferase-like protein YIBF; GST,	98.83
3m1g_A		362	Putative glutathione S-transferase; ECM4-like subf	98.83
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	98.82
2yv7_A		260	CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c	98.78
2yv9_A		291	Chloride intracellular channel EXC-4; chloride ION	98.78
1k0d_A		260	URE2 protein; nitrate assimilation, structural gen	98.77
2hqt_A		124	GU4 nucleic-binding protein 1; GST-fold, biosynthe	98.75
3ppu_A		352	Glutathione-S-transferase; GST fold; HET: GSH; 2.3	98.74
1bg5_A		254	MAB, fusion protein of alpha-Na,K-ATPase with glut	98.71
1z9h_A		290	Membrane-associated prostaglandin E synthase-2; me	98.65
2fno_A		248	AGR_PAT_752P; thioredoxin fold, GST C-terminal dom	98.63
3ir4_A		218	Glutaredoxin 2; glutathione, IDP00895, structural	98.61
4ags_A		471	Thiol-dependent reductase 1; transferase, leishman	98.6
4f03_A		253	Glutathione transferase; GST fold; 1.80A {Phaneroc	98.44
4akg_A		2695	Glutathione S-transferase class-MU 26 kDa isozyme	98.38
2hsn_A		160	Methionyl-tRNA synthetase, cytoplasmic; protein co	95.1

>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis}	Back alignment and structure

Probab=99.41  E-value=2.7e-13  Score=107.55  Aligned_cols=120  Identities=17%  Similarity=0.243  Sum_probs=82.5

Q ss_pred             CcCchhhhhhhhhhhhhhhccCCCchhHHHHHHHHHHHHHhhhhhhccCCCCCHHHHHHHHHhHHHHHHHhhCCCccccC
Q psy2680           5 TKYPDNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFG   84 (178)
Q Consensus         5 ~~~~~~~~~~~~v~~~~~~~~~lP~~~~~~l~~~~~rr~~~~~l~~~Gig~~~~eei~~~~~~~L~~Le~~L~~~~yl~G   84 (178)
                      .++|.+...++.|++...+....-++   ..     .+.+.......+.. ...++..+.+.+.|+.||++|++++||+|
T Consensus        84 ~L~p~d~~~~~~~~~~~~~~~~~~~~---~~-----~~~~~~~~~~~~~~-~~~~~~~~~~~~~l~~le~~L~~~~~l~G  154 (228)
T 4hi7_A           84 SLYPKDLVKRALVDNRMYFESGVVFA---NA-----LRSLAKMILFLGKT-EVPQERIDAITEAYDFVEAFFKDQTYVAG  154 (228)
T ss_dssp             TTSCSSHHHHHHHHHHHHHHHHTTTT---TT-----HHHHHHHHHTSCCC-EEEHHHHHHHHHHHHHHHHHHTTCSBTTB
T ss_pred             CCCchhHHHHHHhhchhhhhhhhhcc---hh-----hhhhhhhccccccc-chhHHHHHHHHHHHHHHHHHHcccccccC
Confidence            47888888888888766554221111   00     01111111111221 12344667788999999999999999999


Q ss_pred             CCcchhhhhHHHHHHHHHhhccCCCchhhHHHhhcCHHHHHHHHHHHhhcCCChhhhhh
Q psy2680          85 EEPTTLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRCFPDWDDICN  143 (178)
Q Consensus        85 d~pT~aDa~vf~~L~~~~~~~~~~~~~l~~~l~~~~PnL~~y~eR~~~r~~p~~~~~~~  143 (178)
                      +++|+||+++++++..+...   .+..     .++||+|.+|++||.++  |+|++...
T Consensus       155 ~~~t~ADi~l~~~l~~~~~~---~~~~-----~~~~P~l~~w~~r~~~r--Pa~~e~~~  203 (228)
T 4hi7_A          155 NQLTIADFSLISSISSLVAF---VPVD-----AAKYPKLSAWIKRLEQL--PYYAENST  203 (228)
T ss_dssp             SSCCHHHHHHHHHHHHHTTT---SCCC-----TTTCHHHHHHHHHHTTS--TTTHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHHHh---CCCC-----chhCHHHHHHHHHHHcC--HHHHHhch
Confidence            99999999999999876544   1112     26899999999999999  99988554

PyMOL of 4hi7

>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori}	Back alignment and structure

>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens}	Back alignment and structure

>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A*	Back alignment and structure

>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A*	Back alignment and structure

>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A*	Back alignment and structure

>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A*	Back alignment and structure

>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus}	Back alignment and structure

>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A*	Back alignment and structure

>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A*	Back alignment and structure

>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A*	Back alignment and structure

>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli}	Back alignment and structure

>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A*	Back alignment and structure

>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris}	Back alignment and structure

>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A*	Back alignment and structure

>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A*	Back alignment and structure

>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens}	Back alignment and structure

>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A*	Back alignment and structure

>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae}	Back alignment and structure

>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori}	Back alignment and structure

>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239}	Back alignment and structure

>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides}	Back alignment and structure

>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A*	Back alignment and structure

>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp}	Back alignment and structure

>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1*	Back alignment and structure

>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa}	Back alignment and structure

>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis}	Back alignment and structure

>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A*	Back alignment and structure

>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ...	Back alignment and structure

>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha}	Back alignment and structure

>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A*	Back alignment and structure

>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A*	Back alignment and structure

>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A*	Back alignment and structure

>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus}	Back alignment and structure

>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans}	Back alignment and structure

>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A*	Back alignment and structure

>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria}	Back alignment and structure

>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A*	Back alignment and structure

>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A*	Back alignment and structure

>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus}	Back alignment and structure

>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A*	Back alignment and structure

>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A*	Back alignment and structure

>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A	Back alignment and structure

>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A*	Back alignment and structure

>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens}	Back alignment and structure

>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A	Back alignment and structure

>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus}	Back alignment and structure

>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A*	Back alignment and structure

>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A*	Back alignment and structure

>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A*	Back alignment and structure

>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ...	Back alignment and structure

>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter}	Back alignment and structure

>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae}	Back alignment and structure

>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans}	Back alignment and structure

>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A*	Back alignment and structure

>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A*	Back alignment and structure

>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli}	Back alignment and structure

>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A*	Back alignment and structure

>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A	Back alignment and structure

>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A*	Back alignment and structure

>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis}	Back alignment and structure

>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ...	Back alignment and structure

>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A*	Back alignment and structure

>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus}	Back alignment and structure

>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae}	Back alignment and structure

>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A	Back alignment and structure

>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A*	Back alignment and structure

>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A*	Back alignment and structure

>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A	Back alignment and structure

>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A*	Back alignment and structure

>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli}	Back alignment and structure

>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A*	Back alignment and structure

>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum}	Back alignment and structure

>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50}	Back alignment and structure

>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli}	Back alignment and structure

>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A*	Back alignment and structure

>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A	Back alignment and structure

>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A	Back alignment and structure

>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis}	Back alignment and structure

>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis}	Back alignment and structure

>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A	Back alignment and structure

>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori}	Back alignment and structure

>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV}	Back alignment and structure

>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A*	Back alignment and structure

>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus}	Back alignment and structure

>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A	Back alignment and structure

>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A*	Back alignment and structure

>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum}	Back alignment and structure

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum}	Back alignment and structure

>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster}	Back alignment and structure

>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A	Back alignment and structure

>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B	Back alignment and structure

>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium}	Back alignment and structure

>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A*	Back alignment and structure

>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5	Back alignment and structure

>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A	Back alignment and structure

>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum}	Back alignment and structure

>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A*	Back alignment and structure

>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A	Back alignment and structure

>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae}	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		178
d1r5aa1		129	Class delta GST {Mosquito (Anopheles dirus b), iso	99.63
d1v2aa1		125	Class delta GST {Mosquito (Anopheles dirus b), iso	99.61
d1axda1		129	Class phi GST {Maize (Zea mays), type I [TaxId: 45	99.59
d1jlva1		123	Class delta GST {Mosquito (Anopheles dirus b), iso	99.57
d1jlwa1		127	Class delta GST {Mosquito (Anopheles dirus b), iso	99.56
d1gnwa1		126	Class phi GST {Mouse-ear cress (Arabidopsis thalia	99.56
d1ljra1		165	Class theta GST {Human (Homo sapiens) [TaxId: 9606	99.5
d1nhya1		144	GST-like domain of elongation factor 1-gamma {Bake	99.44
d1aw9a1		135	Class phi GST {Maize (Zea mays), type III [TaxId:	99.44
d1k0da1		151	Yeast prion protein ure2p, nitrogen regulation fra	99.4
d1e6ba1		133	Class zeta GST {Mouse-ear cress (Arabidopsis thali	99.37
d1n2aa1		121	Class beta GST {Escherichia coli [TaxId: 562]}	99.29
d1fw1a1		125	Class zeta GST {Human (Homo sapiens) [TaxId: 9606]	99.29
d2cvda1		124	Class sigma GST {Human (Homo sapiens) [TaxId: 9606	99.27
d1f2ea1		121	Class beta GST {Sphingomonas paucimobilis [TaxId:	99.25
d2gsqa1		127	Class sigma GST {Squid (Ommastrephes sloani pacifi	99.23
d1k3ya1		142	Class alpha GST {Human (Homo sapiens), (a1-1) [Tax	99.22
d1pmta1		121	Class beta GST {Proteus mirabilis [TaxId: 584]}	99.22
d2a2ra1		132	Class pi GST {Human (Homo sapiens) [TaxId: 9606]}	99.19
d2c4ja1		133	Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	99.18
d2gsta1		133	Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011	99.16
d1gula1		140	Class alpha GST {Human (Homo sapiens), (a1-1) [Tax	99.15
d1gsua1		133	Class mu GST {Chicken (Gallus gallus) [TaxId: 9031	99.14
d3gtub1		140	Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	99.12
d1duga1		140	Class alpha GST {Schistosoma japonicum [TaxId: 618	99.09
d1gwca1		138	Class tau GST {Aegilops tauschii, also known as Tr	99.08
d1tw9a1		129	Class sigma GST {Heligmosomoides polygyrus [TaxId:	99.07
d1eema1		139	Class omega GST {Human (Homo sapiens) [TaxId: 9606	99.06
d1m0ua1		127	Class sigma GST {Fruit fly (Drosophila melanogaste	99.05
d1b48a1		143	Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax	99.03
d2fhea1		136	Class alpha GST {Fasciola hepatica [TaxId: 6192]}	99.02
d1okta1		126	Pf GST {Malarial parasite (Plasmodium falciparum)	99.0
d2hrkb1		118	GU4 nucleic-binding protein 1, Arc1p {Baker's yeas	98.91
d1tu7a1		131	Class pi GST {Onchocerca volvulus [TaxId: 6282]}	98.85
d1k0ma1		149	Chloride intracellular channel 1 (clic1) {Human (H	98.85
d1oe8a1		123	Class alpha GST {Blood fluke (Schistosoma haematob	98.73
d1oyja1		145	Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	98.66
d1z9ha1		161	Microsomal prostaglandin E synthase-2 {Crab-eating	98.64
d1g7oa1		140	Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	95.68
d2fnoa1		149	Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac	94.67

>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]}	Back information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]

Probab=99.63  E-value=4.7e-16  Score=113.15  Aligned_cols=115  Identities=13%  Similarity=0.101  Sum_probs=86.1

Q ss_pred             hhhhhhhhhhhhhhhccCCCchhHHHHHHHHHHHHHhhhhhhccCCCCCHHHHHHHHHhHHHHHHHhhCCCccccCCCcc
Q psy2680           9 DNVIKGYKVNLQHALGTRIPNGLLNFFFKFNYVRKGTKKVKAQGIGVHKPEEIEEFGKNDLKVLADMLGDKAFFFGEEPT   88 (178)
Q Consensus         9 ~~~~~~~~v~~~~~~~~~lP~~~~~~l~~~~~rr~~~~~l~~~Gig~~~~eei~~~~~~~L~~Le~~L~~~~yl~Gd~pT   88 (178)
                      ||+.+|+.||+.++|..+       .+++. +.+.+......   +....++..+.+.+.|+.||.+|++++||+||++|
T Consensus         1 kD~k~RA~v~q~L~f~~~-------~l~~~-~~~~~~~~~~~---~~~~~~~~~~~~~~~l~~le~~L~~~~yl~Gd~~S   69 (129)
T d1r5aa1           1 KDFRSRAIVDQRLHFDLG-------TLYQR-VVDYYFPTIHL---GAHLDQTKKAKLAEALGWFEAMLKQYQWSAANHFT   69 (129)
T ss_dssp             SSHHHHHHHHHHHHHHHH-------THHHH-HHHHHHHHHHH---CCCCCHHHHHHHHHHHHHHHHHTTTSSSSSSSSCC
T ss_pred             CCHHHHHHHHHHHHHHHh-------hHHHH-HHHHHHHHHhc---CCcchHHHHHHHHHHHHHHHHHHccCCCcccCCCc
Confidence            688999999999998743       34444 33333333321   22344557788999999999999999999999999


Q ss_pred             hhhhhHHHHHHHHHhhccCCCchhhHHHhhcCHHHHHHHHHHHhhc-CCChhhhhh
Q psy2680          89 TLDVVAFAHIAQIYCIDKDVEFPLRDYLETTHSNLVAHINRIKNRC-FPDWDDICN  143 (178)
Q Consensus        89 ~aDa~vf~~L~~~~~~~~~~~~~l~~~l~~~~PnL~~y~eR~~~r~-~p~~~~~~~  143 (178)
                      +||+++++.+..+....    .+     ...||||.+|++||+++. .|.+++++.
T Consensus        70 iADi~l~~~~~~~~~~~----~~-----~~~~p~l~~w~~r~~~~~~~~~~~e~n~  116 (129)
T d1r5aa1          70 IADIALCVTVSQIEAFQ----FD-----LHPYPRVRAWLLKCKDELEGHGYKEINE  116 (129)
T ss_dssp             HHHHHHHHHHHHHHHTT----CC-----CTTCHHHHHHHHHHHHHHGGGTHHHHHH
T ss_pred             HHHHHHHHHHHHHHHcC----CC-----hhhChHHHHHHHHHHhcccCccHHHHHH
Confidence            99999999999876652    12     278999999999999873 355666543

PyMOL of d1r5aa1

>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]}	Back information, alignment and structure

>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]}	Back information, alignment and structure

>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}	Back information, alignment and structure

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}	Back information, alignment and structure

>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]}	Back information, alignment and structure

>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]}	Back information, alignment and structure

>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]}	Back information, alignment and structure

>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}	Back information, alignment and structure

>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]}	Back information, alignment and structure

>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]}	Back information, alignment and structure

>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]}	Back information, alignment and structure

>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}	Back information, alignment and structure

>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]}	Back information, alignment and structure

>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]}	Back information, alignment and structure

>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}	Back information, alignment and structure

>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]}	Back information, alignment and structure

>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]}	Back information, alignment and structure

>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]}	Back information, alignment and structure

>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]}	Back information, alignment and structure

>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}	Back information, alignment and structure

>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]}	Back information, alignment and structure

>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]}	Back information, alignment and structure

>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]}	Back information, alignment and structure