Psyllid ID: psy2688


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580------
MAHINKCISIFKNVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVVVPEDTTGLKINGKTMNKIIIPIMWVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQ
ccccccccccccccccccccccccccccEEEEEEccccEEEcccccEEEEEcEEEEEEcccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccEEEEEEccccccHHHHHHHHHHcccccEEEEEccccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHccccccHHHHHccccccccccccccEEEEEEcHHHHHcccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHccccHHHHccccccccHHHccccccccccccccccccccccEEEEEcccEEEEEcEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEccccccHHHHHHHHHcccccEEEEEEcccccc
ccHHHHHHHHHHHHHHHcccHHcccccccccccccccHHEEEHHHHHHHHHHHHHHEEccccccccccccccccHcccccccEEccccccccccccccccEEEEccccccccEEEEEEEccccHHHHHHHHHHHcccccEEEEEccccHHccccccccEcEEEEEEcccccEEcccHHHHHHHHHHHHccccccHHHHHHHccccEEEcccccEEEEEcccEEEEccccccHHHHHHHHHHHHHHHHHHHcEEEEccccccccHHHHHHHHHHHHcccccccHHHEEEHHHHHHHHHHHHcccccccHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHcHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHcccccccEEEEcccHcccccccccEccHcccHHEEEEEHEHEHHHcHEEEEcccccccccccccccccccccccccEEEEEEEccccccccHHccccccccccccEEEEccccccccEEEEEEEcccccHHHHHHHHHHcccccEEEEEcccccc
MAHINKCISIFKNVlrcngrrflstrppivqasffgnpiviGLGLGVGSALGYAYYTnvslepvfnemantqpvlesfpegiKVSRKVCTKLLLCTLENMFqvvvpedttglkitlfqyptcpfcckvrAFLDYYGVSYDIVEVNAVLRQQIkwssykkvpillvkvpngyqqmndSSMIVSCLASYLSDTSVQLEEVasyfpeteyrdddgtvKKEIMNRYFLMLNdrmngrtvkdIMDERKWRKWADQVLVHtlspnvyrtKEEALQSFEWfseeqgrgqkhLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEkrengpffggqkpnladLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLrcngrrflstrppivqasffgnpiviGLGLGVGSALGYAYYTnvslepvfnemantqpvlesfpegikvsrkvvvpedttglkingktmnkiIIPIMWvvvpedttglkitlfqyptcpfcckvrAFLDYYGVSYDIVEVNAVLRQ
MAHINKCISIFKNVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEvasyfpeteyrdddgtvkKEIMNRYFlmlndrmngrtVKDIMDERKWRKWADQVLvhtlspnvyrTKEEALQSFEWFSeeqgrgqkhLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLesfpegikvsrkvvvpedttglkingktmnkiiiPIMWVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQ
MAHINKCISIFKNVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVVVPEDTTGLKINGKTMNKIIIPIMWVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQ
***INKCISIFKNVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVVVPEDTTGLKINGKTMNKIIIPIMWVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVL**
********SIFKNVLRCN***************FFGNPIVIGLGLGVGSALGYAYYT************************IKVSRKVCTK**********************ITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQI**SSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFP*TE***DDGTVKKEIMNRYFL*****************RKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRE***FFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRT******************************************GNPIVIGLGLGVGSALGYAYYTNVSL*********************************TG****************************ITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVL**
MAHINKCISIFKNVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVVVPEDTTGLKINGKTMNKIIIPIMWVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQ
*AHINKCISIFKNVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPV*****NTQPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVVVPEDTTGLKINGKTMNKIIIPIMWVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVL**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAHINKCISIFKNVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYVKHFATQKANVLRCNGRRFLSTRPPIVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQPVLESFPEGIKVSRKVVVPEDTTGLKINGKTMNKIIIPIMWVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query586 2.2.26 [Sep-21-2011]
Q8BWM0384 Prostaglandin E synthase yes N/A 0.459 0.700 0.447 6e-69
Q9N0A4377 Prostaglandin E synthase N/A N/A 0.462 0.718 0.438 1e-68
Q9H7Z7377 Prostaglandin E synthase yes N/A 0.462 0.718 0.432 3e-67
Q7ZUC7377 Prostaglandin E synthase yes N/A 0.462 0.718 0.440 5e-67
Q66LN079 Prostaglandin E synthase no N/A 0.088 0.658 0.452 3e-05
>sp|Q8BWM0|PGES2_MOUSE Prostaglandin E synthase 2 OS=Mus musculus GN=Ptges2 PE=1 SV=3 Back     alignment and function desciption
 Score =  262 bits (669), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 189/317 (59%), Gaps = 48/317 (15%)

Query: 109 TTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVP 168
           +  L++TL+QY TCPFC KVRAFLD++ + Y +VEVN V R +IK+SSY+KVPIL+ +  
Sbjct: 96  SNSLQLTLYQYKTCPFCSKVRAFLDFHSLPYQVVEVNPVRRTEIKFSSYRKVPILVAQEG 155

Query: 169 NGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLND 228
           +  QQ+NDSS+I+S L +YL  +   LEEV +Y+P  +  +D G    E  N+Y+LML++
Sbjct: 156 DSLQQLNDSSVIISALKTYLV-SGQPLEEVITYYPPMKAMNDQGKEVTEFCNKYWLMLDE 214

Query: 229 R-----MNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQK 283
           +       G+  +   +E KWR+WAD  LVH +SPNVYRT  EAL SF++   E      
Sbjct: 215 KEAQQMYGGKEAR--TEEMKWRQWADDWLVHLISPNVYRTPAEALASFDYIVRE------ 266

Query: 284 HLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKK 343
                                             F   E  +  YVGA AMY ISKRLK 
Sbjct: 267 --------------------------------GKFGAVEAAMAKYVGAAAMYLISKRLKS 294

Query: 344 RHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDL 403
           RH+L+++VR  LY+  N+WV  + K  + PF GGQKPNLADLAVYGVL  +EG EAF DL
Sbjct: 295 RHHLQDDVRVDLYEAANKWVTAVGK--DRPFMGGQKPNLADLAVYGVLRVMEGLEAFDDL 352

Query: 404 MAKSKIKPWYERMRTNV 420
           M  S I+PWY RM   +
Sbjct: 353 MRHSHIQPWYLRMERAI 369




Isomerase that catalyzes the conversion of unstable intermediate of prostaglandin E2 H2 (PGH2) into the more stable prostaglandin E2 (PGE2) form (By similarity). May also have transactivation activity toward IFN-gamma (IFNG), possibly via an interaction with CEBPB; however, the relevance of transcription activation activity remains unclear.
Mus musculus (taxid: 10090)
EC: 5EC: .EC: 3EC: .EC: 9EC: 9EC: .EC: 3
>sp|Q9N0A4|PGES2_MACFA Prostaglandin E synthase 2 OS=Macaca fascicularis GN=PTGES2 PE=1 SV=1 Back     alignment and function description
>sp|Q9H7Z7|PGES2_HUMAN Prostaglandin E synthase 2 OS=Homo sapiens GN=PTGES2 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZUC7|PGES2_DANRE Prostaglandin E synthase 2 OS=Danio rerio GN=ptges2 PE=2 SV=1 Back     alignment and function description
>sp|Q66LN0|PGES2_BOVIN Prostaglandin E synthase 2 (Fragments) OS=Bos taurus GN=PTGES2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query586
340730193397 PREDICTED: LOW QUALITY PROTEIN: prostagl 0.593 0.876 0.467 1e-100
350396023397 PREDICTED: prostaglandin E synthase 2-li 0.593 0.876 0.467 1e-99
383863121397 PREDICTED: prostaglandin E synthase 2-li 0.626 0.924 0.460 1e-99
242023805412 Prostaglandin E synthase 2, putative [Pe 0.583 0.830 0.482 2e-99
307189400358 Prostaglandin E synthase 2 [Camponotus f 0.569 0.932 0.487 2e-99
91078348386 PREDICTED: similar to prostaglandin E sy 0.624 0.948 0.457 2e-98
380017895369 PREDICTED: prostaglandin E synthase 2-li 0.593 0.943 0.470 2e-98
332026259396 Prostaglandin E synthase 2 [Acromyrmex e 0.621 0.919 0.467 2e-97
157119740392 hypothetical protein AaeL_AAEL008783 [Ae 0.569 0.852 0.471 1e-94
170035627400 prostaglandin E synthase 2 [Culex quinqu 0.612 0.897 0.448 2e-94
>gi|340730193|ref|XP_003403370.1| PREDICTED: LOW QUALITY PROTEIN: prostaglandin E synthase 2-like [Bombus terrestris] Back     alignment and taxonomy information
 Score =  372 bits (956), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/404 (46%), Positives = 255/404 (63%), Gaps = 56/404 (13%)

Query: 29  IVQASFFGNPIVIGLGLGVGSALGYAYYTNVSLEPVFNEMANTQP--VLESFPEGIKVSR 86
           + +AS  G  I IG  +G+    GY++Y ++ +   F+     +   VL+  P  + VSR
Sbjct: 44  VFKASLVG--ISIGFPVGIAITTGYSWYKDMEVSKTFHLQGKEEKIKVLKEKPP-VPVSR 100

Query: 87  KVCTKLLLCTLENMFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNA 146
                          +++ P DTT LK+TL+QY TCPFCCKVR FLDYYG+SY+IVEV+ 
Sbjct: 101 ---------------EIIFPMDTTELKLTLYQYQTCPFCCKVRVFLDYYGISYEIVEVDP 145

Query: 147 VLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETE 206
           VLR++I WSSYKKVPILL +V +GYQ +NDSSMI+S LASYL + S ++ ++  Y+P   
Sbjct: 146 VLRKEISWSSYKKVPILLAQVDSGYQPLNDSSMIISLLASYLKERSQKINDLIEYYPSIA 205

Query: 207 YRDDDGTVKKEIMNRYFLMLNDRMNGRTVKD-IMDERKWRKWADQVLVHTLSPNVYRTKE 265
             D++G +K EIMN+YFLM  D +    + D IM+ERKWRKW D   VHTLSPNVYRT +
Sbjct: 206 MHDENGRLKYEIMNKYFLMYQDNLPANKIMDKIMEERKWRKWVDDEFVHTLSPNVYRTLD 265

Query: 266 EALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLL 325
           EA ++F WFSE                                  VG+W+++F +WERL+
Sbjct: 266 EAYKTFNWFSE----------------------------------VGKWEEYFPRWERLI 291

Query: 326 MVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADL 385
           M+ VGA AM+ ISKR KKRH+LK++VR+SLYDE N+W+  I K   G F GG++PNL+DL
Sbjct: 292 MINVGATAMWLISKRXKKRHHLKQDVRQSLYDEINKWINAINK-HGGTFMGGEQPNLSDL 350

Query: 386 AVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNEYV 429
           AVYGVL SIEGC AFKD +  + +  WY  M   V  H G++Y+
Sbjct: 351 AVYGVLKSIEGCSAFKDALNNTNLSTWYNAMTKEVETHSGSKYL 394




Source: Bombus terrestris

Species: Bombus terrestris

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350396023|ref|XP_003484412.1| PREDICTED: prostaglandin E synthase 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383863121|ref|XP_003707031.1| PREDICTED: prostaglandin E synthase 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|242023805|ref|XP_002432321.1| Prostaglandin E synthase 2, putative [Pediculus humanus corporis] gi|212517744|gb|EEB19583.1| Prostaglandin E synthase 2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307189400|gb|EFN73810.1| Prostaglandin E synthase 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|91078348|ref|XP_973652.1| PREDICTED: similar to prostaglandin E synthase 2 [Tribolium castaneum] gi|270003893|gb|EFA00341.1| hypothetical protein TcasGA2_TC003180 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380017895|ref|XP_003692879.1| PREDICTED: prostaglandin E synthase 2-like [Apis florea] Back     alignment and taxonomy information
>gi|332026259|gb|EGI66398.1| Prostaglandin E synthase 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157119740|ref|XP_001659483.1| hypothetical protein AaeL_AAEL008783 [Aedes aegypti] gi|157119742|ref|XP_001659484.1| hypothetical protein AaeL_AAEL008776 [Aedes aegypti] gi|108875199|gb|EAT39424.1| AAEL008783-PA [Aedes aegypti] gi|108875200|gb|EAT39425.1| AAEL008776-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170035627|ref|XP_001845670.1| prostaglandin E synthase 2 [Culex quinquefasciatus] gi|167877643|gb|EDS41026.1| prostaglandin E synthase 2 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query586
FB|FBgn0004465419 Su(P) "Suppressor of ref(2)P s 0.373 0.522 0.451 3.6e-82
UNIPROTKB|F1RRY6380 PTGES2 "Uncharacterized protei 0.288 0.444 0.479 6e-68
UNIPROTKB|F1N1J6372 PTGES2 "Prostaglandin E syntha 0.288 0.454 0.468 1.6e-67
UNIPROTKB|F1P9X4374 PTGES2 "Uncharacterized protei 0.278 0.435 0.479 2e-67
ZFIN|ZDB-GENE-040426-1063378 ptgesl "prostaglandin E syntha 0.281 0.436 0.508 2.6e-67
UNIPROTKB|Q9H7Z7377 PTGES2 "Prostaglandin E syntha 0.281 0.437 0.485 2.3e-66
WB|WBGene00011239347 R11A8.5 [Caenorhabditis elegan 0.372 0.628 0.369 1.4e-65
UNIPROTKB|H7C5L1309 PTGES2 "Prostaglandin E syntha 0.281 0.533 0.485 1.2e-43
UNIPROTKB|F1NG33362 PTGES2 "Uncharacterized protei 0.363 0.588 0.425 5.9e-41
MGI|MGI:1917592384 Ptges2 "prostaglandin E syntha 0.283 0.432 0.477 2.9e-39
FB|FBgn0004465 Su(P) "Suppressor of ref(2)P sterility" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 527 (190.6 bits), Expect = 3.6e-82, Sum P(2) = 3.6e-82
 Identities = 108/239 (45%), Positives = 152/239 (63%)

Query:    43 LGLGVGSALG--YAYYTNVSLEPVFNEMANTQPV-LESFPEGIKVSRKVCTKLLLCTLEN 99
             LG  VG+A G  Y  Y   +      E   T+P  L+  P G++++++            
Sbjct:    66 LGATVGAATGSVYTMYQRWTDGSSHKEHEETKPTRLDGIPAGVRITKRY----------- 114

Query:   100 MFQVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKK 159
                 V P+DT+GL I LFQ+ TCPFCCKVRAFLDY G+SY +VEV+AVLRQ I+WSS KK
Sbjct:   115 ----VNPKDTSGLDIVLFQFQTCPFCCKVRAFLDYMGISYAVVEVDAVLRQDIRWSSVKK 170

Query:   160 VPILLVKVPNG-YQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEI 218
             VP++L++  +G Y QM DSS I+S +A++L D    + E+A ++P T + DDDG  K +I
Sbjct:   171 VPMVLIRQQDGKYVQMVDSSAIISLIATHLQDKRTDIGELAQFYPHTSFFDDDGKKKNDI 230

Query:   219 MNRYFLMLNDRMNGRTVKDIMD-ERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSE 276
             +N+YFLM  +       K+  + +RKWR WAD  LVH +SPN Y+T  E+L++FEWFS+
Sbjct:   231 LNKYFLMYREHTPKGVSKETDETDRKWRSWADSHLVHLISPNCYQTMGESLETFEWFSQ 289


GO:0009055 "electron carrier activity" evidence=IEA
GO:0015035 "protein disulfide oxidoreductase activity" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
UNIPROTKB|F1RRY6 PTGES2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1N1J6 PTGES2 "Prostaglandin E synthase 2 truncated form" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P9X4 PTGES2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1063 ptgesl "prostaglandin E synthase 2-like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H7Z7 PTGES2 "Prostaglandin E synthase 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00011239 R11A8.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|H7C5L1 PTGES2 "Prostaglandin E synthase 2 truncated form" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NG33 PTGES2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1917592 Ptges2 "prostaglandin E synthase 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.99.3LOW CONFIDENCE prediction!
3rd Layer5.3.99LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query586
cd03197149 cd03197, GST_C_mPGES2, C-terminal, alpha helical d 5e-71
cd0304077 cd03040, GST_N_mPGES2, GST_N family; microsomal Pr 3e-37
cd0304077 cd03040, GST_N_mPGES2, GST_N family; microsomal Pr 2e-17
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 1e-09
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 3e-09
pfam0046260 pfam00462, Glutaredoxin, Glutaredoxin 6e-08
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 1e-07
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 9e-07
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 2e-06
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 3e-06
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 6e-06
cd0297673 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is 4e-05
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 8e-05
cd03184124 cd03184, GST_C_Omega, C-terminal, alpha helical do 3e-04
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [ 4e-04
COG069580 COG0695, GrxC, Glutaredoxin and related proteins [ 4e-04
cd0297673 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is 0.001
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 0.001
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 0.001
COG0625 211 COG0625, Gst, Glutathione S-transferase [Posttrans 0.004
cd0206672 cd02066, GRX_family, Glutaredoxin (GRX) family; co 0.004
cd0319388 cd03193, GST_C_Metaxin, C-terminal, alpha helical 0.004
cd03036111 cd03036, ArsC_like, Arsenate Reductase (ArsC) fami 0.004
cd03192104 cd03192, GST_C_Sigma_like, C-terminal, alpha helic 0.004
>gnl|CDD|198306 cd03197, GST_C_mPGES2, C-terminal, alpha helical domain of microsomal Prostaglandin E synthase Type 2 Back     alignment and domain information
 Score =  224 bits (574), Expect = 5e-71
 Identities = 91/183 (49%), Positives = 113/183 (61%), Gaps = 40/183 (21%)

Query: 240 DERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLK 299
           +E+KWRKW D VLVH LSPN+YRT  EALQ+F++ +                        
Sbjct: 7   EEKKWRKWVDDVLVHLLSPNIYRTFSEALQAFDYIT------------------------ 42

Query: 300 RAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDEC 359
                     TVG +      WER++  YVGA AMY ISKRLKK+ N+K++VRESLYD  
Sbjct: 43  ----------TVGNF----GPWERIVAKYVGAAAMYLISKRLKKKRNIKDDVRESLYDAL 88

Query: 360 NQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTN 419
           N WVK + K+    F GG KPNLADLAVYGVL SIEG +AFKD++A +KI PWYERM+  
Sbjct: 89  NDWVKALGKKR--KFHGGSKPNLADLAVYGVLRSIEGLDAFKDVLANTKIGPWYERMKEA 146

Query: 420 VTN 422
           V +
Sbjct: 147 VGS 149


Glutathione S-transferase (GST) C-terminal domain family, microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2. Unlike cytosolic PGE synthase (cPGES) and microsomal PGES Type 1 (mPGES1), mPGES2 does not require glutathione (GSH) for its activity, although its catalytic rate is increased two- to four-fold in the presence of DTT, GSH, or other thiol compounds. PGE2 is widely distributed in various tissues and is implicated in the sleep/wake cycle, relaxation/contraction of smooth muscle, excretion of sodium ions, maintenance of body temperature, and mediation of inflammation. mPGES2 contains an N-terminal hydrophobic domain which is membrane associated and a C-terminal soluble domain with a GST-like structure. The C-terminal GST-like domain contains two structural domains, an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. The GST active site is located in a cleft between the two structural domains. Length = 149

>gnl|CDD|239338 cd03040, GST_N_mPGES2, GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>gnl|CDD|239338 cd03040, GST_N_mPGES2, GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|239274 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|198293 cd03184, GST_C_Omega, C-terminal, alpha helical domain of Class Omega Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239274 cd02976, NrdH, NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>gnl|CDD|198302 cd03193, GST_C_Metaxin, C-terminal, alpha helical domain of Metaxin and related proteins Back     alignment and domain information
>gnl|CDD|239334 cd03036, ArsC_like, Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>gnl|CDD|198301 cd03192, GST_C_Sigma_like, C-terminal, alpha helical domain of Class Sigma-like Glutathione S-transferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 586
KOG3029|consensus370 100.0
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 99.96
PRK09481211 sspA stringent starvation protein A; Provisional 99.9
PRK10387210 glutaredoxin 2; Provisional 99.86
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.85
PLN02473214 glutathione S-transferase 99.84
PRK15113214 glutathione S-transferase; Provisional 99.84
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.83
PRK10542201 glutathionine S-transferase; Provisional 99.82
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.81
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.81
PLN02395215 glutathione S-transferase 99.81
PRK10357202 putative glutathione S-transferase; Provisional 99.8
KOG0406|consensus231 99.8
PRK11752264 putative S-transferase; Provisional 99.79
PLN02378213 glutathione S-transferase DHAR1 99.72
PTZ00057205 glutathione s-transferase; Provisional 99.71
PLN02817265 glutathione dehydrogenase (ascorbate) 99.7
KOG0867|consensus226 99.69
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.69
KOG0868|consensus217 99.62
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 99.54
KOG4244|consensus281 99.51
KOG4420|consensus325 99.47
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 99.46
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 99.4
PLN02907 722 glutamate-tRNA ligase 99.4
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.36
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 99.34
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 99.33
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 99.32
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 99.29
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.28
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 99.28
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 99.26
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 99.26
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 99.26
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.24
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 99.21
KOG1695|consensus206 99.21
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 99.2
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 99.2
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.19
KOG3029|consensus 370 99.19
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 99.17
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.16
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 99.16
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 99.15
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 99.15
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 99.14
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 99.13
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 99.13
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 99.12
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 99.11
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 99.11
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.1
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 99.03
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 99.03
KOG1422|consensus221 98.98
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 98.96
PRK1063883 glutaredoxin 3; Provisional 98.93
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 98.9
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.9
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.9
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 98.88
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 98.88
PRK1120085 grxA glutaredoxin 1; Provisional 98.86
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 98.83
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.8
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.77
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.77
PRK1032981 glutaredoxin-like protein; Provisional 98.76
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.74
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.71
PHA03050108 glutaredoxin; Provisional 98.7
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 98.7
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 98.67
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.66
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.65
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 98.62
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 98.6
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 98.6
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 98.6
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 98.58
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 98.57
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 98.56
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.55
PRK10824115 glutaredoxin-4; Provisional 98.55
PRK1032981 glutaredoxin-like protein; Provisional 98.54
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 98.53
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 98.51
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 98.51
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 98.51
PRK1063883 glutaredoxin 3; Provisional 98.49
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 98.48
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 98.48
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 98.47
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 98.46
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 98.46
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 98.43
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.43
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 98.4
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 98.4
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.38
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 98.38
PHA03050108 glutaredoxin; Provisional 98.37
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 98.36
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 98.36
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 98.35
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 98.34
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 98.33
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 98.32
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 98.32
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 98.27
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 98.26
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 98.26
PRK12759410 bifunctional gluaredoxin/ribonucleoside-diphosphat 98.25
KOG3027|consensus257 98.25
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 98.22
PRK1120085 grxA glutaredoxin 1; Provisional 98.22
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 98.19
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 98.19
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 98.19
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 98.18
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 98.17
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 98.15
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 98.15
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 98.12
KOG1752|consensus104 98.12
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 98.11
KOG2903|consensus319 98.09
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 98.09
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 98.08
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 98.08
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 98.08
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 98.07
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 98.06
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 98.06
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 98.05
PTZ00062204 glutaredoxin; Provisional 98.03
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.03
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 98.0
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 98.0
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 97.99
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 97.95
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 97.91
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 97.89
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 97.89
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 97.85
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 97.8
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 97.8
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 97.8
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 97.79
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 97.75
PRK10824115 glutaredoxin-4; Provisional 97.71
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 97.67
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 97.62
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 97.61
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 97.55
KOG3028|consensus313 97.53
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 97.51
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 97.51
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 97.51
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 97.5
KOG1752|consensus104 97.47
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 97.46
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 97.45
cd0305589 GST_N_Omega GST_N family, Class Omega subfamily; G 97.42
cd03036111 ArsC_like Arsenate Reductase (ArsC) family, unknow 97.31
PRK01655131 spxA transcriptional regulator Spx; Reviewed 97.25
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 97.23
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 97.2
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 97.19
cd02977105 ArsC_family Arsenate Reductase (ArsC) family; comp 97.19
COG0278105 Glutaredoxin-related protein [Posttranslational mo 97.19
PTZ00062204 glutaredoxin; Provisional 97.15
cd03032115 ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub 97.12
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 97.06
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 97.04
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 97.01
PRK12559131 transcriptional regulator Spx; Provisional 96.99
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 96.97
PRK13344132 spxA transcriptional regulator Spx; Reviewed 96.95
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 96.92
TIGR01617117 arsC_related transcriptional regulator, Spx/MgsR f 96.86
cd03035105 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s 96.72
COG1393117 ArsC Arsenate reductase and related proteins, glut 96.69
cd03033113 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p 96.67
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 96.49
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 96.35
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 96.31
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 96.29
COG1393117 ArsC Arsenate reductase and related proteins, glut 96.26
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 96.23
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 96.2
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 96.1
PRK10853118 putative reductase; Provisional 95.98
PRK10026141 arsenate reductase; Provisional 95.93
TIGR01616126 nitro_assoc nitrogenase-associated protein. This m 95.84
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 95.76
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 95.7
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 95.52
TIGR00014114 arsC arsenate reductase (glutaredoxin). composed o 95.46
COG454585 Glutaredoxin-related protein [Posttranslational mo 95.4
cd03034112 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s 95.37
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 95.33
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 95.3
KOG0911|consensus227 95.15
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 95.12
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 95.02
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 95.0
PF1056872 Tom37: Outer mitochondrial membrane transport comp 94.99
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 94.98
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 94.53
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 94.51
PHA0212575 thioredoxin-like protein 94.48
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 94.44
PHA0212575 thioredoxin-like protein 94.22
COG454585 Glutaredoxin-related protein [Posttranslational mo 93.97
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 93.94
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 93.92
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 93.9
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 92.86
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 92.77
cd0303092 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 92.12
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 92.05
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 91.49
PF03960110 ArsC: ArsC family; InterPro: IPR006660 Several bac 91.32
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 91.23
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 91.01
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 90.58
PF0490899 SH3BGR: SH3-binding, glutamic acid-rich protein; I 90.51
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 90.15
PLN02817 265 glutathione dehydrogenase (ascorbate) 89.68
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 88.39
cd0294793 TRX_family TRX family; composed of two groups: Gro 87.82
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 87.29
PRK11752 264 putative S-transferase; Provisional 87.15
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 86.97
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 86.43
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 85.05
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 84.52
PRK10877232 protein disulfide isomerase II DsbC; Provisional 83.53
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 83.33
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 83.26
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 82.81
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 82.12
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 81.99
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 81.11
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 80.92
>KOG3029|consensus Back     alignment and domain information
Probab=100.00  E-value=2.5e-63  Score=496.71  Aligned_cols=322  Identities=52%  Similarity=0.920  Sum_probs=290.4

Q ss_pred             eeccCCceeeecccceeee--eeeeeeecccCCccccccccc-cccccccCccccccchhhcccccccchhhccccCCCC
Q psy2688          32 ASFFGNPIVIGLGLGVGSA--LGYAYYTNVSLEPVFNEMANT-QPVLESFPEGIKVSRKVCTKLLLCTLENMFQVVVPED  108 (586)
Q Consensus        32 ~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~vs~~~c~~~~~~~~~~m~~~~~p~~  108 (586)
                      +.+-|.|.+..+|+..|.+  .+|..|..+.+.. +.+|+++ ..-|+..                              
T Consensus        39 r~~~G~~kl~~~~a~~~~~ag~~~~~~ar~~~~~-~~lhae~~~~~ld~s------------------------------   87 (370)
T KOG3029|consen   39 RKKNGTPKLAVLGATAGGAAGSVYTMYARVTDGS-QKLHAETKATRLDGS------------------------------   87 (370)
T ss_pred             cccCCCcchhhhhhhhccccceeEeeHHHhhcch-HHHHHHHHHhhcCCC------------------------------
Confidence            3457999999999988887  4555555555433 5666655 3333322                              


Q ss_pred             CCCCcEEEEEcCCChhHHHHHHHHHhcCCCeEEEEecccchhhhccCCCceeeEEEEccCCCcEEecChHHHHHHHHhhh
Q psy2688         109 TTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGYQQMNDSSMIVSCLASYL  188 (586)
Q Consensus       109 ~~~~~I~LY~~~~cPfC~KVR~~L~ekGI~YE~v~Vd~~~~~~l~~sp~gkVPvL~idg~dG~~~I~eS~aIi~yLaeyL  188 (586)
                        +.+++||+|.+||||+|||++|+++||+|+.|+|++..++++++|.+++||+|.++|    +.+.||++||..|+.||
T Consensus        88 --~L~l~LyQyetCPFCcKVrAFLDyhgisY~VVEVnpV~r~eIk~SsykKVPil~~~G----eqm~dSsvIIs~laTyL  161 (370)
T KOG3029|consen   88 --PLDLVLYQYETCPFCCKVRAFLDYHGISYAVVEVNPVLRQEIKWSSYKKVPILLIRG----EQMVDSSVIISLLATYL  161 (370)
T ss_pred             --CceEEEEeeccCchHHHHHHHHhhcCCceEEEEecchhhhhccccccccccEEEecc----ceechhHHHHHHHHHHh
Confidence              357999999999999999999999999999999999999999999999999999875    56999999999999999


Q ss_pred             ccccccchhccccCCCCCCCCCChhhHHHHHHHHHHhhhccccCccccchHHHHHHHHHHHhhchhccccccccchHHHh
Q psy2688         189 SDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEAL  268 (586)
Q Consensus       189 ee~~~~~~~~~~lYP~~~l~p~~~k~~~~i~n~~f~m~~~~~~~~~~~~~~e~~~W~~waD~~L~~~i~p~vyr~~~eal  268 (586)
                      .+..++++++.++||..+.+.+++++..++.||||+|+.+.-|+---..+.+++.|++|+|+||+|+|+|++||++.|++
T Consensus       162 q~~~q~l~eiiq~yPa~~~~ne~GK~v~~~~NKyflM~~e~d~~~~ke~~~eerkWR~WvDn~lVHLiSPNvYrn~~Esl  241 (370)
T KOG3029|consen  162 QDKRQDLGEIIQMYPATSFFNEDGKEVNDILNKYFLMYREHDPGVSKETDEEERKWRSWVDNHLVHLISPNVYRNMGESL  241 (370)
T ss_pred             ccCCCCHHHHHHhccccccccccccchhhcchhheeeeeccCCCccccchHHHhHHHHHHhhhhhhhcCcccccChhhHH
Confidence            99999999999999999999999999999999999999987664333346689999999999999999999999999999


Q ss_pred             hhhhhhhhhhccCCccccchhhhhhHHHHHHHHhhhhcccccccccchhhhHHHHHHHHHhhhhHHHHHHHHhhhhccch
Q psy2688         269 QSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLK  348 (586)
Q Consensus       269 ~~F~wf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~e~~g~~~~~~p~~er~l~~~~ga~~m~~i~k~lkk~~~l~  348 (586)
                      ++|+||++                                  .|+|+.+||+|||.+++|+||.+||+++|+||++|+|+
T Consensus       242 etFewf~q----------------------------------~G~w~~~FpawEr~lavY~GAtAM~lisK~LKkkhni~  287 (370)
T KOG3029|consen  242 ETFEWFSQ----------------------------------AGEWDVHFPAWERDLAVYCGATAMYLISKMLKKKHNIS  287 (370)
T ss_pred             HHHHHHHH----------------------------------cCCccccCchHHHHHHHHhhHHHHHHHHHHHHhhcccc
Confidence            99999988                                  79999999999999999999999999999999999997


Q ss_pred             HHHHHHHHHHHHHHHHHHhccCCCCeecCCCCChhhhhHHHHHHhhhhccccccCCCCCCHHHHHHHHhhhhhcccchh
Q psy2688         349 EEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTNVTNHLGNE  427 (586)
Q Consensus       349 ~~vre~L~d~l~~~l~aL~~~~~~pFL~Gd~pTlAD~av~g~L~~l~~~~~~~dl~~~P~L~aW~eRmke~~~~~~G~~  427 (586)
                      + +|++||+++++|.++|++  ++|||+|++|++||+++||+|+++++|.+|+|+++++.|+.||.||++++..++|+.
T Consensus       288 D-~Re~lydA~d~Wvaalgk--nr~flGG~kPnLaDLsvfGvl~sm~gc~afkd~~q~t~I~eW~~rmealV~e~~g~~  363 (370)
T KOG3029|consen  288 D-EREHLYDAADQWVAALGK--NRPFLGGKKPNLADLSVFGVLRSMEGCQAFKDCLQNTSIGEWYYRMEALVEENRGQL  363 (370)
T ss_pred             h-HHHHHHHHHHHHHHHhCC--CCCccCCCCCchhhhhhhhhhhHhhhhhHHHHHHhcchHHHHHHHHHHHHhccccch
Confidence            7 999999999999999985  899999999999999999999999999999999999999999999999999999973



>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>KOG1752|consensus Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC Back     alignment and domain information
>PRK01655 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx Back     alignment and domain information
>COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>PRK12559 transcriptional regulator Spx; Provisional Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK13344 spxA transcriptional regulator Spx; Reviewed Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family Back     alignment and domain information
>cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>PRK10853 putative reductase; Provisional Back     alignment and domain information
>PRK10026 arsenate reductase; Provisional Back     alignment and domain information
>TIGR01616 nitro_assoc nitrogenase-associated protein Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>TIGR00014 arsC arsenate reductase (glutaredoxin) Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>KOG0911|consensus Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query586
1z9h_A290 Microsomal Prostaglandin E Synthase Type-2 Length = 6e-70
1z9h_A 290 Microsomal Prostaglandin E Synthase Type-2 Length = 3e-10
>pdb|1Z9H|A Chain A, Microsomal Prostaglandin E Synthase Type-2 Length = 290 Back     alignment and structure

Iteration: 1

Score = 261 bits (668), Expect = 6e-70, Method: Compositional matrix adjust. Identities = 141/319 (44%), Positives = 193/319 (60%), Gaps = 48/319 (15%) Query: 109 TTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVP 168 ++ L++TL+QY TCPFC KVRAFLD++ + Y +VEVN VLR +IK+SSY+KVPIL+ + Sbjct: 10 SSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVLRAEIKFSSYRKVPILVAQEG 69 Query: 169 NGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNRYFLMLND 228 QQ+NDSS+I+S L +YL + LEE+ +Y+P + +D G E N+Y+LMLN+ Sbjct: 70 ESSQQLNDSSVIISALKTYLV-SGQPLEEIITYYPAMKAVNDQGKEVTEFGNKYWLMLNE 128 Query: 229 R-----MNGRTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQK 283 + +G+ + +E KWR+WAD LVH +SPNVYRT EAL SF++ E G+ Sbjct: 129 KEAQQVYSGKEAR--TEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVRE-GK--- 182 Query: 284 HLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKK 343 F E + Y+GA AMY ISKRLK Sbjct: 183 ----------------------------------FGAVEGAVAKYMGAAAMYLISKRLKS 208 Query: 344 RHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDL 403 RH L++ VRE LY+ ++WV + K + PF GGQKPNLADLAVYGVL +EG +AF DL Sbjct: 209 RHRLQDNVREDLYEAADKWVAAVGK--DRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDL 266 Query: 404 MAKSKIKPWYERMRTNVTN 422 M + I+PWY R+ +T Sbjct: 267 MQHTHIQPWYLRVERAITE 285
>pdb|1Z9H|A Chain A, Microsomal Prostaglandin E Synthase Type-2 Length = 290 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query586
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 4e-96
1z9h_A 290 Membrane-associated prostaglandin E synthase-2; me 1e-14
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 1e-18
3ir4_A 218 Glutaredoxin 2; glutathione, IDP00895, structural 6e-08
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 2e-14
3ic8_A 310 Uncharacterized GST-like proteinprotein; glutathio 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 4e-07
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 2e-04
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 1e-06
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 4e-06
3q18_A 239 GSTO-2, glutathione S-transferase omega-2; glutath 1e-04
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 1e-06
1oyj_A 231 Glutathione S-transferase; herbicide detoxificatio 5e-04
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 4e-06
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 1e-05
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 8e-06
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 8e-06
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 8e-06
3ubk_A 242 Glutathione transferase; GSH binding; 1.95A {Lepto 1e-04
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 2e-04
3lyp_A215 Stringent starvation protein A; structural genomic 9e-06
3lyp_A215 Stringent starvation protein A; structural genomic 2e-04
3lyp_A 215 Stringent starvation protein A; structural genomic 3e-04
3lxz_A229 Glutathione S-transferase family protein; structur 1e-05
3lxz_A 229 Glutathione S-transferase family protein; structur 2e-04
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 1e-05
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 3e-04
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 1e-05
3cbu_A 214 Probable GST-related protein; thioredoxin fold, GS 7e-05
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 8e-05
3lyk_A216 Stringent starvation protein A homolog; structural 2e-05
3lyk_A216 Stringent starvation protein A homolog; structural 4e-05
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 3e-05
3tou_A226 Glutathione S-transferase protein; GSH binding sit 3e-05
3tou_A 226 Glutathione S-transferase protein; GSH binding sit 9e-05
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 4e-05
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 4e-05
2ahe_A267 Chloride intracellular channel protein 4; glutathi 4e-05
2ahe_A267 Chloride intracellular channel protein 4; glutathi 9e-04
2r4v_A247 XAP121, chloride intracellular channel protein 2; 5e-05
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 5e-05
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 7e-05
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 8e-05
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 1e-04
3niv_A222 Glutathione S-transferase; structural genomics, PS 1e-04
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 1e-04
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 2e-04
4dej_A231 Glutathione S-transferase related protein; transfe 1e-04
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 2e-04
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 2e-04
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 2e-04
2v6k_A 214 Maleylpyruvate isomerase; glutathione-S-transferas 8e-04
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 2e-04
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 3e-04
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 3e-04
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 3e-04
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 3e-04
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 3e-04
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 4e-04
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 4e-04
2cz2_A 223 Maleylacetoacetate isomerase; structural genomics, 4e-04
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 7e-04
1r5a_A218 Glutathione transferase; glutathione S-transferase 5e-04
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 5e-04
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 7e-04
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 7e-04
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 8e-04
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 8e-04
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 Back     alignment and structure
 Score =  294 bits (753), Expect = 4e-96
 Identities = 140/327 (42%), Positives = 188/327 (57%), Gaps = 44/327 (13%)

Query: 102 QVVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVP 161
             V    ++ L++TL+QY TCPFC KVRAFLD++ + Y +VEVN VLR +IK+SSY+KVP
Sbjct: 3   SAVQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVLRAEIKFSSYRKVP 62

Query: 162 ILLVKVPNGYQQMNDSSMIVSCLASYLSDTSVQLEEVASYFPETEYRDDDGTVKKEIMNR 221
           IL+ +     QQ+NDSS+I+S L +YL      LEE+ +Y+P  +  +D G    E  N+
Sbjct: 63  ILVAQEGESSQQLNDSSVIISALKTYLVSGQ-PLEEIITYYPAMKAVNDQGKEVTEFGNK 121

Query: 222 YFLMLNDRMNG---RTVKDIMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQ 278
           Y+LMLN++         +   +E KWR+WAD  LVH +SPNVYRT  EAL SF++   E 
Sbjct: 122 YWLMLNEKEAQQVYSGKEARTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREG 181

Query: 279 GRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYIS 338
                                                  F   E  +  Y+GA AMY IS
Sbjct: 182 --------------------------------------KFGAVEGAVAKYMGAAAMYLIS 203

Query: 339 KRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCE 398
           KRLK RH L++ VRE LY+  ++WV  + K  + PF GGQKPNLADLAVYGVL  +EG +
Sbjct: 204 KRLKSRHRLQDNVREDLYEAADKWVAAVGK--DRPFMGGQKPNLADLAVYGVLRVMEGLD 261

Query: 399 AFKDLMAKSKIKPWYERMRTNVTNHLG 425
           AF DLM  + I+PWY R+   +T    
Sbjct: 262 AFDDLMQHTHIQPWYLRVERAITEASP 288


>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Length = 290 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query586
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.96
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.93
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.93
4glt_A225 Glutathione S-transferase-like protein; structural 99.93
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.92
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.92
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.91
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.91
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.91
3lxz_A229 Glutathione S-transferase family protein; structur 99.91
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.91
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.91
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.9
3lyk_A216 Stringent starvation protein A homolog; structural 99.9
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.9
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.9
3lyp_A215 Stringent starvation protein A; structural genomic 99.9
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.9
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.9
3n5o_A235 Glutathione transferase; seattle structural genomi 99.9
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.9
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.9
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.89
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.89
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.89
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.89
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.89
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.89
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.89
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.89
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.89
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.89
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.89
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.89
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.89
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.89
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.89
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.88
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.88
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.88
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.88
4dej_A231 Glutathione S-transferase related protein; transfe 99.88
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.88
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.88
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.88
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.88
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.88
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.88
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.88
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.88
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.88
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.88
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.88
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.88
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.88
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.88
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.88
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.88
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.87
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.87
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.87
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.87
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.87
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.87
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.87
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.87
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.87
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.87
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.87
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.87
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.87
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.87
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.87
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.86
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.86
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.86
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.86
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.86
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.86
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.86
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.86
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.85
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.85
4exj_A238 Uncharacterized protein; transferase-like protein, 99.85
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.85
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.85
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.84
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.84
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.84
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.84
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.84
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.83
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.83
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.83
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.83
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.83
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.82
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.81
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.81
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.8
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.78
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.77
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.77
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.73
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.73
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.72
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.72
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.7
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.62
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.62
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.61
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.53
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.5
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 99.17
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 99.12
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 99.06
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 99.02
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.99
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 98.96
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.89
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.89
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 98.89
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.88
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 98.8
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 98.76
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 98.7
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.69
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.69
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 98.68
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 98.68
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 98.66
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.63
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.62
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 98.58
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 98.57
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 98.57
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 98.55
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 98.53
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.52
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.51
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 98.47
1kte_A105 Thioltransferase; redox-active center, electron tr 98.46
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 98.44
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.43
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 98.43
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 98.41
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 98.35
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 98.34
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 98.32
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.29
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 98.28
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 98.27
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 98.26
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 98.24
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 98.2
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 98.19
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 98.18
3rdw_A121 Putative arsenate reductase; structural genomics, 98.17
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 98.17
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.13
3fz4_A120 Putative arsenate reductase; APC61768, structural 98.13
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 98.12
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 98.11
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 98.09
3gkx_A120 Putative ARSC family related protein; ARSC family 98.09
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.09
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 98.08
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 98.07
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 98.05
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 98.02
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.02
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 98.02
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 97.98
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 97.98
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 97.96
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 97.96
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 97.96
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 97.95
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 97.85
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 97.82
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 97.82
1z3e_A132 Regulatory protein SPX; bacterial transcription re 97.82
1kte_A105 Thioltransferase; redox-active center, electron tr 97.8
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.8
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 97.77
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 97.75
1rw1_A114 Conserved hypothetical protein YFFB; thioredoxin f 97.74
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 97.72
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 97.71
1ttz_A87 Conserved hypothetical protein; structural genomic 97.71
1ttz_A87 Conserved hypothetical protein; structural genomic 97.71
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.64
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 97.63
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 97.61
3fz4_A120 Putative arsenate reductase; APC61768, structural 97.61
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.58
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.57
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 97.56
3gkx_A120 Putative ARSC family related protein; ARSC family 97.5
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 97.48
3l78_A120 Regulatory protein SPX; transcription, transcripti 97.46
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 97.42
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 97.42
3f0i_A119 Arsenate reductase; structural genomics, IDP01300, 97.33
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 97.24
3rdw_A121 Putative arsenate reductase; structural genomics, 97.15
1s3c_A141 Arsenate reductase; ARSC, arsenite, oxidoreductase 97.1
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 96.85
2axo_A270 Hypothetical protein ATU2684; alpha beta protein., 96.78
3vln_A 241 GSTO-1, glutathione S-transferase omega-1; GST fol 96.7
3q18_A 239 GSTO-2, glutathione S-transferase omega-2; glutath 96.58
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 96.53
3rbt_A 246 Glutathione transferase O1; glutathione S-transfer 96.08
4iel_A 229 Glutathione S-transferase, N-terminal domain PROT; 96.04
3qav_A 243 RHO-class glutathione S-transferase; cytosol; 2.10 95.8
3fy7_A 250 Chloride intracellular channel protein 3; GST, glu 95.75
2hnl_A 225 Glutathione S-transferase 1; prostaglandin synthas 95.43
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 94.9
1m0u_A 249 GST2 gene product; flight muscle protein, sigma, t 94.71
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 94.41
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 94.0
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 93.77
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 93.29
2ahe_A 267 Chloride intracellular channel protein 4; glutathi 92.78
3c8e_A 288 YGHU, glutathione S-transferase homologue; glutath 91.07
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 90.76
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 90.47
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 90.33
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 89.59
2yv7_A 260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 89.32
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 88.96
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 88.18
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 88.05
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 87.95
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 87.89
2yv9_A 291 Chloride intracellular channel EXC-4; chloride ION 87.8
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 87.51
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 87.4
4euy_A105 Uncharacterized protein; structural genomics, PSI- 87.33
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 87.33
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 87.32
3m1g_A 362 Putative glutathione S-transferase; ECM4-like subf 87.15
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 86.95
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 86.94
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 86.92
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 86.89
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 86.67
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 86.34
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 86.15
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 86.12
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 86.08
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 86.06
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 85.95
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 85.87
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 85.83
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 85.74
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 85.68
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 85.56
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 85.51
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 85.4
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 85.26
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 85.05
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 84.94
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 84.82
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 84.69
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 84.59
2l57_A126 Uncharacterized protein; structural genomics, unkn 84.46
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 84.38
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 84.16
2yzu_A109 Thioredoxin; redox protein, electron transport, st 84.05
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 84.04
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 83.93
3ppu_A 352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 83.85
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 83.84
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 83.64
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 83.57
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 83.52
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 83.45
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 83.39
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 83.32
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 83.2
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 83.01
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 82.88
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 82.78
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 82.66
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 82.57
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 82.55
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 82.49
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 82.46
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 82.46
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 82.4
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 82.27
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 82.16
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 82.12
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 82.11
2yzu_A109 Thioredoxin; redox protein, electron transport, st 82.09
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 82.05
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 82.04
2l57_A126 Uncharacterized protein; structural genomics, unkn 82.02
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 81.85
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 81.77
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 81.72
2l5l_A136 Thioredoxin; structural genomics, electron transpo 81.63
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 81.55
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 81.52
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 81.47
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 81.43
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 81.31
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 81.27
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 81.22
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 81.12
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 81.09
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 81.04
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 80.92
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 80.89
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 80.76
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 80.57
2l5l_A136 Thioredoxin; structural genomics, electron transpo 80.56
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 80.31
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 80.11
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
Probab=99.96  E-value=7.4e-29  Score=250.94  Aligned_cols=269  Identities=49%  Similarity=0.876  Sum_probs=170.1

Q ss_pred             ccCCCCCCCCcEEEEEcCCChhHHHHHHHHHhcCCCeEEEEecccchhhhccCCCceeeEEEEccCCCc-EEecChHHHH
Q psy2688         103 VVVPEDTTGLKITLFQYPTCPFCCKVRAFLDYYGVSYDIVEVNAVLRQQIKWSSYKKVPILLVKVPNGY-QQMNDSSMIV  181 (586)
Q Consensus       103 ~~~p~~~~~~~I~LY~~~~cPfC~KVR~~L~ekGI~YE~v~Vd~~~~~~l~~sp~gkVPvL~idg~dG~-~~I~eS~aIi  181 (586)
                      .++|.+.+.++++||+++.||+|++++++|+++||+|+.+.+++....+++.+|.++||+|++++ +|+ ..++||.+|+
T Consensus         4 ~~~~~~~~~~~~~Ly~~~~sp~~~~v~~~L~~~gi~~~~~~v~~~~~~~~~~~p~~~vP~l~~~~-~g~~~~l~eS~aI~   82 (290)
T 1z9h_A            4 AVQLSLSSRLQLTLYQYKTCPFCSKVRAFLDFHALPYQVVEVNPVLRAEIKFSSYRKVPILVAQE-GESSQQLNDSSVII   82 (290)
T ss_dssp             ---------CEEEEEECTTCHHHHHHHHHHHHTTCCEEEEECCTTTCGGGTTCSCCSSCEEEEEE-TTEEEEECSHHHHH
T ss_pred             ccCCccCCCCCEEEEeCCCChHHHHHHHHHHHcCCCeEEEECChhhHHHHHHcCCCCCCEEEECC-CCCeEEecCHHHHH
Confidence            46778888889999999999999999999999999999999986544567789999999999763 234 7999999999


Q ss_pred             HHHHhhhccccccchhccccCCCCC----------------CCCCChhhHHHHHHHHHHhhhccccCccccchHHHHHHH
Q psy2688         182 SCLASYLSDTSVQLEEVASYFPETE----------------YRDDDGTVKKEIMNRYFLMLNDRMNGRTVKDIMDERKWR  245 (586)
Q Consensus       182 ~yLaeyLee~~~~~~~~~~lYP~~~----------------l~p~~~k~~~~i~n~~f~m~~~~~~~~~~~~~~e~~~W~  245 (586)
                      +||++++.+.+ +..+....||+.+                +.|.++.++.++           .|+  ..+++++.+|+
T Consensus        83 ~yL~~~~~~~~-~l~~~~~~~p~~~~~~~~~~~~~~~~~~~l~p~~~~~~~~l-----------~~~--~~~ra~~~~w~  148 (290)
T 1z9h_A           83 SALKTYLVSGQ-PLEEIITYYPAMKAVNDQGKEVTEFGNKYWLMLNEKEAQQV-----------YSG--KEARTEEMKWR  148 (290)
T ss_dssp             HHHHHHHHHCC-CHHHHGGGSCEEEEECTTSCEEEEETTTTCCCCCHHHHHHH-----------CSS--HHHHHHHHHHH
T ss_pred             HHHHHHhcccc-ccccccccCCCcccccchhhhhhhhhhhhhhhhcccccccc-----------ccc--ccchhHHHHHH
Confidence            99997775411 1111111366533                555444321110           000  13467889999


Q ss_pred             HHHHhhchhccccccccchHHHhhhhhhhhhhhccCCccccchhhhhhHHHHHHHHhhhhcccccccccchhhhHHHHHH
Q psy2688         246 KWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKHFSKWERLL  325 (586)
Q Consensus       246 ~waD~~L~~~i~p~vyr~~~eal~~F~wf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~e~~g~~~~~~p~~er~l  325 (586)
                      .|++..+.+.+.+.+++...+.+..|.++...                                  +    .++..++..
T Consensus       149 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~----------------------------------~----~~~~~~~~~  190 (290)
T 1z9h_A          149 QWADDWLVHLISPNVYRTPTEALASFDYIVRE----------------------------------G----KFGAVEGAV  190 (290)
T ss_dssp             HHHHHTTGGGHHHHHSSSHHHHHHHHHHHHHH----------------------------------S----CCCHHHHHH
T ss_pred             HHHhhhhHhhhhHHhhcchHHHHHHHhhhhcc----------------------------------c----ccchHHHHH
Confidence            99999887666666655433333333332210                                  0    000111222


Q ss_pred             HHHhhhhHHHHHHHHhhhhccchHHHHHHHHHHHHHHHHHHhccCCCCeecCCCCChhhhhHHHHHHhhhhccccccCCC
Q psy2688         326 MVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMA  405 (586)
Q Consensus       326 ~~~~ga~~m~~i~k~lkk~~~l~~~vre~L~d~l~~~l~aL~~~~~~pFL~Gd~pTlAD~av~g~L~~l~~~~~~~dl~~  405 (586)
                      ..+.|+..|+.+.++++++..+.++..+.+++.++++++++.  ++++||+|++||+||+++++.+.++..+..+.++.+
T Consensus       191 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~l--~~~~yl~Gd~~T~ADi~~~~~l~~~~~~~~~~~~~~  268 (290)
T 1z9h_A          191 AKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVG--KDRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQ  268 (290)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHC--SSCSBTTBTSCCHHHHHHHHHHHTTTTSHHHHHHHH
T ss_pred             HHHhhHHHHHHHHHHHhhhcccccHHHHHHHHHHHHHHHhcc--CCCCccCCCCCCHHHHHHHHHHHHHHcccchhhhhh
Confidence            224455566666665544444422333445566666655432  278999999999999999999998866542223446


Q ss_pred             CCCHHHHHHHHhhhhhcccch
Q psy2688         406 KSKIKPWYERMRTNVTNHLGN  426 (586)
Q Consensus       406 ~P~L~aW~eRmke~~~~~~G~  426 (586)
                      +|+|.+|++||.++++.|.|.
T Consensus       269 ~P~l~~w~~r~~~r~~~~~g~  289 (290)
T 1z9h_A          269 HTHIQPWYLRVERAITEASPA  289 (290)
T ss_dssp             HHSCHHHHHHHHHHHHTC---
T ss_pred             ChHHHHHHHHHHHhhccccCC
Confidence            799999999999999998874



>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} Back     alignment and structure
>1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 586
d1z9ha1161 a.45.1.1 (A:213-373) Microsomal prostaglandin E sy 3e-54
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 4e-20
d1z9ha2113 c.47.1.5 (A:100-212) Microsomal prostaglandin E sy 7e-07
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 5e-08
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 4e-05
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 2e-07
d1eema298 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sa 8e-06
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 1e-06
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 8e-06
d1h75a_76 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch 9e-06
d1h75a_76 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch 0.003
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 1e-05
d1gwca283 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii 7e-05
d1eema1139 a.45.1.1 (A:103-241) Class omega GST {Human (Homo 1e-05
d1r7ha_74 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory 1e-05
d1r7ha_74 c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory 0.002
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 2e-05
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 0.001
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 3e-05
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 1e-04
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 5e-05
d1nm3a174 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb 0.001
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 6e-05
d1k0da292 c.47.1.5 (A:109-200) Yeast prion protein ure2p, ni 5e-04
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 9e-05
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 1e-04
d1oe8a1123 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( 1e-04
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 1e-04
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 2e-04
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 2e-04
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 3e-04
d1tw9a1129 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid 2e-04
d1gnwa284 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress ( 2e-04
d1ljra1165 a.45.1.1 (A:80-244) Class theta GST {Human (Homo s 4e-04
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 4e-04
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 4e-04
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 5e-04
d1m0ua1127 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D 6e-04
d1k0ma286 c.47.1.5 (A:6-91) Chloride intracellular channel 1 0.001
d1f2ea1121 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p 0.001
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 0.001
d1duga1140 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma j 0.002
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 0.002
d1ljra279 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sap 0.004
d1gnwa1126 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress 0.003
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 0.004
d1egoa_85 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 0.004
d1fova_82 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 0.004
d1fova_82 c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) 0.004
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Microsomal prostaglandin E synthase-2
species: Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]
 Score =  179 bits (455), Expect = 3e-54
 Identities = 78/181 (43%), Positives = 98/181 (54%), Gaps = 40/181 (22%)

Query: 240 DERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLK 299
           +E KWR+WAD  LVH +SPNVYRT  EAL SF++   E                      
Sbjct: 18  EEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVREGK-------------------- 57

Query: 300 RAYAFVKNLDTVGEWDKHFSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDEC 359
                             F   E  +  Y+GA AMY ISKRLK RH L++ VRE LY+  
Sbjct: 58  ------------------FGAVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAA 99

Query: 360 NQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGCEAFKDLMAKSKIKPWYERMRTN 419
           ++WV  + K  + PF GGQKPNLADLAVYGVL  +EG +AF DLM  + I+PWY R+   
Sbjct: 100 DKWVAAVGK--DRPFMGGQKPNLADLAVYGVLRVMEGLDAFDDLMQHTHIQPWYLRVERA 157

Query: 420 V 420
           +
Sbjct: 158 I 158


>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 113 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 83 Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 92 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 140 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query586
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 99.94
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 99.72
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.56
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 99.55
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.54
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.52
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.52
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.52
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.51
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.5
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.5
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.5
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.49
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.47
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 99.44
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.43
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.38
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.34
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.27
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.26
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.26
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.24
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.21
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.16
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.14
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 99.13
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.09
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.08
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.08
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.04
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.04
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 99.04
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 99.03
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.02
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.01
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 98.99
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 98.99
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 98.99
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 98.97
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.95
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 98.95
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 98.95
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 98.91
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 98.9
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.88
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 98.87
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.84
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.84
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 98.83
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 98.83
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 98.82
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 98.8
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 98.8
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 98.77
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.73
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 98.71
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.7
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 98.66
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 98.65
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 98.65
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 98.64
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 98.6
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 98.58
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 98.52
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 98.43
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 98.43
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 98.36
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 98.34
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 98.34
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 98.32
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 98.27
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 98.25
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 98.25
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 98.22
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.21
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 98.2
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 98.2
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 98.18
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 98.13
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 98.07
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 98.07
d1abaa_87 Glutaredoxin (Grx, thioltransferase) {Bacteriophag 98.06
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 98.03
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 98.01
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 97.93
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 97.91
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 97.87
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 97.86
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 97.85
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 97.83
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 97.79
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 97.68
d1wjka_100 Thioredoxin-like structure containing protein C330 97.64
d1t1va_93 SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} 97.55
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 97.55
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 97.54
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 97.49
d1wjka_100 Thioredoxin-like structure containing protein C330 97.41
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.37
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 97.36
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 97.28
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 97.24
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.08
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 97.07
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 96.97
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 96.96
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 96.85
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 96.64
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 96.63
d1z3ea1114 Regulatory protein Spx {Bacillus subtilis [TaxId: 96.51
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 96.45
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 96.23
d1rw1a_114 Hypothetical protein PA3664 (YffB) {Pseudomonas ae 95.59
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 95.2
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 95.18
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 94.87
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 94.44
d1j9ba_138 Arsenate reductase ArsC {Escherichia coli [TaxId: 93.79
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 93.74
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 92.78
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 91.88
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 89.85
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 88.65
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 88.62
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 86.58
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 86.51
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 86.02
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 85.61
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 85.54
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 84.94
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 84.86
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 84.8
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 83.99
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 83.69
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 82.9
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 82.76
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 82.64
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 82.28
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 80.52
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 80.26
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Microsomal prostaglandin E synthase-2
species: Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]
Probab=99.94  E-value=3.1e-28  Score=228.20  Aligned_cols=145  Identities=54%  Similarity=0.983  Sum_probs=133.5

Q ss_pred             hHHHHHHHHHHHhhchhccccccccchHHHhhhhhhhhhhhccCCccccchhhhhhHHHHHHHHhhhhcccccccccchh
Q psy2688         238 IMDERKWRKWADQVLVHTLSPNVYRTKEEALQSFEWFSEEQGRGQKHLDFHVIKTTQKLYLKRAYAFVKNLDTVGEWDKH  317 (586)
Q Consensus       238 ~~e~~~W~~waD~~L~~~i~p~vyr~~~eal~~F~wf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~~e~~g~~~~~  317 (586)
                      +.++++|+.|+|++|+|+++|++|+++.|++++|.|+++                                  +|    .
T Consensus        16 ~~~e~~Wr~w~d~~lv~~~~p~~y~t~~~a~~t~~yi~~----------------------------------~~----~   57 (161)
T d1z9ha1          16 RTEEMKWRQWADDWLVHLISPNVYRTPTEALASFDYIVR----------------------------------EG----K   57 (161)
T ss_dssp             HHHHHHHHHHHHHTTGGGHHHHHSSSHHHHHHHHHHHHH----------------------------------HS----C
T ss_pred             hhHHHHHHHHHHhhhhhhccHHHhCCHHHHHHHHHHHhc----------------------------------cc----c
Confidence            456789999999999999999999999999999999987                                  23    4


Q ss_pred             hhHHHHHHHHHhhhhHHHHHHHHhhhhccchHHHHHHHHHHHHHHHHHHhccCCCCeecCCCCChhhhhHHHHHHhhhhc
Q psy2688         318 FSKWERLLMVYVGAYAMYYISKRLKKRHNLKEEVRESLYDECNQWVKTIEKRENGPFFGGQKPNLADLAVYGVLSSIEGC  397 (586)
Q Consensus       318 ~p~~er~l~~~~ga~~m~~i~k~lkk~~~l~~~vre~L~d~l~~~l~aL~~~~~~pFL~Gd~pTlAD~av~g~L~~l~~~  397 (586)
                      ||.++|.+.+++|+.+||+|+|++++++++.+++|+.|+++++.|++++.+  +++|++|++|++||+++||+|++++.+
T Consensus        58 f~~~~r~~~~~~Ga~~M~~I~krlkkk~~~~dd~r~~L~~~ld~f~~~~l~--~~~F~gGd~P~lADlavfg~l~~~~~~  135 (161)
T d1z9ha1          58 FGAVEGAVAKYMGAAAMYLISKRLKSRHRLQDNVREDLYEAADKWVAAVGK--DRPFMGGQKPNLADLAVYGVLRVMEGL  135 (161)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHHHHHHHTTCCSSHHHHHHHHHHHHHHHHCS--SCSBTTBTSCCHHHHHHHHHHHTTTTS
T ss_pred             ccHHHHHHHHHcCHHHHHHHHHHHhhcccCchHHHHHHHHHHHHHHHHhcC--CCCccCCCCCcHHHHHHHhhhhhhhhc
Confidence            788999999999999999999999999999999999999999999998863  789999999999999999999999998


Q ss_pred             cccccCCCCCCHHHHHHHHhhhhhc
Q psy2688         398 EAFKDLMAKSKIKPWYERMRTNVTN  422 (586)
Q Consensus       398 ~~~~dl~~~P~L~aW~eRmke~~~~  422 (586)
                      ..+.++.++|+|.+|++||++.++.
T Consensus       136 ~~f~~l~~~p~i~~W~~RMk~aVg~  160 (161)
T d1z9ha1         136 DAFDDLMQHTHIQPWYLRVERAITE  160 (161)
T ss_dssp             HHHHHHHHHHSCHHHHHHHHHHHHT
T ss_pred             cccchhccCCcHHHHHHHHHHHhcc
Confidence            8877777899999999999998864



>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure