Psyllid ID: psy2726


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---
MGLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLVNLPLERSRRSTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCAGIYPLHQEGGVGLMGLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKYHHHSGESVEIGMDACNL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccEcccccHHEHEHccccccccccccccccEccccHHHHHHHHHHHHccccccccccccccccccccEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHEEEEEcccccccEccccHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHcccccccccccccEccccHHHHHcccccccccccccccEEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccccccccccccEEccccHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEEccccccccccccccccccccccEEEccccHHHHHHHccccccccccccccc
mglpshccpgpirkrkkkprrdgtfVCKVCnktftqsswghkgltksrdiqnltGKISWAHSERNisgwleelplvnlplersrrstherihtgerpfrcEVCMKTftqqpnlwkhmkthtgekpyncgmcdkafTQRAnlwgswvchptavRDLFLVNLgtherihtgerpfrcEVCMKTftqqpnlwkhmkthtgekpyncgmcdkAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCagiyplhqeggvglmglpshccpgpirkrkkkprrdgtfVCKVCnktftqsswghkgltksrdiqnltGKISWAHSERnisgwleelpllvnlgtherihtgerpfrcEVCMKTftqqpnlwkhmkthtgekpyncgmcdkAFTQRANLLKHIRvhtgerpyscklcgkRFTQQANLVkhnrlhsgerpyhcryctktfiqqsnldrhervhtgvkpyscKICWKAFAqtgnltkhelsahgigkpgvnkgtnthnceekcsipvllcsktgkilkklpmkyhhhsgesveigmdacnl
mglpshccpgpirkrkkkprrdgTFVCKVcnktftqsswghkgltksrdiQNLTGKISWAHSERNISGWLEELplvnlplersrrstherihtgerpfrcevCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHErihtgerpfrcEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHtenlklytrrkeeVEVEVDVCAGIYPLHQEGGVGLMGLPSHCCPGPirkrkkkprrdgtfvckvcnktftqsswghkgltksrdiQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVkhnrlhsgerpyHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKyhhhsgesveigmdACNL
MGLPSHCCPGPIrkrkkkprrDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWleelplvnlpleRSRRSTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKeevevevdvCAGIYPLHQEGGVGLMGLPSHCCPGPIrkrkkkprrDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKYHHHSGESVEIGMDACNL
**********************GTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLVNLPL**********IHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCAGIYPLHQEGGVGLMGLPSHCCPGPI*********DGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKYH****************
*GLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLVNLPLERSRRSTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCAGIYPLHQEGGVGLMGLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKYHHHSGESVEIGMDACNL
MGLPSHCCPGPIR********DGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLVNLPLERSRRSTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCAGIYPLHQEGGVGLMGLPSHCCPGPIR********DGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKYHHHSGESVEIGMDACNL
*GLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLVNLPLERSRRSTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCAGIYPLHQEGGVGLMGLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKYHHHSGESVEIGM**C**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLVNLPLERSRRSTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHxxxxxxxxxxxxxxxxxxxxxVDVCAGIYPLHQEGGVGLMGLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPGVNKGTNTHNCEEKCSIPVLLCSKTGKILKKLPMKYHHHSGESVEIGMDACNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query543 2.2.26 [Sep-21-2011]
Q5R5U3 672 Zinc finger protein 271 O yes N/A 0.626 0.505 0.405 1e-82
P15620580 Zinc finger protein 271 O yes N/A 0.611 0.572 0.407 1e-81
Q3ZCX4644 Zinc finger protein 568 O yes N/A 0.620 0.523 0.393 3e-78
Q14591 655 Zinc finger protein 271 O no N/A 0.616 0.511 0.393 4e-78
A1YG88673 Zinc finger protein 16 OS N/A N/A 0.736 0.594 0.358 7e-78
P08045 1350 Zinc finger protein Xfin N/A N/A 0.732 0.294 0.371 3e-77
P17020682 Zinc finger protein 16 OS no N/A 0.745 0.593 0.358 1e-76
A1YF12682 Zinc finger protein 16 OS N/A N/A 0.745 0.593 0.356 1e-76
A2T759682 Zinc finger protein 16 OS no N/A 0.745 0.593 0.356 6e-76
Q14590738 Zinc finger protein 235 O no N/A 0.685 0.504 0.374 1e-74
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function desciption
 Score =  308 bits (788), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 166/409 (40%), Positives = 243/409 (59%), Gaps = 69/409 (16%)

Query: 88  HERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWGSWVC 147
           H+RIHTGE+P+ C  C+K+F++  +L KH + HTGEKPY C  C KAF+Q ++L      
Sbjct: 125 HQRIHTGEKPYSCNWCIKSFSRSSDLIKHQRVHTGEKPYKCDECGKAFSQSSDLI----- 179

Query: 148 HPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCD 207
                          H+RIHTGE+P++C  C K+F+Q+ +L KH + HTGEKPY C  C+
Sbjct: 180 --------------IHQRIHTGEKPYQCSHCSKSFSQRSDLVKHQRIHTGEKPYTCNQCN 225

Query: 208 KAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCAGIYP------LHQEGGVGLMGL 261
           K F+Q ++++KH R+HT           E   + DVCA  +       LHQ    G    
Sbjct: 226 KHFSQSSDVIKHQRIHTG----------EKPYKCDVCAKAFSQSSDLILHQRIHTG---- 271

Query: 262 PSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSE 321
                        +KP     + C  C+K+F+Q+S     L K R I   TG+  +  +E
Sbjct: 272 -------------EKP-----YPCNQCSKSFSQNS----DLIKHRRIH--TGEKPYKCNE 307

Query: 322 RNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCG 381
                   +  +L+    H+RIHTGE+P+ C+ C KTF++  +L  H + HTGEKPY C 
Sbjct: 308 --CGKAFNQSSVLI---LHQRIHTGEKPYPCDQCSKTFSRLSDLINHQRIHTGEKPYPCN 362

Query: 382 MCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTK 441
            C+K F++R++L+KH R+HTGE+PY C  CGK F+Q +NL+ H R+H+GE+PY C  CTK
Sbjct: 363 QCNKMFSRRSDLVKHHRIHTGEKPYECDECGKTFSQSSNLILHQRIHTGEKPYPCSDCTK 422

Query: 442 TFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKP 490
           +F ++S+L +H+R+HTG KPY+C  C K+F+Q+ +LTKH+   H   KP
Sbjct: 423 SFSRRSDLVKHQRIHTGEKPYACNQCDKSFSQSSDLTKHQ-RVHSGEKP 470




May be involved in transcriptional regulation.
Pongo abelii (taxid: 9601)
>sp|P15620|ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus GN=Znf271 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZCX4|ZN568_HUMAN Zinc finger protein 568 OS=Homo sapiens GN=ZNF568 PE=2 SV=2 Back     alignment and function description
>sp|Q14591|ZN271_HUMAN Zinc finger protein 271 OS=Homo sapiens GN=ZNF271 PE=2 SV=4 Back     alignment and function description
>sp|A1YG88|ZNF16_PANPA Zinc finger protein 16 OS=Pan paniscus GN=ZNF16 PE=3 SV=1 Back     alignment and function description
>sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 Back     alignment and function description
>sp|P17020|ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens GN=ZNF16 PE=1 SV=3 Back     alignment and function description
>sp|A1YF12|ZNF16_GORGO Zinc finger protein 16 OS=Gorilla gorilla gorilla GN=ZNF16 PE=3 SV=1 Back     alignment and function description
>sp|A2T759|ZNF16_PANTR Zinc finger protein 16 OS=Pan troglodytes GN=ZNF16 PE=3 SV=1 Back     alignment and function description
>sp|Q14590|ZN235_HUMAN Zinc finger protein 235 OS=Homo sapiens GN=ZNF235 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
328706819 818 PREDICTED: zinc finger protein 91-like [ 0.786 0.522 0.376 9e-87
328715046392 PREDICTED: zinc finger protein 271-like 0.650 0.900 0.4 2e-83
328705603 735 PREDICTED: zinc finger protein 62 homolo 0.797 0.589 0.354 2e-82
397520352 1102 PREDICTED: zinc finger protein 271-like 0.627 0.309 0.403 7e-81
197099478 672 zinc finger protein 271 [Pongo abelii] g 0.626 0.505 0.405 7e-81
61557076580 zinc finger protein 271 [Rattus norvegic 0.674 0.631 0.385 8e-81
426253963 722 PREDICTED: zinc finger protein 271-like 0.611 0.459 0.407 2e-80
114672750 672 PREDICTED: zinc finger protein 271-like 0.626 0.505 0.403 2e-80
354477288582 PREDICTED: zinc finger protein 271 [Cric 0.611 0.570 0.405 3e-80
441603025 688 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.626 0.494 0.403 3e-80
>gi|328706819|ref|XP_003243211.1| PREDICTED: zinc finger protein 91-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  327 bits (838), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 182/483 (37%), Positives = 268/483 (55%), Gaps = 56/483 (11%)

Query: 25  FVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLVNLPLERSR 84
           F C VC K+F+QS              NLT      H+      +  ++   + P   S 
Sbjct: 90  FPCDVCEKSFSQSG-------------NLTA---HRHTHTGEKPYACDVCDKSFPTS-SN 132

Query: 85  RSTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLWG- 143
            +TH R HTGE+P+ C+VC K+F++  +L KH +THTGEKPY C +C+K+F+  +NL   
Sbjct: 133 FTTHRRTHTGEKPYACDVCEKSFSEIGSLTKHKRTHTGEKPYKCDVCEKSFSTSSNLTTH 192

Query: 144 --------SWVCHPTAVRDLFLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTH 195
                    + C           +L  H R+HTGE+PF C+VC K+F+Q  NL  H +TH
Sbjct: 193 RRTHTGEKPYACDVCEKSFSASTDLTIHRRMHTGEKPFPCDVCEKSFSQSGNLIAHRRTH 252

Query: 196 TGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKEEVEVEVDVCAGIYP------ 249
           TGEKPY C +C+K+F++ ++L +H R HT           E     DVC   +       
Sbjct: 253 TGEKPYACDVCEKSFSESSHLTRHKRTHTG----------EKPYACDVCEKSFSTSTDLT 302

Query: 250 LHQEGGVGLMGLPSHCC------PGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLT 303
           +H+    G    P   C       G +   ++    +  + C VC K+FT+S      LT
Sbjct: 303 IHRRMHTGEKPFPCDVCDKSFSKSGNLIAHRRMHTGEKPYACDVCEKSFTESG----SLT 358

Query: 304 KSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQP 363
           K R  +  TG+  +  ++ ++    +      NL  H R+HTGE+PF C+VC K+F+Q  
Sbjct: 359 KHR--RTHTGEKPYKLNQCDVCD--KSFSESTNLTIHRRMHTGEKPFPCDVCEKSFSQSG 414

Query: 364 NLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVK 423
           NL  H +THTGEKP+ C +CDK+F++  NL  H R HTGE+PY+C +C K F++  NL K
Sbjct: 415 NLTAHRRTHTGEKPFLCDVCDKSFSKSTNLTTHRRTHTGEKPYACDVCEKSFSESGNLTK 474

Query: 424 HNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELS 483
           H + H+GE+PY C  C K+F + S+L +H+R HTG KPY+C +C K+F+Q+GNLTKH+ +
Sbjct: 475 HKQTHTGEKPYACDVCEKSFSESSHLTKHKRTHTGEKPYACDVCEKSFSQSGNLTKHKRT 534

Query: 484 AHG 486
             G
Sbjct: 535 HTG 537




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|328715046|ref|XP_001949223.2| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328705603|ref|XP_003242853.1| PREDICTED: zinc finger protein 62 homolog [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|397520352|ref|XP_003830283.1| PREDICTED: zinc finger protein 271-like [Pan paniscus] Back     alignment and taxonomy information
>gi|197099478|ref|NP_001126681.1| zinc finger protein 271 [Pongo abelii] gi|75070496|sp|Q5R5U3.1|ZN271_PONAB RecName: Full=Zinc finger protein 271 gi|55732341|emb|CAH92873.1| hypothetical protein [Pongo abelii] Back     alignment and taxonomy information
>gi|61557076|ref|NP_001013159.1| zinc finger protein 271 [Rattus norvegicus] gi|58476737|gb|AAH89850.1| Zinc finger protein 35 [Rattus norvegicus] gi|149017074|gb|EDL76125.1| zinc finger protein 239, isoform CRA_a [Rattus norvegicus] gi|149017075|gb|EDL76126.1| zinc finger protein 239, isoform CRA_a [Rattus norvegicus] Back     alignment and taxonomy information
>gi|426253963|ref|XP_004020658.1| PREDICTED: zinc finger protein 271-like [Ovis aries] Back     alignment and taxonomy information
>gi|114672750|ref|XP_523909.2| PREDICTED: zinc finger protein 271-like [Pan troglodytes] Back     alignment and taxonomy information
>gi|354477288|ref|XP_003500854.1| PREDICTED: zinc finger protein 271 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|441603025|ref|XP_003261976.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 271-like [Nomascus leucogenys] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
UNIPROTKB|F1RKM8 678 ZNF420 "Uncharacterized protei 0.701 0.561 0.375 7e-70
UNIPROTKB|J9NYQ6717 ZNF677 "Uncharacterized protei 0.699 0.529 0.394 2.5e-81
UNIPROTKB|F1MSL7652 F1MSL7 "Uncharacterized protei 0.613 0.510 0.358 2.7e-59
ZFIN|ZDB-GENE-110913-39 639 si:dkey-202n8.1 "si:dkey-202n8 0.447 0.380 0.379 6e-46
UNIPROTKB|P17035718 ZNF28 "Zinc finger protein 28" 0.788 0.596 0.346 9.7e-64
UNIPROTKB|G3N2G8759 ZNF397 "Zinc finger protein 39 0.710 0.508 0.396 1.1e-80
UNIPROTKB|F1RKP8646 ZNF568 "Uncharacterized protei 0.697 0.586 0.408 6.2e-78
UNIPROTKB|Q9H7R5613 ZNF665 "Zinc finger protein 66 0.705 0.624 0.384 5.9e-73
UNIPROTKB|Q3ZCX4644 ZNF568 "Zinc finger protein 56 0.697 0.588 0.408 4.2e-79
UNIPROTKB|J9NXK0744 ZNF84 "Uncharacterized protein 0.657 0.479 0.359 1.5e-65
UNIPROTKB|F1RKM8 ZNF420 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 708 (254.3 bits), Expect = 7.0e-70, P = 7.0e-70
 Identities = 157/418 (37%), Positives = 216/418 (51%)

Query:    91 IHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANL-------WG 143
             IHTGE+P+ C  C K F++   L  H + HTGEKPY+C  C KAFTQ + L        G
Sbjct:     1 IHTGEKPYECMQCGKAFSRDSQLSLHQRLHTGEKPYSCKECGKAFTQSSQLILHHRTHTG 60

Query:   144 S--WVCHPTAVRDLFLVN-LGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKP 200
                + C     RD    + L  H+++HTGE+P++C+ C K FTQ   L  H + HTGEK 
Sbjct:    61 EKPYKCEECG-RDFIRSSQLSRHQKVHTGEKPYKCKECGKAFTQNSQLTLHQRLHTGEKL 119

Query:   201 YNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKXXXXXXXXXCAGIYPLHQEGGVGLMG 260
             Y C  C K FTQ + L+ H R+HT   K Y  ++         C      HQ+   G   
Sbjct:   120 YECKECRKVFTQLSQLILHKRIHTGE-KPYECKECGKAFI---CGSQLSQHQKIHNGEK- 174

Query:   261 LPSHC--CP-----GPIXXXXXXXXX-DGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLT 312
              P  C  C      G +          +  + C+ C K F + S     LT+ + I    
Sbjct:   175 -PYECQECGKAFIRGSLLMQHQRIHTGEKPYKCEECGKAFIRGSQ----LTQHQRIHTNE 229

Query:   313 GKISWAHSERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTH 372
                      R  S   +       L  H+RIHTGE+P++C+ C K F +   L +H + H
Sbjct:   230 KPYECKECGRTFSHGSQ-------LSQHQRIHTGEKPYQCKECGKAFNRGSLLTRHQRIH 282

Query:   373 TGEKPYNCGMCDKAFTQRANLLKHIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGER 432
             TGEKPY C  C K F++ + L +H R+HTGE+PY CK CGK F + + L +H R+H+GE+
Sbjct:   283 TGEKPYECKECGKTFSRGSELTQHERIHTGEKPYECKECGKSFIRGSQLTQHERIHTGEK 342

Query:   433 PYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKP 490
             PY C+ C   F Q S+L +H+R+HTG KPY C  C KAFA+   L +H+   H   KP
Sbjct:   343 PYKCKECRMAFTQSSHLSQHQRLHTGEKPYVCNECGKAFARGLLLIQHQ-RIHTGEKP 399


GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|J9NYQ6 ZNF677 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MSL7 F1MSL7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-39 si:dkey-202n8.1 "si:dkey-202n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P17035 ZNF28 "Zinc finger protein 28" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3N2G8 ZNF397 "Zinc finger protein 397" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RKP8 ZNF568 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H7R5 ZNF665 "Zinc finger protein 665" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q3ZCX4 ZNF568 "Zinc finger protein 568" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NXK0 ZNF84 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 3e-10
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 1e-06
COG5189423 COG5189, SFP1, Putative transcriptional repressor 3e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 1e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.003
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 62.0 bits (150), Expect = 3e-10
 Identities = 61/327 (18%), Positives = 102/327 (31%), Gaps = 31/327 (9%)

Query: 171 RPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCG--MCDKAFTQRANLLKHIRVHTENLK 228
           RP  C  C  +F++  +L +H+++HTGEKP  C    CDK+F++   L +H+R H  N  
Sbjct: 32  RPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLELSRHLRTHHNN-P 90

Query: 229 LYTRRKEEVEVEVDVCAGIYPLHQEGGVGLMGLPSHCCPGPIRKRKKKPRRDGTFVCKVC 288
                K          +               L SH  P   R  +       + +    
Sbjct: 91  SDLNSKSLPLSNSKASSSSLSSSSSNSNDNNLLSSHSLPPSSRDPQLPDLLSISNLRNNP 150

Query: 289 NKTFTQSSWGHKGLTKSRDI--QNLTGKISWAHSERNISGW-------------LEELPL 333
                 SS               N   K   ++    IS               L     
Sbjct: 151 LPGNNSSSVNTPQSNSLHPPLPANSLSKDPSSNLSLLISSNVSTSIPSSSENSPLSSSYS 210

Query: 334 LVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKT------HTGEKPYNCGMCDKAF 387
           + +  + + +             +   +                 +  +     +   + 
Sbjct: 211 IPSSSSDQNLENSSSSLPLTTNSQLSPKSLLSQSPSSLSSSDSSSSASESPRSSLPTASS 270

Query: 388 TQRANLLKHIRVHTGER-PYSCKLCGKRFTQQANLVKHNR--LHSGE--RPYHCRY--CT 440
              +          G   P   K C   F++ + L +H R   HSGE  +P+ C Y  C 
Sbjct: 271 QSSSPNESDSSSEKGFSLPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCG 330

Query: 441 KTFIQQSNLDRHERVHTGVKPYSCKIC 467
           K F +   L RH  +HT + P   K+ 
Sbjct: 331 KLFSRNDALKRHILLHTSISPAKEKLL 357


Length = 467

>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 543
KOG1074|consensus958 99.97
KOG2462|consensus279 99.97
KOG1074|consensus958 99.96
KOG2462|consensus279 99.95
KOG3608|consensus467 99.94
KOG3608|consensus467 99.92
KOG3623|consensus 1007 99.92
KOG3623|consensus 1007 99.89
KOG3576|consensus267 99.74
KOG3576|consensus267 99.74
PLN03086567 PRLI-interacting factor K; Provisional 99.44
PLN03086567 PRLI-interacting factor K; Provisional 99.29
PHA00733128 hypothetical protein 99.28
PHA00733128 hypothetical protein 99.2
PHA0276855 hypothetical protein; Provisional 99.0
KOG3993|consensus500 98.93
PHA0276855 hypothetical protein; Provisional 98.93
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.74
KOG3993|consensus500 98.73
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.66
PHA0061644 hypothetical protein 98.49
PHA0061644 hypothetical protein 98.45
PHA0073279 hypothetical protein 98.37
PHA0073279 hypothetical protein 98.3
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.06
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.88
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.85
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.75
KOG1146|consensus 1406 97.75
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.56
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.54
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.49
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.46
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.38
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.38
COG5189423 SFP1 Putative transcriptional repressor regulating 97.38
COG5189423 SFP1 Putative transcriptional repressor regulating 97.25
KOG1146|consensus 1406 97.05
KOG2231|consensus 669 96.97
KOG2231|consensus 669 96.88
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.83
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.8
COG5048467 FOG: Zn-finger [General function prediction only] 96.74
smart0035526 ZnF_C2H2 zinc finger. 96.71
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.66
PRK04860160 hypothetical protein; Provisional 96.58
smart0035526 ZnF_C2H2 zinc finger. 96.51
KOG2785|consensus390 96.49
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.28
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.26
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.16
PRK04860160 hypothetical protein; Provisional 96.1
COG5048467 FOG: Zn-finger [General function prediction only] 95.72
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.66
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.62
KOG2785|consensus390 95.08
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.05
KOG2482|consensus423 94.57
COG5236493 Uncharacterized conserved protein, contains RING Z 94.52
KOG2893|consensus 341 93.26
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.11
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.91
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 91.72
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.55
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 91.07
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 90.71
KOG2482|consensus423 90.53
KOG2893|consensus 341 89.35
KOG4173|consensus253 89.2
KOG4173|consensus253 88.57
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.55
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.37
COG404965 Uncharacterized protein containing archaeal-type C 88.23
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 84.01
KOG2186|consensus276 82.64
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 82.34
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 81.48
COG404965 Uncharacterized protein containing archaeal-type C 80.81
>KOG1074|consensus Back     alignment and domain information
Probab=99.97  E-value=1.1e-31  Score=262.86  Aligned_cols=58  Identities=36%  Similarity=0.658  Sum_probs=55.4

Q ss_pred             ccccccccccCCchhHHhhhhhhCCCCceeccccchhccCcchHHHHHHhhcCCCCCC
Q psy2726         434 YHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELSAHGIGKPG  491 (543)
Q Consensus       434 ~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~  491 (543)
                      ..|.+|++.|.+.+.|..||++|+++|||.|.+|++.|..+.+|+.||.+|+...++.
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHMgtH~w~q~~s  937 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHMGTHMWVQPPS  937 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhhccccccCCCc
Confidence            6799999999999999999999999999999999999999999999999999887764



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-41
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 9e-22
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-10
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-17
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 5e-17
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 6e-17
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-17
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 9e-17
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-16
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 4e-16
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-15
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-16
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-15
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-16
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-15
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-15
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-15
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 2e-15
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-14
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-15
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-14
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 2e-15
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-14
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-15
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 3e-11
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 2e-14
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-14
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-14
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-13
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 1e-12
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-13
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 4e-13
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 9e-13
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-11
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 9e-13
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 3e-06
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-12
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 4e-11
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 4e-12
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 4e-08
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-11
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-11
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-09
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-10
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 1e-10
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-10
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 2e-10
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-10
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 2e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 1e-08
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 8e-08
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 5e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-07
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 3e-06
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-06
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 9e-07
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 2e-04
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-06
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-06
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-05
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2ep3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-05
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 4e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 4e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 9e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 6e-04
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-05
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2enh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 9e-05
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2ytj_A46 Solution Structure Of The C2h2 Type Zinc Finger (re 1e-04
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 2e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 7e-04
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eoe_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eon_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 2e-04
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 6e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2enf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2em1_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2em1_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2yu8_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2em9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2em2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2emg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 8e-04
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 8e-04
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 8e-04
2yti_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2ept_A41 Solution Structure Of The First C2h2 Type Zinc Fing 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 166 bits (419), Expect = 4e-41, Method: Compositional matrix adjust. Identities = 75/151 (49%), Positives = 103/151 (68%) Query: 336 NLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLK 395 +L H+R HTGE+P++C C K+F+ + +L +H +THTGEKPY C C K+F+QRANL Sbjct: 36 HLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRA 95 Query: 396 HIRVHTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERV 455 H R HTGE+PY+C CGK F+Q A+L H R H+GE+PY C C K+F ++ NL H+R Sbjct: 96 HQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRT 155 Query: 456 HTGVKPYSCKICWKAFAQTGNLTKHELSAHG 486 HTG KPY C C K+F++ L H+ + G Sbjct: 156 HTGEKPYKCPECGKSFSRRDALNVHQRTHTG 186
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EP3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 631- 663) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 369- 401) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2ENH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 556- 588) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2YTJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (region 771- 803) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EOE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 508- 540) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EON|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 397- 429) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2ENF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 340- 372) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EM1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 637- 667) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EM1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 637- 667) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YU8|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 648- 680) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EM9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 367- 399) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EM2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 584- 616) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EMG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 463- 495) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2YTI|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 564- 596) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EPT|A Chain A, Solution Structure Of The First C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 32 Length = 41 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-66
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-65
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-55
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-53
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-49
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-49
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-48
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-37
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-37
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-23
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-55
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-53
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-42
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-42
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-41
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-37
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-31
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-30
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-50
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-41
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-40
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-36
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-36
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-33
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-29
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-27
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-49
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-44
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-42
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-35
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-30
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-48
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-46
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-45
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-38
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-33
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-46
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-46
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-42
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-35
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-32
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-32
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-31
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-19
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-45
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-45
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-41
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-37
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-36
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-26
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-45
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-43
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-43
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-38
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 9e-33
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-31
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-09
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-45
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-38
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-38
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-37
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-35
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-31
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-43
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-43
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-40
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-35
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-33
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-32
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-27
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-18
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-34
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-34
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-31
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-30
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-23
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-33
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-33
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-32
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-31
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-29
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-29
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-15
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-13
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-33
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-31
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-30
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-28
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-28
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-26
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-32
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-30
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-29
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-26
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-24
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-31
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-26
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-26
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-24
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-30
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-30
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-27
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-27
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-26
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-26
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-22
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 8e-30
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-30
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-29
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-25
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-25
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-25
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-14
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-29
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-28
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-27
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-25
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-24
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-23
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-14
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-12
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-29
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-28
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-28
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-24
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 7e-24
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-24
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-22
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-29
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-28
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-27
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-26
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-25
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-22
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-29
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-27
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-27
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-25
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-24
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 6e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-27
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-26
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-25
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-22
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-18
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-16
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-14
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-26
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-25
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-25
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-24
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-23
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-23
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-23
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-23
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-22
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-22
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-21
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-17
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-11
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-20
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-20
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-19
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-18
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-17
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-19
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 3e-19
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-17
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-14
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-11
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-17
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-16
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-16
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-15
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-13
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-15
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 4e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-17
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-13
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-17
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-15
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-15
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-15
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-13
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-12
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-13
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-17
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-15
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-16
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-15
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-15
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-15
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-14
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-12
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-11
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-14
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-16
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-16
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-14
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-12
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-16
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-13
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-16
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-15
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-15
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-15
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-14
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-15
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-11
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-16
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-12
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-11
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-08
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-16
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-16
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-15
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-15
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-15
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-15
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-12
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-16
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-16
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-15
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-15
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-15
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-14
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-14
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-11
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-16
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-12
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-08
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-15
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-15
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-16
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-16
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-12
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-16
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-12
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-11
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-16
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-12
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-16
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-12
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-11
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-16
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-11
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-16
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-15
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-15
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-12
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-16
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-15
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-14
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-12
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-11
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-16
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-13
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-12
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 6e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-16
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-12
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-12
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-16
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-12
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-12
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-11
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-16
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-11
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-16
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-15
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-12
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-16
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-16
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-16
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-16
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-12
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-16
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-14
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-12
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-16
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-16
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-11
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-16
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-16
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-13
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-12
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-11
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-16
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-16
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-16
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-15
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-11
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-16
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-16
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-15
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-16
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-15
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-11
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 9e-16
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-14
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-14
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-13
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-12
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-11
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-14
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-15
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-15
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-15
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-15
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-15
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-12
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-11
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-12
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-15
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-11
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-14
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-14
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-12
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-15
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-13
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 4e-14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-14
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-14
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-11
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-14
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-15
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-15
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-13
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-14
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-11
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-11
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-11
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-15
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-15
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-14
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-13
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-10
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 7e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-12
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-12
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-09
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-14
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-12
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 9e-13
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 7e-11
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 9e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-08
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 9e-12
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-12
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-12
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-12
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 7e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-11
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 9e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-09
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 7e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 9e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-07
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-08
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 4e-06
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 2e-05
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 1e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 3e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 7e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 7e-04
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 7e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 7e-05
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 4e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 7e-04
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 7e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  210 bits (538), Expect = 8e-66
 Identities = 79/198 (39%), Positives = 109/198 (55%), Gaps = 39/198 (19%)

Query: 283 FVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAHSERNISGWLEELPLLVNLGTHER 342
           + C  C K+F++S                                        +L  H+R
Sbjct: 22  YACPECGKSFSRSD---------------------------------------HLAEHQR 42

Query: 343 IHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTG 402
            HTGE+P++C  C K+F+ + +L +H +THTGEKPY C  C K+F+QRANL  H R HTG
Sbjct: 43  THTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTG 102

Query: 403 ERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPY 462
           E+PY+C  CGK F+Q A+L  H R H+GE+PY C  C K+F ++ NL  H+R HTG KPY
Sbjct: 103 EKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPY 162

Query: 463 SCKICWKAFAQTGNLTKH 480
            C  C K+F++   L  H
Sbjct: 163 KCPECGKSFSRRDALNVH 180


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Length = 29 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query543
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.93
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.92
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.92
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.83
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.83
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.83
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.82
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.81
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.81
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.81
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.8
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.79
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.79
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.78
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.77
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.75
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.73
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.73
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.72
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.72
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.68
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.67
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.67
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.66
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.65
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.65
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.64
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.62
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.61
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.61
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.61
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.6
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.59
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.58
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.58
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.58
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.56
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.55
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.55
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.55
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.54
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.53
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.53
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.52
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.52
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.52
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.5
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.5
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.5
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.48
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.47
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.47
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.43
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.42
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.4
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.38
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.37
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.37
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.33
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.32
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.32
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.32
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.32
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.31
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.31
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.3
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.3
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.3
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.3
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.3
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.3
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.28
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.28
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.27
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.25
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.23
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.22
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.22
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.21
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.21
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.21
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.2
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.2
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.2
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.18
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.18
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.18
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.17
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.17
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.15
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.14
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.14
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.12
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.12
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.1
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.08
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.04
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.01
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.01
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.0
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.99
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.98
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.96
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.94
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.94
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.92
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.92
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.89
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.8
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.8
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.77
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.72
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.71
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.7
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.66
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.65
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.64
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.57
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.56
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.55
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.48
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.47
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.47
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.44
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.43
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.41
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.39
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.37
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.37
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.35
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.29
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.27
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.27
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.25
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.22
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.22
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.21
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.2
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.2
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.19
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.19
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.18
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.18
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.48
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.17
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.17
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.16
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.15
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.15
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.44
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.15
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.1
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.09
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.08
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.08
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.07
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.07
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.34
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.06
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.05
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.05
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.28
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.27
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.97
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.11
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.8
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.68
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.6
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.27
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.6
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.54
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.25
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.1
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.74
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.6
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.23
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.79
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.81
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 88.38
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 87.45
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 86.99
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 85.52
2k5c_A95 Uncharacterized protein PF0385; structural genomic 83.29
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.4
2k5c_A95 Uncharacterized protein PF0385; structural genomic 80.57
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 80.51
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 80.36
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.4e-39  Score=287.81  Aligned_cols=182  Identities=46%  Similarity=0.942  Sum_probs=108.7

Q ss_pred             cccccccccCCCccccCccccccCCchhHHHHHhhhcCCCCcccccchhhccChHHHHHHHHHHhcccccccccccccce
Q psy2726         160 LGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRVHTENLKLYTRRKEEVEV  239 (543)
Q Consensus       160 l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~~~~~~~~~~  239 (543)
                      |..|+.++.++++|.|++|++.|.+...|..|+++|.++++|.|+.|++.|.+...|..|++.|++              
T Consensus         9 l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~--------------   74 (190)
T 2i13_A            9 SVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTG--------------   74 (190)
T ss_dssp             ----------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHC--------------
T ss_pred             chhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCC--------------
Confidence            666777777777777777777777777777777777777777777777777777777777666542              


Q ss_pred             ecccccCccccccCCCcccCCCCCCCCCCCcccccCCCCCCCCcccccccccccCCcccCcCCCcchhhhhccCCccccc
Q psy2726         240 EVDVCAGIYPLHQEGGVGLMGLPSHCCPGPIRKRKKKPRRDGTFVCKVCNKTFTQSSWGHKGLTKSRDIQNLTGKISWAH  319 (543)
Q Consensus       240 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~~~~~~~~~~~~~~~~~~~~~~~  319 (543)
                                                                                                      
T Consensus        75 --------------------------------------------------------------------------------   74 (190)
T 2i13_A           75 --------------------------------------------------------------------------------   74 (190)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccCccccccccccccchhhhhhhcCCCCCeecccCccccCCchhHHhhhhhcCCCCCccCccchhccCChHHHHHHHhh
Q psy2726         320 SERNISGWLEELPLLVNLGTHERIHTGERPFRCEVCMKTFTQQPNLWKHMKTHTGEKPYNCGMCDKAFTQRANLLKHIRV  399 (543)
Q Consensus       320 ~~~~~~~~~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~k~~~C~~C~~~f~~~~~L~~H~~~  399 (543)
                                                 +++|.|++|++.|.+...|..|+++|+++++|.|++|++.|.+...|..|+++
T Consensus        75 ---------------------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  127 (190)
T 2i13_A           75 ---------------------------EKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRT  127 (190)
T ss_dssp             ---------------------------CCCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHH
T ss_pred             ---------------------------CCCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHH
Confidence                                       23466777777777777777777777777777777777777777777777777


Q ss_pred             hCCCCCcccccccccccChHHHHhhhhhccCCCcccccccccccCCchhHHhhhhhhCCCCce
Q psy2726         400 HTGERPYSCKLCGKRFTQQANLVKHNRLHSGERPYHCRYCTKTFIQQSNLDRHERVHTGVKPY  462 (543)
Q Consensus       400 H~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~  462 (543)
                      |++++||.|++|++.|.+...|..|+++|++++||.|++|++.|.+...|..|+++|+|++||
T Consensus       128 h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          128 HTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             hCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            777777777777777777777777777777777777777777777777777777777776665



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 543
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-10
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-11
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-09
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 7e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-08
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 9e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 7e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-08
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-10
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-09
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 9e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.003
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-08
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-09
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 2e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-06
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 7e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 1e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 9e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 9e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 9e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.003
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 3e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.003
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 8e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 4e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-06
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 6e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 9e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 9e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 7e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 4e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 1e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 3e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 5e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 5e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 4e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.001
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.001
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 55.7 bits (135), Expect = 3e-11
 Identities = 19/32 (59%), Positives = 25/32 (78%)

Query: 372 HTGEKPYNCGMCDKAFTQRANLLKHIRVHTGE 403
           H+GEKPY C  C KAF++ + L++H RVHTGE
Sbjct: 2   HSGEKPYGCVECGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query543
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.66
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.66
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.33
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.33
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.26
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.21
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.19
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.19
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.18
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.18
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.15
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.13
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.11
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.07
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.07
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.06
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.02
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.01
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.01
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.96
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.95
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.93
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.93
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.86
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.83
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.8
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.8
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.77
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.7
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.67
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.66
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.58
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.5
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.46
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.45
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.43
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.35
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.28
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.24
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.21
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.15
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.09
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.08
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.01
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.98
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.98
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.94
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.93
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.85
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.79
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.73
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.66
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.63
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.58
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.52
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.48
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.46
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.45
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.4
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.39
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.38
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.37
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.34
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.23
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.21
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.21
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.13
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.13
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.11
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.1
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.08
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.05
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.04
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.95
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.89
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.75
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.72
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.61
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.52
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.32
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.0
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.92
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.84
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.81
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.77
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.08
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.06
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.81
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 94.64
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.6
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.23
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.22
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.36
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 93.33
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.57
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 92.56
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.48
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 91.64
d1y0jb136 U-shaped transcription factor, different fingers { 91.37
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 91.36
d1y0jb136 U-shaped transcription factor, different fingers { 91.07
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 90.67
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 89.45
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.38
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 89.13
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.97
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 88.86
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.23
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 87.74
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 87.73
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 85.93
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 85.38
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 85.21
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 84.65
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 80.94
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.66  E-value=2.2e-17  Score=108.77  Aligned_cols=52  Identities=37%  Similarity=0.810  Sum_probs=29.9

Q ss_pred             CCcccccccccccCCchhHHhhhhhhCCCCceeccccchhccCcchHHHHHHh
Q psy2726         431 ERPYHCRYCTKTFIQQSNLDRHERVHTGVKPYSCKICWKAFAQTGNLTKHELS  483 (543)
Q Consensus       431 ~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~  483 (543)
                      ||||.|. ||++|..+..|..|+++|++++||.|.+||++|.+.+.|..|+++
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            3555553 555555555555555555555555555555555555555555554



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure