Psyllid ID: psy2797

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-----
MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRLLNYSDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGEQKNGLNPLILS
cEEEccccHHHHHHccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHccccEEEEEEccccHHHHHHHccHHHHHHHHHHHHHccccccccccc
EEccccEccHHHHccEEEccccEEEcEEEEEEccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccEEEEEcccccHHHHHHHcHHHHHHHHHHHHHcccccccccccc
maiaplsitserervvdfskpfMTLGISIMikkpskqkprvlsfldpLSEEIWVAIIFSYIMVSVVLFLVSrfsphewrllnysdpghphhspsphhgpsppsviandfslsnSFWFSLGAFmqqgsdisprsisgrIVGAVWWFFTLILISSYTANLAAFLTVERmvnpinsvedladqsdvlygtvkdastyhfFEVSAVNLVADVVRALGeqknglnplils
maiaplsitserervvdfsKPFMTLGISimikkpskqkprVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRLLNYSDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALgeqknglnplils
MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMvsvvlflvsrfsPHEWRLLNYSDpghphhspsphhgpsppsVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGEQKNGLNPLILS
**************VVDFSKPFMTLGISIMIKK*****PRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRLLNY*********************IANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGE***********
MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRL***********************VIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGE*******L***
MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRLLNYSDP**************PPSVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGEQKNGLNPLILS
MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRLLN*************HHGPSPPSVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGE***********
oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRLLNYSDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGEQKNGLNPLILS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query225 2.2.26 [Sep-21-2011]
Q38PU6 894 Glutamate receptor 3 OS=M N/A N/A 0.857 0.215 0.658 2e-72
P42263 894 Glutamate receptor 3 OS=H yes N/A 0.857 0.215 0.663 7e-72
P19492 888 Glutamate receptor 3 OS=R yes N/A 0.857 0.217 0.663 8e-72
Q9Z2W9 888 Glutamate receptor 3 OS=M yes N/A 0.857 0.217 0.663 8e-72
P23819 883 Glutamate receptor 2 OS=M no N/A 0.848 0.216 0.643 1e-71
P42262 883 Glutamate receptor 2 OS=H no N/A 0.848 0.216 0.643 1e-71
P19491 883 Glutamate receptor 2 OS=R no N/A 0.848 0.216 0.643 1e-71
Q38PU7 883 Glutamate receptor 2 OS=M N/A N/A 0.848 0.216 0.638 4e-71
P19493 902 Glutamate receptor 4 OS=R no N/A 0.844 0.210 0.655 4e-71
Q38PU5 902 Glutamate receptor 4 OS=M N/A N/A 0.844 0.210 0.655 5e-71
>sp|Q38PU6|GRIA3_MACFA Glutamate receptor 3 OS=Macaca fascicularis GN=GRIA3 PE=2 SV=1 Back     alignment and function desciption
 Score =  271 bits (694), Expect = 2e-72,   Method: Composition-based stats.
 Identities = 133/202 (65%), Positives = 156/202 (77%), Gaps = 9/202 (4%)

Query: 1   MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSY 60
           +A+APL+IT  RE V+DFSKPFM+LGISIMIKKP K KP V SFLDPL+ EIW+ I+F+ 
Sbjct: 504 IAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAS 563

Query: 61  IMVSVVLFLVSRFSPHEWRLLNYSDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLG 120
           I VSVVLFLVSRFSP+EW L + ++   P    SP   P PP    N+F + NS WFSLG
Sbjct: 564 IGVSVVLFLVSRFSPYEWHLEDNNE--EPRDPQSP---PDPP----NEFGIFNSLWFSLG 614

Query: 121 AFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQ 180
           AFMQQG DISPRS+SGRIVG VWWFFTLI+ISSYTANLAAFLTVERMV+PI S EDLA Q
Sbjct: 615 AFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQ 674

Query: 181 SDVLYGTVKDASTYHFFEVSAV 202
           +++ YGT+   ST  FF  S +
Sbjct: 675 TEIAYGTLDSGSTKEFFRRSKI 696
Receptor for glutamate that functions as ligand-gated ion channel in the central nervous system and plays an important role in excitatory synaptic transmission. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. In the presence of CACNG4 or CACNG7 or CACNG8, shows resensitization which is characterized by a delayed accumulation of current flux upon continued application of glutamate.
Macaca fascicularis (taxid: 9541)
>sp|P42263|GRIA3_HUMAN Glutamate receptor 3 OS=Homo sapiens GN=GRIA3 PE=1 SV=2 Back     alignment and function description
>sp|P19492|GRIA3_RAT Glutamate receptor 3 OS=Rattus norvegicus GN=Gria3 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z2W9|GRIA3_MOUSE Glutamate receptor 3 OS=Mus musculus GN=Gria3 PE=1 SV=2 Back     alignment and function description
>sp|P23819|GRIA2_MOUSE Glutamate receptor 2 OS=Mus musculus GN=Gria2 PE=1 SV=3 Back     alignment and function description
>sp|P42262|GRIA2_HUMAN Glutamate receptor 2 OS=Homo sapiens GN=GRIA2 PE=1 SV=3 Back     alignment and function description
>sp|P19491|GRIA2_RAT Glutamate receptor 2 OS=Rattus norvegicus GN=Gria2 PE=1 SV=2 Back     alignment and function description
>sp|Q38PU7|GRIA2_MACFA Glutamate receptor 2 OS=Macaca fascicularis GN=GRIA2 PE=2 SV=1 Back     alignment and function description
>sp|P19493|GRIA4_RAT Glutamate receptor 4 OS=Rattus norvegicus GN=Gria4 PE=1 SV=1 Back     alignment and function description
>sp|Q38PU5|GRIA4_MACFA Glutamate receptor 4 OS=Macaca fascicularis GN=GRIA4 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
189241889 929 PREDICTED: similar to AGAP006027-PA [Tri 0.942 0.228 0.672 2e-77
340716839 924 PREDICTED: glutamate receptor 1-like [Bo 0.951 0.231 0.658 2e-77
380018371 1105 PREDICTED: LOW QUALITY PROTEIN: glutamat 0.951 0.193 0.658 3e-77
350402901 924 PREDICTED: glutamate receptor 1-like [Bo 0.951 0.231 0.658 3e-77
383858325 1111 PREDICTED: glutamate receptor 1-like [Me 0.951 0.192 0.658 3e-77
332021791 1002 Glutamate receptor 1 [Acromyrmex echinat 0.893 0.200 0.678 5e-76
242019761 836 glutamate receptor 1 precursor, putative 0.906 0.244 0.676 8e-76
345478907 917 PREDICTED: glutamate receptor 1-like, pa 0.955 0.234 0.641 1e-75
307208273 791 Glutamate receptor 1 [Harpegnathos salta 0.951 0.270 0.636 3e-75
307184662 879 Glutamate receptor 1 [Camponotus florida 0.951 0.243 0.632 7e-74
>gi|189241889|ref|XP_968786.2| PREDICTED: similar to AGAP006027-PA [Tribolium castaneum] gi|270016489|gb|EFA12935.1| hypothetical protein TcasGA2_TC010481 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 175/217 (80%), Gaps = 5/217 (2%)

Query: 1   MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSY 60
           +AIAP++ITSERERV+DFSKPFM+LGISIMIKKP KQKP V SFL+PLS+EIWV +IFSY
Sbjct: 524 IAIAPMTITSERERVIDFSKPFMSLGISIMIKKPMKQKPGVFSFLNPLSKEIWVCVIFSY 583

Query: 61  IMVSVVLFLVSRFSPHEWRLLNYSDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLG 120
           I VS+VLF VSRFSP+EWRLL+ +     H  PS  H  S  + +ANDF++ NS WFSLG
Sbjct: 584 IGVSIVLFTVSRFSPYEWRLLHLTGE---HRDPSGQH--STHNSMANDFTMLNSLWFSLG 638

Query: 121 AFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQ 180
           AFMQQG DI+PRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMV PINS EDLA Q
Sbjct: 639 AFMQQGCDIAPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVAPINSPEDLASQ 698

Query: 181 SDVLYGTVKDASTYHFFEVSAVNLVADVVRALGEQKN 217
           ++V YGT+   +T+ FF+ S + L + +   +  +K+
Sbjct: 699 TEVEYGTLYHGATWDFFKRSQITLYSKMWEYMNSRKH 735

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340716839|ref|XP_003396900.1| PREDICTED: glutamate receptor 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380018371|ref|XP_003693103.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 1-like [Apis florea] Back     alignment and taxonomy information
>gi|350402901|ref|XP_003486640.1| PREDICTED: glutamate receptor 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383858325|ref|XP_003704652.1| PREDICTED: glutamate receptor 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332021791|gb|EGI62137.1| Glutamate receptor 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242019761|ref|XP_002430327.1| glutamate receptor 1 precursor, putative [Pediculus humanus corporis] gi|212515451|gb|EEB17589.1| glutamate receptor 1 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345478907|ref|XP_001600998.2| PREDICTED: glutamate receptor 1-like, partial [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307208273|gb|EFN85705.1| Glutamate receptor 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307184662|gb|EFN70991.1| Glutamate receptor 1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query225
FB|FBgn0264000 1095 GluRIB "Glutamate receptor IB" 0.444 0.091 0.7 1.1e-56
UNIPROTKB|F8W7L6730 GRIA2 "Glutamate receptor 2" [ 0.848 0.261 0.574 4.2e-56
UNIPROTKB|F1LNE4 756 Gria2 "Glutamate receptor 2" [ 0.848 0.252 0.574 4.2e-56
UNIPROTKB|A8MT92 836 GRIA2 "Glutamate receptor 2" [ 0.848 0.228 0.574 6.5e-56
UNIPROTKB|F1PE26 842 GRIA2 "Uncharacterized protein 0.848 0.226 0.574 7.2e-56
UNIPROTKB|F1PDR1 806 GRIA1 "Uncharacterized protein 0.848 0.236 0.569 8.6e-56
UNIPROTKB|B7Z1W1716 GRIA1 "Glutamate receptor 1" [ 0.848 0.266 0.569 8.6e-56
UNIPROTKB|I3LHM1 854 GRIA2 "Uncharacterized protein 0.848 0.223 0.574 8.7e-56
UNIPROTKB|F1MBY1 883 GRIA2 "Uncharacterized protein 0.848 0.216 0.574 1.2e-55
UNIPROTKB|F1MK58 883 GRIA2 "Uncharacterized protein 0.848 0.216 0.574 1.2e-55
FB|FBgn0264000 GluRIB "Glutamate receptor IB" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 1.1e-56, Sum P(2) = 1.1e-56
 Identities = 70/100 (70%), Positives = 81/100 (81%)

Query:   105 IANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTV 164
             + N+FS+ NSFWFSL AFMQQG D+SPRS+SGRI  A W+FFTLILISSYTANLAAFLTV
Sbjct:   733 VVNEFSVWNSFWFSLAAFMQQGCDLSPRSVSGRIAAASWFFFTLILISSYTANLAAFLTV 792

Query:   165 ERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNL 204
             ERMV PINS EDLA Q++V YGT+   ST+ FF  S + L
Sbjct:   793 ERMVTPINSPEDLAMQTEVQYGTLLHGSTWDFFRRSQIGL 832
GO:0008328 "ionotropic glutamate receptor complex" evidence=ISS
GO:0004970 "ionotropic glutamate receptor activity" evidence=IEA;ISS
GO:0004971 "alpha-amino-3-hydroxy-5-methyl-4-isoxazole propionate selective glutamate receptor activity" evidence=ISS
GO:0006812 "cation transport" evidence=ISS
GO:0005230 "extracellular ligand-gated ion channel activity" evidence=ISS
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
UNIPROTKB|F8W7L6 GRIA2 "Glutamate receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNE4 Gria2 "Glutamate receptor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A8MT92 GRIA2 "Glutamate receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PE26 GRIA2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PDR1 GRIA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z1W1 GRIA1 "Glutamate receptor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3LHM1 GRIA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBY1 GRIA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MK58 GRIA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P19492GRIA3_RATNo assigned EC number0.66330.85770.2173yesN/A
P34299GLR1_CAEELNo assigned EC number0.58210.880.2058yesN/A
Q9Z2W9GRIA3_MOUSENo assigned EC number0.66330.85770.2173yesN/A
P42263GRIA3_HUMANNo assigned EC number0.66330.85770.2158yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
pfam00060 268 pfam00060, Lig_chan, Ligand-gated ion channel 3e-60
pfam00497220 pfam00497, SBP_bac_3, Bacterial extracellular solu 1e-06
cd00134218 cd00134, PBPb, Bacterial periplasmic transport sys 3e-06
smart00062219 smart00062, PBPb, Bacterial periplasmic substrate- 5e-04
smart00079133 smart00079, PBPe, Eukaryotic homologues of bacteri 0.002
COG0834275 COG0834, HisJ, ABC-type amino acid transport/signa 0.003
>gnl|CDD|215685 pfam00060, Lig_chan, Ligand-gated ion channel Back     alignment and domain information 
 Score =  189 bits (483), Expect = 3e-60
 Identities = 79/160 (49%), Positives = 101/160 (63%), Gaps = 21/160 (13%)

Query: 51  EIWVAIIFSYIMVSVVLFLVSRFSPHEWRLLNYSDPGHPHHSPSPHHGPSPPSVIANDFS 110
           E+W+ I+ +Y++V VVLFL+ RFSP+EWR                      P    N F+
Sbjct: 1   EVWLCILAAYLLVGVVLFLLERFSPYEWR---------------------GPPEEPNQFT 39

Query: 111 LSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNP 170
           LSNS WFS GA +QQG    PRS+SGRI+  VWWFF LIL+SSYTANLAAFLTVERM +P
Sbjct: 40  LSNSLWFSFGALVQQGHRELPRSLSGRILVGVWWFFALILLSSYTANLAAFLTVERMQSP 99

Query: 171 INSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVR 210
           I S+EDLA Q+ + YGT++  ST+ FF+ S       +  
Sbjct: 100 IQSLEDLAKQNKIGYGTLRGGSTFEFFKESKNPTYRRMWE 139

This family includes the four transmembrane regions of the ionotropic glutamate receptors and NMDA receptors. Length = 268
>gnl|CDD|215950 pfam00497, SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 Back     alignment and domain information
>gnl|CDD|238078 cd00134, PBPb, Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of substrates, such as, amino acids, peptides, sugars, vitamins and inorganic ions Back     alignment and domain information
>gnl|CDD|214497 smart00062, PBPb, Bacterial periplasmic substrate-binding proteins Back     alignment and domain information
>gnl|CDD|197504 smart00079, PBPe, Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>gnl|CDD|223904 COG0834, HisJ, ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 225
KOG1054|consensus 897 100.0
KOG1053|consensus 1258 99.97
KOG1052|consensus 656 99.96
KOG4440|consensus 993 99.95
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 99.8
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 97.05
KOG1419|consensus 654 96.1
smart00079134 PBPe Eukaryotic homologues of bacterial periplasmi 94.66
KOG3713|consensus477 94.54
PRK11917259 bifunctional adhesin/ABC transporter aspartate/glu 93.94
PRK10797302 glutamate and aspartate transporter subunit; Provi 93.27
PLN03192 823 Voltage-dependent potassium channel; Provisional 92.72
PRK09495247 glnH glutamine ABC transporter periplasmic protein 89.63
PRK15010260 ABC transporter lysine/arginine/ornithine binding 89.46
PF00497225 SBP_bac_3: Bacterial extracellular solute-binding 88.76
PRK10537 393 voltage-gated potassium channel; Provisional 88.61
PRK15437259 histidine ABC transporter substrate-binding protei 88.59
COG0834275 HisJ ABC-type amino acid transport/signal transduc 87.7
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 86.56
TIGR02995275 ectoine_ehuB ectoine/hydroxyectoine ABC transporte 85.25
TIGR02285268 conserved hypothetical protein. Members of this fa 85.06
PRK10859 482 membrane-bound lytic transglycosylase F; Provision 84.08
KOG0498|consensus 727 81.25
KOG1418|consensus 433 80.2
>KOG1054|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.1e-43  Score=305.23  Aligned_cols=201  Identities=64%  Similarity=1.043  Sum_probs=188.3

Q ss_pred             CeecCCCCChhhhhcccccccccccCeeEEEEcCCCCCCCccccccccchhHHHHHHHHHHHHHHHHHHHhhcCchhhhh
Q psy2797           1 MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRL   80 (225)
Q Consensus         1 ~ai~~~~it~~R~~~~dft~p~~~~~~~~lv~~~~~~~~~~~~~~~PF~~~vWl~i~~~~~~~~~~l~~~~~~~~~~~~~   80 (225)
                      +|++++|||.+|++++|||.|++..|+.+|+++|.++.+..++|+.|....+|+|++++.+.+++++++++|++|+||+.
T Consensus       498 iavApLTIt~~REeviDFSKPfMslGISIMIKKPqKsk~gVFSFldPLa~eIWm~ivfaYiGVSvvlFLVSrFSPYEwh~  577 (897)
T KOG1054|consen  498 IAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHT  577 (897)
T ss_pred             eEEeeeeeehhhhhhhccccchhhcCeEEEEeCcccCCCCeeeecchhHHHHHHHHHHHHhcceEEEEEEeccCchheec
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             ccC-CCCCCCCCCCCCCCCCCCCCccCCcccccchhhhhhhhhhccCCCcccCCchhhHHHHHHHHHHHHHHhhhcccce
Q psy2797          81 LNY-SDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLA  159 (225)
Q Consensus        81 ~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~qg~~~~p~s~~~Ril~~~w~l~~lvl~~~Yta~L~  159 (225)
                      +.. +++-.|             ......+++.+++|+.+++++|||.++.|++.+|||+.++||||.++++++|||||+
T Consensus       578 Ee~~rg~~t~-------------~~~~NeFgifNsLWFsLgAFMQQG~DI~PRslSGRIvggvWWFFTlIIiSSYTANLA  644 (897)
T KOG1054|consen  578 EEFERGRFTP-------------SDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLA  644 (897)
T ss_pred             cccccCCCCC-------------CCCCccchhhHHHHHHHHHHHhcCCCCCccccccceeccchhhhhhhhhhhhhhHHH
Confidence            744 222111             123466899999999999999999999999999999999999999999999999999


Q ss_pred             eeeeeccccCCCCChHHhhcCCCeEEEEEcCChHHHHHHhcChHHHHHHHHHhhc
Q psy2797         160 AFLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGE  214 (225)
Q Consensus       160 s~Lt~~~~~~~I~sl~dL~~~~~~~~~~~~~s~~~~~l~~~~~~~~~~~~~~~~~  214 (225)
                      ++||+++..+||.|.+||+++.++.+|+.+++++.+||+.+..+.|+++|..|+.
T Consensus       645 AFLTvErMvsPIESaEDLAkQteIaYGt~~~GSTkeFFr~Skiavy~kMW~yM~S  699 (897)
T KOG1054|consen  645 AFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMKS  699 (897)
T ss_pred             HHHhHHhhcCcchhHHHHhhcceeeeeecCCCchHHHHhhhhHHHHHHHHHHHhc
Confidence            9999999999999999999999999999999999999999999999999999987

>KOG1053|consensus Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>smart00079 PBPe Eukaryotic homologues of bacterial periplasmic substrate binding proteins Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>PRK11917 bifunctional adhesin/ABC transporter aspartate/glutamate-binding protein; Reviewed Back     alignment and domain information
>PRK10797 glutamate and aspartate transporter subunit; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK09495 glnH glutamine ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK15010 ABC transporter lysine/arginine/ornithine binding periplasmic protein; Provisional Back     alignment and domain information
>PF00497 SBP_bac_3: Bacterial extracellular solute-binding proteins, family 3; InterPro: IPR001638 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PRK15437 histidine ABC transporter substrate-binding protein HisJ; Provisional Back     alignment and domain information
>COG0834 HisJ ABC-type amino acid transport/signal transduction systems, periplasmic component/domain [Amino acid transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>TIGR02995 ectoine_ehuB ectoine/hydroxyectoine ABC transporter solute-binding protein Back     alignment and domain information
>TIGR02285 conserved hypothetical protein Back     alignment and domain information
>PRK10859 membrane-bound lytic transglycosylase F; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3kg2_A 823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 9e-63
1yae_A312 Structure Of The Kainate Receptor Subunit Glur6 Ago 3e-11
1yae_A 312 Structure Of The Kainate Receptor Subunit Glur6 Ago 9e-05
1gr2_A279 Structure Of A Glutamate Receptor Ligand Binding Co 1e-09
3tdj_A263 Crystal Structure Of The Glua2 Ligand-Binding Domai 1e-08
1lb8_A263 Crystal Structure Of The Non-Desensitizing Glur2 Li 1e-08
1p1w_A263 Crystal Structure Of The Glur2 Ligand-Binding Core 1e-08
3t9x_B258 Glutamate Bound To A Double Cysteine Mutant (V484cE 2e-08
3rnn_A292 Crystal Structure Of Iglur2 Ligand Binding Domain W 2e-08
3rn8_A280 Crystal Structure Of Iglur2 Ligand Binding Domain A 2e-08
3b6t_A263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-08
1fw0_A263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-08
1mqh_A263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-08
1p1n_A263 Glur2 Ligand Binding Core (S1s2j) Mutant L650t In C 2e-08
1lbb_A263 Crystal Structure Of The Glur2 Ligand Binding Domai 2e-08
1lbc_A263 Crystal Structure Of Glur2 Ligand Binding Core (S1s 2e-08
3b6w_C263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-08
2gfe_A262 Crystal Structure Of The Glur2 A476e S673d Ligand B 2e-08
1mqd_A261 X-Ray Structure Of The Glur2 Ligand-Binding Core (S 2e-08
1m5d_A263 X-ray Structure Of The Glur2 Ligand Binding Core (s 2e-08
3t93_B258 Glutamate Bound To A Double Cysteine Mutant (A452cS 2e-08
3pd8_A261 X-Ray Structure Of The Ligand-Binding Core Of Glua2 2e-08
2i3w_A259 Measurement Of Conformational Changes Accompanying 2e-08
3pd9_A260 X-Ray Structure Of The Ligand-Binding Core Of Glua2 2e-08
2i3v_A259 Measurement Of Conformational Changes Accompanying 2e-08
3h03_A258 Crystal Structure Of The Binding Domain Of The Ampa 2e-08
3dp6_A279 Crystal Structure Of The Binding Domain Of The Ampa 2e-08
2xx7_A291 Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)p 2e-08
3ijo_B258 Crystal Structure Of The Ampa Subunit Glur2 Bound T 2e-08
2anj_A263 Crystal Structure Of The Glur2 Ligand Binding Core 2e-08
3o29_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 2e-08
3r7x_A263 Crystal Structure Analysis Of A Quinazolinedione Su 2e-08
3o28_A263 Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Gl 2e-08
2xhd_A263 Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridiny 2e-08
2uxa_A261 Crystal Structure Of The Glur2-Flip Ligand Binding 2e-08
3en3_A257 Crystal Structure Of The Glur4 Ligand-Binding Domai 3e-08
3kei_A257 Crystal Structure Of The Glua4 Ligand-Binding Domai 3e-08
3fat_A260 X-Ray Structure Of Iglur4 Flip Ligand-Binding Core 3e-08
3m3f_A258 Pepa Bound To The Ligand Binding Domain Of Glua3 (F 3e-08
4f2o_A258 Quisqualate Bound To The D655a Mutant Of The Ligand 3e-08
4f22_A258 Kainate Bound To The K660a Mutant Of The Ligand Bin 4e-08
3lsw_A258 Aniracetam Bound To The Ligand Binding Domain Of Gl 4e-08
3dp4_A278 Crystal Structure Of The Binding Domain Of The Ampa 4e-08
2i0c_A259 Crystal Structure Of The Glur6 Ligand Binding Core 5e-08
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 9e-08
2f34_A258 Crystal Structure Of The Glur5 Ligand Binding Core 8e-04
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 9e-08
1ycj_A257 Crystal Structure Of The Kainate Receptor Glur5 Lig 8e-04
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 9e-08
2wky_A258 Crystal Structure Of The Ligand-Binding Core Of Glu 8e-04
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 9e-08
2zns_A256 Crystal Structure Of The Ligand-Binding Core Of The 8e-04
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 9e-08
1txf_A258 Crystal Structure Of The Glur5 Ligand Binding Core 8e-04
1s50_A259 X-Ray Structure Of The Glur6 Ligand Binding Core (S 1e-07
3g3g_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-07
3g3h_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 1e-07
3qxm_A258 Crystal Structure Of Human Gluk2 Ligand-Binding Cor 1e-07
2xxu_A261 Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Di 1e-07
2xxr_A261 Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lb 1e-07
2xxw_A261 Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Di 1e-07
3g3k_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-07
3g3j_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-07
3g3i_A259 Crystal Structure Of The Glur6 Ligand Binding Domai 2e-07
2i0b_A259 Crystal Structure Of The Glur6 Ligand Binding Core 2e-07
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 3e-07
3u92_A257 Crystal Structure Of The Gluk3 Ligand Binding Domai 7e-04
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 3e-07
3s9e_A258 Crystal Structure Of The Kainate Receptor Gluk3 Lig 7e-04
1pb8_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 1e-04
1pb7_A292 Crystal Structure Of The Nr1 Ligand Binding Core In 1e-04
2a5s_A284 Crystal Structure Of The Nr2a Ligand Binding Core I 4e-04
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure 
Iteration: 1

 Score =  236 bits (601), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 138/202 (68%), Gaps = 11/202 (5%)
Query: 1   MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSY 60
           +AIAPL+IT  RE V+DFSKPFM+LGISIMIKKP K KP V SFLDPL+ EIW+ I+F+Y
Sbjct: 465 IAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAY 524
Query: 61  IMXXXXXXXXXXXXPHEWRLLNYSDXXXXXXXXXXXXXXXXXXVIANDFSLSNSFWFSLG 120
           I             P+EW    + D                     N+F + NS WFSLG
Sbjct: 525 IGVSVVLFLVSRFSPYEWHTEEFEDGRETQSSES-----------TNEFGIFNSLWFSLG 573
Query: 121 AFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQ 180
           AFMQQG+DISPRS+SGRIVG VWWFFTLI+ISSYTANLAAFLTVERMV+PI S EDL+ Q
Sbjct: 574 AFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQ 633
Query: 181 SDVLYGTVKDASTYHFFEVSAV 202
           +++ YGT+   ST  FF  S +
Sbjct: 634 TEIAYGTLDSGSTKEFFRRSKI 655
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|1YAE|A Chain A, Structure Of The Kainate Receptor Subunit Glur6 Agonist Binding Domain Complexed With Domoic Acid Length = 312 Back     alignment and structure
>pdb|1GR2|A Chain A, Structure Of A Glutamate Receptor Ligand Binding Core (Glur2) Complexed With Kainate Length = 279 Back     alignment and structure
>pdb|3TDJ|A Chain A, Crystal Structure Of The Glua2 Ligand-Binding Domain (S1s2j-L483y- N754s) In Complex With Glutamate And Bpam-97 At 1.95 A Resolution Length = 263 Back     alignment and structure
>pdb|1LB8|A Chain A, Crystal Structure Of The Non-Desensitizing Glur2 Ligand Binding Core Mutant (S1s2j-L483y) In Complex With Ampa At 2.3 Resolution Length = 263 Back     alignment and structure
>pdb|1P1W|A Chain A, Crystal Structure Of The Glur2 Ligand-Binding Core (S1s2j) With The L483y And L650t Mutations And In Complex With Ampa Length = 263 Back     alignment and structure
>pdb|3T9X|B Chain B, Glutamate Bound To A Double Cysteine Mutant (V484cE657C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3RNN|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain With Symmetric Sulfonamide Containing Potentiator Length = 292 Back     alignment and structure
>pdb|3RN8|A Chain A, Crystal Structure Of Iglur2 Ligand Binding Domain And Symmetrical Carboxyl Containing Potentiator Length = 280 Back     alignment and structure
>pdb|3B6T|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686a Mutant In Complex With Quisqualate At 2.1 Resolution Length = 263 Back     alignment and structure
>pdb|1FW0|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Kainate At 2.0 A Resolution Length = 263 Back     alignment and structure
>pdb|1MQH|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) In Complex With Bromo-Willardiine At 1.8 Angstroms Resolution Length = 263 Back     alignment and structure
>pdb|1P1N|A Chain A, Glur2 Ligand Binding Core (S1s2j) Mutant L650t In Complex With Kainate Length = 263 Back     alignment and structure
>pdb|1LBB|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Domain Mutant (s1s2j-n754d) In Complex With Kainate At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|1LBC|A Chain A, Crystal Structure Of Glur2 Ligand Binding Core (S1s2j- N775s) In Complex With Cyclothiazide (Ctz) As Well As Glutamate At 1.8 A Resolution Length = 263 Back     alignment and structure
>pdb|3B6W|C Chain C, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j) T686s Mutant In Complex With Glutamate At 1.7 Resolution Length = 263 Back     alignment and structure
>pdb|2GFE|A Chain A, Crystal Structure Of The Glur2 A476e S673d Ligand Binding Core Mutant At 1.54 Angstroms Resolution Length = 262 Back     alignment and structure
>pdb|1MQD|A Chain A, X-Ray Structure Of The Glur2 Ligand-Binding Core (S1s2j) In Complex With (S)-Des-Me-Ampa At 1.46 A Resolution. Crystallization In The Presence Of Lithium Sulfate. Length = 261 Back     alignment and structure
>pdb|1M5D|A Chain A, X-ray Structure Of The Glur2 Ligand Binding Core (s1s2j- Y702f) In Complex With Br-hibo At 1.73 A Resolution Length = 263 Back     alignment and structure
>pdb|3T93|B Chain B, Glutamate Bound To A Double Cysteine Mutant (A452cS652C) OF THE Ligand Binding Domain Of Glua2 Length = 258 Back     alignment and structure
>pdb|3PD8|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (S)-7-Hpca At 2.5 A Resolution Length = 261 Back     alignment and structure
>pdb|2I3W|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of S729c Mutant Length = 259 Back     alignment and structure
>pdb|3PD9|A Chain A, X-Ray Structure Of The Ligand-Binding Core Of Glua2 In Complex With (R)-5-Hpca At 2.1 A Resolution Length = 260 Back     alignment and structure
>pdb|2I3V|A Chain A, Measurement Of Conformational Changes Accompanying Desensitization In An Ionotropic Glutamate Receptor: Structure Of G725c Mutant Length = 259 Back     alignment and structure
>pdb|3H03|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Ubp277 Length = 258 Back     alignment and structure
>pdb|3DP6|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur2 Bound To Glutamate Length = 279 Back     alignment and structure
>pdb|2XX7|A Chain A, Crystal Structure Of 1-(4-(1-Pyrrolidinylcarbonyl)phenyl)-3- (Trifluoromethyl)-4,5,6,7-Tetrahydro-1h-Indazole In Complex With The Ligand Binding Domain Of The Rat Glua2 Receptor And Glutamate At 2.2a Resolution. Length = 291 Back     alignment and structure
>pdb|3IJO|B Chain B, Crystal Structure Of The Ampa Subunit Glur2 Bound To The Allosteric Modulator, Althiazide Length = 258 Back     alignment and structure
>pdb|2ANJ|A Chain A, Crystal Structure Of The Glur2 Ligand Binding Core (S1s2j- Y450w) Mutant In Complex With The Partial Agonist Kainic Acid At 2.1 A Resolution Length = 263 Back     alignment and structure
>pdb|3O29|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|3R7X|A Chain A, Crystal Structure Analysis Of A Quinazolinedione Sulfonamide Bound To Human Glur2: A Novel Class Of Competitive Ampa Receptor Antagonists With Oral Activity Length = 263 Back     alignment and structure
>pdb|3O28|A Chain A, Ligand-Binding Domain Of Glua2 (Flip) Ionotropic Glutamate Receptor In Complex With An Allosteric Modulator Length = 263 Back     alignment and structure
>pdb|2XHD|A Chain A, Crystal Structure Of N-((2s)-5-(6-Fluoro-3-Pyridinyl)-2,3- Dihydro-1h-Inden-2-Yl)-2-Propanesulfonamide In Complex With The Ligand Binding Domain Of The Human Glua2 Receptor Length = 263 Back     alignment and structure
>pdb|2UXA|A Chain A, Crystal Structure Of The Glur2-Flip Ligand Binding Domain, RG UNEDITED. Length = 261 Back     alignment and structure
>pdb|3EN3|A Chain A, Crystal Structure Of The Glur4 Ligand-Binding Domain In Complex With Kainate Length = 257 Back     alignment and structure
>pdb|3KEI|A Chain A, Crystal Structure Of The Glua4 Ligand-Binding Domain L651v Mutant In Complex With Glutamate Length = 257 Back     alignment and structure
>pdb|3FAT|A Chain A, X-Ray Structure Of Iglur4 Flip Ligand-Binding Core (S1s2) In Complex With (S)-Ampa At 1.90a Resolution Length = 260 Back     alignment and structure
>pdb|3M3F|A Chain A, Pepa Bound To The Ligand Binding Domain Of Glua3 (Flop Form) Length = 258 Back     alignment and structure
>pdb|4F2O|A Chain A, Quisqualate Bound To The D655a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|4F22|A Chain A, Kainate Bound To The K660a Mutant Of The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3LSW|A Chain A, Aniracetam Bound To The Ligand Binding Domain Of Glua3 Length = 258 Back     alignment and structure
>pdb|3DP4|A Chain A, Crystal Structure Of The Binding Domain Of The Ampa Subunit Glur3 Bound To Ampa Length = 278 Back     alignment and structure
>pdb|2I0C|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Dimer Crosslinked By Disulfide Bonds Between Y490c And L752c At 2.25 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|2F34|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core Dimer With Ubp310 At 1.74 Angstroms Resolution Length = 258 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|1YCJ|A Chain A, Crystal Structure Of The Kainate Receptor Glur5 Ligand- Binding Core In Complex With (S)-Glutamate Length = 257 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2WKY|A Chain A, Crystal Structure Of The Ligand-Binding Core Of Glur5 In Complex With The Agonist 4-Ahcp Length = 258 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|2ZNS|A Chain A, Crystal Structure Of The Ligand-Binding Core Of The Human Ionotropic Glutamate Receptor, Glur5, In Complex With Glutamate Length = 256 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|1TXF|A Chain A, Crystal Structure Of The Glur5 Ligand Binding Core In Complex With Glutamate At 2.1 Angstrom Resolution Length = 258 Back     alignment and structure
>pdb|1S50|A Chain A, X-Ray Structure Of The Glur6 Ligand Binding Core (S1s2a) In Complex With Glutamate At 1.65 A Resolution Length = 259 Back     alignment and structure
>pdb|3G3G|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r Mutant With Glutamate And Nacl At 1.3 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3H|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer K665r I749l Q753k Mutant With Glutamate And Nacl At 1.5 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3QXM|A Chain A, Crystal Structure Of Human Gluk2 Ligand-Binding Core In Complex With Novel Marine-Derived Toxins, Neodysiherbaine A Length = 258 Back     alignment and structure
>pdb|2XXU|A Chain A, Crystal Structure Of The Gluk2 (Glur6) M770k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXR|A Chain A, Crystal Structure Of The Gluk2 (Glur6) Wild-Type Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|2XXW|A Chain A, Crystal Structure Of The Gluk2 (Glur6) D776k Lbd Dimer In Complex With Glutamate Length = 261 Back     alignment and structure
>pdb|3G3K|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k E757q Mutant With Glutamate And Nacl At 1.24 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3J|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e K665r I749l Q753k Mutant With Glutamate And Nacl At 1.32 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|3G3I|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Domain Dimer I442h K494e I749l Q753k Mutant With Glutamate And Nacl At 1.37 Angstrom Resolution Length = 259 Back     alignment and structure
>pdb|2I0B|A Chain A, Crystal Structure Of The Glur6 Ligand Binding Core Elkq Mutant Dimer At 1.96 Angstroms Resolution Length = 259 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3U92|A Chain A, Crystal Structure Of The Gluk3 Ligand Binding Domain Complex With Kainate And Zinc: P2221 Form Length = 257 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|3S9E|A Chain A, Crystal Structure Of The Kainate Receptor Gluk3 Ligand Binding Domain In Complex With (S)-Glutamate Length = 258 Back     alignment and structure
>pdb|1PB8|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With D-Serine At 1.45 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|1PB7|A Chain A, Crystal Structure Of The Nr1 Ligand Binding Core In Complex With Glycine At 1.35 Angstroms Resolution Length = 292 Back     alignment and structure
>pdb|2A5S|A Chain A, Crystal Structure Of The Nr2a Ligand Binding Core In Complex With Glutamate Length = 284 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query225
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 2e-65
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 1e-16
1yae_A312 Glutamate receptor, ionotropic kainate 2; kainate 2e-13
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 2e-07
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 2e-13
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 3e-13
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 6e-10
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 2e-07
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 4e-09
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 2e-08
2pyy_A228 Ionotropic glutamate receptor bacterial homologue; 2e-06
2pvu_A272 ARTJ; basic amino acid binding protein, ABC transp 2e-06
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 3e-06
1wdn_A226 GLNBP, glutamine binding protein; closed form, com 3e-06
2yjp_A291 Putative ABC transporter, periplasmic binding Pro 3e-06
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 4e-06
1xt8_A292 Putative amino-acid transporter periplasmic solut 5e-06
2y7i_A229 STM4351; arginine-binding protein; HET: ARG; 1.90A 5e-06
3k4u_A245 Binding component of ABC transporter; structural g 6e-06
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 6e-06
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 7e-06
3tql_A227 Arginine-binding protein; transport and binding pr 8e-06
3qax_A268 Probable ABC transporter arginine-binding protein; 8e-06
2q88_A257 EHUB, putative ABC transporter amino acid-binding 9e-06
3kzg_A237 Arginine 3RD transport system periplasmic binding 1e-05
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 2e-05
3del_B242 Arginine binding protein; alpha and beta protein ( 3e-05
3hv1_A268 Polar amino acid ABC uptake transporter substrate 3e-05
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 3e-05
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 3e-05
2v25_A259 Major cell-binding factor; antigen, adhesin, aspar 5e-05
2vha_A287 Periplasmic binding transport protein; periplasmic 6e-05
4eq9_A246 ABC transporter substrate-binding protein-amino A 1e-04
1ii5_A233 SLR1257 protein; membrane protein; HET: GLU; 1.60A 2e-04
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 3e-04
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  215 bits (548), Expect = 2e-65
 Identities = 129/204 (63%), Positives = 152/204 (74%), Gaps = 11/204 (5%)

Query: 1   MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSY 60
           +AIAPL+IT  RE V+DFSKPFM+LGISIMIKKP K KP V SFLDPL+ EIW+ I+F+Y
Sbjct: 465 IAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAY 524

Query: 61  IMVSVVLFLVSRFSPHEWRLLNYSDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLG 120
           I VSVVLFLVSRFSP+EW    + D                 S   N+F + NS WFSLG
Sbjct: 525 IGVSVVLFLVSRFSPYEWHTEEFEDGRETQ-----------SSESTNEFGIFNSLWFSLG 573

Query: 121 AFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVERMVNPINSVEDLADQ 180
           AFMQQG+DISPRS+SGRIVG VWWFFTLI+ISSYTANLAAFLTVERMV+PI S EDL+ Q
Sbjct: 574 AFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLSKQ 633

Query: 181 SDVLYGTVKDASTYHFFEVSAVNL 204
           +++ YGT+   ST  FF  S + +
Sbjct: 634 TEIAYGTLDSGSTKEFFRRSKIAV 657
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Length = 259 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Length = 312 Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Length = 265 Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Length = 292 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Length = 263 Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Length = 294 Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Length = 284 Back     alignment and structure
>2pyy_A Ionotropic glutamate receptor bacterial homologue; GLUR0 ligand binding domain, transport protein; HET: GLU; 2.10A {Nostoc punctiforme} Length = 228 Back     alignment and structure
>2pvu_A ARTJ; basic amino acid binding protein, ABC transport system, THER bacterium, transport protein; HET: LYS; 1.79A {Geobacillus stearothermophilus} PDB: 2q2a_A* 2q2c_A* Length = 272 Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Length = 239 Back     alignment and structure
>1wdn_A GLNBP, glutamine binding protein; closed form, complex, peptide, complex (binding protein/peptide); 1.94A {Escherichia coli} SCOP: c.94.1.1 PDB: 1ggg_A Length = 226 Back     alignment and structure
>2yjp_A Putative ABC transporter, periplasmic binding Pro amino acid; transport protein, solute-binding protein; 2.26A {Neisseria gonorrhoeae} Length = 291 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Length = 259 Back     alignment and structure
>1xt8_A Putative amino-acid transporter periplasmic solut protein; ABC transport, cysteine uptake; 2.00A {Campylobacter jejuni} SCOP: c.94.1.1 Length = 292 Back     alignment and structure
>2y7i_A STM4351; arginine-binding protein; HET: ARG; 1.90A {Salmonella enterica subsp} Length = 229 Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} Length = 245 Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Length = 249 Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Length = 239 Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} Length = 227 Back     alignment and structure
>3qax_A Probable ABC transporter arginine-binding protein; periplasmic, transport PR; HET: ARG; 2.00A {Chlamydophila pneumoniae} PDB: 3g41_A* 3n26_A* Length = 268 Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Length = 257 Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} Length = 237 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} Length = 234 Back     alignment and structure
>3del_B Arginine binding protein; alpha and beta protein (A/B), periplasmic protein, arginine protein binding, transport protein; 1.92A {Chlamydia trachomatis} Length = 242 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Length = 268 Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} Length = 232 Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Length = 271 Back     alignment and structure
>2v25_A Major cell-binding factor; antigen, adhesin, aspartate, glutamate, transport, ABC transport, virulence factor, receptor; 1.49A {Campylobacter jejuni} Length = 259 Back     alignment and structure
>2vha_A Periplasmic binding transport protein; periplasmic binding protein, ligand binding, ultrahigh resolution; HET: GLU; 1.00A {Shigella flexneri} PDB: 2ia4_A* Length = 287 Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Length = 246 Back     alignment and structure
>1ii5_A SLR1257 protein; membrane protein; HET: GLU; 1.60A {Synechocystis SP} SCOP: c.94.1.1 PDB: 1iit_A 1iiw_A Length = 233 Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 100.0
1yae_A 312 Glutamate receptor, ionotropic kainate 2; kainate 98.69
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 98.05
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 97.85
2a9h_A155 Voltage-gated potassium channel; potassium channel 97.78
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 97.63
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 97.58
3g3k_A259 Glutamate receptor, ionotropic kainate 2; membrane 97.5
3ouf_A97 Potassium channel protein; ION channel, membrane, 97.37
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 97.26
2q67_A114 Potassium channel protein; inverted teepee, helix 97.21
2rc8_A294 Glutamate [NMDA] receptor subunit 3A; membrane pro 97.14
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 97.09
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 96.87
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 96.79
1p7b_A 333 Integral membrane channel and cytosolic domains; t 96.7
1mqi_A263 Glutamate receptor 2; GLUR2, ligand binding core, 96.38
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 96.22
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 95.91
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 95.87
1xl4_A 301 Inward rectifier potassium channel; integral membr 95.72
1pb7_A292 N-methyl-D-aspartate receptor subunit 1; ligand bi 95.23
2a5s_A284 N-methyl-D-aspartate receptor nmdar2A subunit, NMD 95.11
3ukm_A280 Potassium channel subfamily K member 1; membrane p 95.02
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 94.95
4h5g_A243 Amino acid ABC superfamily ATP binding cassette tr 94.48
3um7_A309 Potassium channel subfamily K member 4; potassium 94.38
1lnq_A 336 MTHK channels, potassium channel related protein; 93.31
2v3u_A265 Glutamate receptor delta-2 subunit; postsynaptic m 93.31
3um7_A309 Potassium channel subfamily K member 4; potassium 92.9
3ukm_A280 Potassium channel subfamily K member 1; membrane p 92.59
3sya_A 340 G protein-activated inward rectifier potassium CH; 92.16
3i6v_A232 Periplasmic His/Glu/Gln/Arg/opine family-binding; 90.53
4gvo_A243 LMO2349 protein; structural genomics, IDP05245, L- 90.37
3kzg_A237 Arginine 3RD transport system periplasmic binding 88.61
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 87.98
3kbr_A239 Cyclohexadienyl dehydratase; pseudomonas aeruginos 86.15
1lst_A239 Lysine, arginine, ornithine-binding protein; amino 86.12
3rvy_A285 ION transport protein; tetrameric ION channel, vol 85.33
4eq9_A246 ABC transporter substrate-binding protein-amino A 84.78
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 84.12
3k4u_A245 Binding component of ABC transporter; structural g 83.76
4dz1_A259 DALS D-alanine transporter; D-alanine binding, per 83.65
3tql_A227 Arginine-binding protein; transport and binding pr 83.55
3h7m_A234 Sensor protein; histidine kinase sensor domain, ki 83.24
3hv1_A268 Polar amino acid ABC uptake transporter substrate 83.17
2iee_A271 ORF2, probable ABC transporter extracellular-bindi 82.45
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 82.04
2q88_A257 EHUB, putative ABC transporter amino acid-binding 81.97
2q88_A257 EHUB, putative ABC transporter amino acid-binding 81.4
3mpk_A267 Virulence sensor protein BVGS; venus flytrap, sens 81.01
4f3p_A249 Glutamine-binding periplasmic protein; ssgcid, str 80.38
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=6.1e-34  Score=267.50  Aligned_cols=205  Identities=63%  Similarity=1.036  Sum_probs=165.0

Q ss_pred             CeecCCCCChhhhhcccccccccccCeeEEEEcCCCCCCCccccccccchhHHHHHHHHHHHHHHHHHHHhhcCchhhhh
Q psy2797           1 MAIAPLSITSERERVVDFSKPFMTLGISIMIKKPSKQKPRVLSFLDPLSEEIWVAIIFSYIMVSVVLFLVSRFSPHEWRL   80 (225)
Q Consensus         1 ~ai~~~~it~~R~~~~dft~p~~~~~~~~lv~~~~~~~~~~~~~~~PF~~~vWl~i~~~~~~~~~~l~~~~~~~~~~~~~   80 (225)
                      ++++++++|.+|.+.+|||.||+.++.++++|+|....++++.|++||++.+|++++++++++++++|+++++.|.+|+.
T Consensus       465 ~~~~~~~~t~~R~~~~dfs~py~~~~~~~~v~~~~~~~~~~~~fl~Pf~~~vW~~i~~~~~~~~~~l~~~~~~~p~~w~~  544 (823)
T 3kg2_A          465 IAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHT  544 (823)
T ss_dssp             EECSCCBCCHHHHTTEEECSCSEEECEEEEEECCCCCCCCGGGTTTTSCHHHHHHHHHHHHHHHTTGGGTC---------
T ss_pred             EEecceecchhheeeEEeccchhhCCEEEEEECCCcccccchHhhcCCchhHHHHHHHHHHHHHHHHHHHHhcChhhccC
Confidence            47899999999999999999999999999999987666788899999999999999999999999999999999999985


Q ss_pred             ccCCCCCCCCCCCCCCCCCCCCCccCCcccccchhhhhhhhhhccCCCcccCCchhhHHHHHHHHHHHHHHhhhccccee
Q psy2797          81 LNYSDPGHPHHSPSPHHGPSPPSVIANDFSLSNSFWFSLGAFMQQGSDISPRSISGRIVGAVWWFFTLILISSYTANLAA  160 (225)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~qg~~~~p~s~~~Ril~~~w~l~~lvl~~~Yta~L~s  160 (225)
                      +...++..+.           .......+++.+++|++++++++||.+..|++.++|++.++|++++++++++|||+|+|
T Consensus       545 ~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~l~~~g~~~~p~~~~~R~~~~~w~~~~lil~~~Yta~L~s  613 (823)
T 3kg2_A          545 EEFEDGRETQ-----------SSESTNEFGIFNSLWFSLGAFMQQGADISPRSLSGRIVGGVWWFFTLIIISSYTANLAA  613 (823)
T ss_dssp             -------------------------CHHHHHHHHHHHTTTTSCC------CCCHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccccccccc-----------cccccccccHHHHHHHHHHHHHhcCCCcCCcchhhhhHHHHHHHHHHHHHHHHHHHHHH
Confidence            4211110000           00122345788999999999999999999999999999999999999999999999999


Q ss_pred             eeeeccccCCCCChHHhhcCCCeEEEEEcCChHHHHHHhcChHHHHHHHHHhhccC
Q psy2797         161 FLTVERMVNPINSVEDLADQSDVLYGTVKDASTYHFFEVSAVNLVADVVRALGEQK  216 (225)
Q Consensus       161 ~Lt~~~~~~~I~sl~dL~~~~~~~~~~~~~s~~~~~l~~~~~~~~~~~~~~~~~~~  216 (225)
                      +||.|+++++|+|++||++++++++++.++++..++|++++.+.|+++++.++..+
T Consensus       614 ~Lt~~~~~~~I~s~~dL~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  669 (823)
T 3kg2_A          614 FLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAE  669 (823)
T ss_dssp             HHHHHHHCCCCCSSHHHHHCCSSEEECBSSSHHHHHHHHCCCHHHHHHHHHHHHCS
T ss_pred             HhcccccCCCCCCHHHHhhCCCeeEEEEeCCcHHHHHHhccchHHHHHHHHHHhcC
Confidence            99999999999999999998889999999999999999999999999998887543
>1yae_A Glutamate receptor, ionotropic kainate 2; kainate receptor, membrane protein; HET: NAG FUC DOQ; 3.11A {Rattus norvegicus} SCOP: c.94.1.1 Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3g3k_A Glutamate receptor, ionotropic kainate 2; membrane protein, cell junction, cell membrane, glycoprotein, ION transport, ionic channel, membrane; HET: GLU IPA; 1.24A {Rattus norvegicus} PDB: 3g3j_A* 3g3i_A* 2i0b_A* 3g3h_A* 3g3g_A* 3g3f_A* 1s7y_A* 1s9t_A* 1sd3_A* 1tt1_A* 1s50_A* 2xxr_A* 2xxt_A* 2xxx_A* 2xxw_A* 2xxy_A* 2xxu_A* 2xxv_A* 3qxm_A* 2i0c_A* ... Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>2rc8_A Glutamate [NMDA] receptor subunit 3A; membrane protein, cell junction, glycoprotein, ION transport channel, magnesium; 1.45A {Rattus norvegicus} PDB: 2rc7_A 2rc9_A 2rca_A 2rcb_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>1mqi_A Glutamate receptor 2; GLUR2, ligand binding core, S1S2, partial agonist, WILLARDIINES, fluoro-WILLARDIINE, membrane protein; HET: FWD; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1ftj_A* 1ftl_A* 1fto_A 1fw0_A* 1m5b_A* 1ftm_A* 1m5c_A* 1mm6_A* 1mm7_A* 1mqg_A* 1m5e_A* 1mqj_A* 1ms7_A* 1mxu_A* 1mxv_A 1mxw_A 1mxx_A 1mxy_A 1mxz_A 1my0_A ... Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>1pb7_A N-methyl-D-aspartate receptor subunit 1; ligand binding receptor, NR1, ligand binding protein; 1.35A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 1pbq_A* 1y1m_A 1y1z_A 1y20_A 2a5t_A* 1pb8_A 1pb9_A Back     alignment and structure
>2a5s_A N-methyl-D-aspartate receptor nmdar2A subunit, NMDA receptor nmdar2A; protein-ligand complex, metal transport,membrane protein; HET: GLU; 1.70A {Rattus norvegicus} SCOP: c.94.1.1 PDB: 2a5t_B* 3oen_A* 3oel_A* 3oem_A* 3oek_A* Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>4h5g_A Amino acid ABC superfamily ATP binding cassette transporter, binding protein; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: ARG; 1.78A {Streptococcus pneumoniae} PDB: 4h5f_A* Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>2v3u_A Glutamate receptor delta-2 subunit; postsynaptic membrane, ionotropic glutamate receptors, transmembrane, membrane protein; 1.74A {Rattus norvegicus} PDB: 2v3t_A Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>3i6v_A Periplasmic His/Glu/Gln/Arg/opine family-binding; structural genomics, transporter, PSI-2, protein structure initiative; HET: LYS; 2.00A {Silicibacter pomeroyi} SCOP: c.94.1.0 Back     alignment and structure
>4gvo_A LMO2349 protein; structural genomics, IDP05245, L-cystine, ABC transporter, periplasmic binding protein, niaid; HET: HIS; 1.45A {Listeria monocytogenes} PDB: 2o1m_A Back     alignment and structure
>3kzg_A Arginine 3RD transport system periplasmic binding protein; arginine transport system, protein structure initiative II(PSI II); 2.06A {Legionella pneumophila subsp} SCOP: c.94.1.0 Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3kbr_A Cyclohexadienyl dehydratase; pseudomonas aeruginos structural genomics, PSI-2, protein structure initiative; HET: EPE; 1.66A {Pseudomonas aeruginosa} Back     alignment and structure
>1lst_A Lysine, arginine, ornithine-binding protein; amino-acid binding protein; HET: LYS; 1.80A {Salmonella typhimurium} SCOP: c.94.1.1 PDB: 2lao_A 1lag_E* 1lah_E 1laf_E 1hsl_A* 1hpb_P* Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4eq9_A ABC transporter substrate-binding protein-amino A transport; structural genomics, niaid; HET: GSH; 1.40A {Streptococcus pneumoniae} Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>3k4u_A Binding component of ABC transporter; structural genomics, protein structure INI NEW YORK structural genomix research consortium, nysgxrc; HET: LYS; 2.62A {Wolinella succinogenes} SCOP: c.94.1.0 Back     alignment and structure
>4dz1_A DALS D-alanine transporter; D-alanine binding, periplasmic, transport protein; 1.90A {Salmonella enterica} PDB: 3r39_A 4f3s_A Back     alignment and structure
>3tql_A Arginine-binding protein; transport and binding proteins, transport protein; HET: MSE ARG; 1.59A {Coxiella burnetii} SCOP: c.94.1.0 Back     alignment and structure
>3h7m_A Sensor protein; histidine kinase sensor domain, kinase, phosphoprotein, transferase; 2.40A {Geobacter sulfurreducens} SCOP: c.94.1.0 Back     alignment and structure
>3hv1_A Polar amino acid ABC uptake transporter substrate binding protein; protein structure initiative II(PSI II), nysgxrc; 1.90A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2iee_A ORF2, probable ABC transporter extracellular-binding protein YCKB; SR574, NESG, X-RAY, structural genomics, PSI-2; 2.20A {Bacillus subtilis} Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>2q88_A EHUB, putative ABC transporter amino acid-binding prote; substrate-binding protein, compatible solues, ABC-transporte osmoprotection; HET: 4CS; 1.90A {Sinorhizobium meliloti} PDB: 2q89_A* Back     alignment and structure
>3mpk_A Virulence sensor protein BVGS; venus flytrap, sensor domain, signaling protein; 2.04A {Bordetella pertussis} PDB: 3mpl_A Back     alignment and structure
>4f3p_A Glutamine-binding periplasmic protein; ssgcid, structural genomics, GLUT seattle structural genomics center for infectious disease; 2.40A {Burkholderia pseudomallei} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 225
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 6e-04
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel-related protein MthK
species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]

 Score = 35.5 bits (82), Expect = 6e-04
 Identities = 10/56 (17%), Positives = 17/56 (30%), Gaps = 1/56 (1%)

Query: 108 DFSLSNSFWFSLGAFMQQG-SDISPRSISGRIVGAVWWFFTLILISSYTANLAAFL 162
             S + S +++       G  D SP +  G           +   +     L  FL
Sbjct: 25  GESWTVSLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGIGTFAVAVERLLEFL 80

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query225
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 98.08
d2a5sa1277 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 97.44
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 97.04
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 96.68
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 96.06
d1mqia_260 Glutamate receptor ligand binding core {Rat (Rattu 96.04
d1pb7a_289 N-methyl-D-aspartate receptor subunit 1 {Rat (Ratt 95.6
d2f34a1246 Glutamate receptor ligand binding core {Rat (Rattu 93.32
d1wdna_223 Glutamine-binding protein {Escherichia coli [TaxId 89.89
d1xt8a1248 Putative amino-acid transporter CjaA {Campylobacte 87.99
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 85.91
d1lsta_238 Lysine-,arginine-,ornithine-binding (LAO) protein 81.53
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]

Probab=98.08  E-value=2.1e-06  Score=58.52  Aligned_cols=57  Identities=23%  Similarity=0.374  Sum_probs=52.2

Q ss_pred             ccccchhhhhhhhhhccCC-CcccCCchhhHHHHHHHHHHHHHHhhhcccceeeeeec
Q psy2797         109 FSLSNSFWFSLGAFMQQGS-DISPRSISGRIVGAVWWFFTLILISSYTANLAAFLTVE  165 (225)
Q Consensus       109 ~~~~~~~~~~~~~~~~qg~-~~~p~s~~~Ril~~~w~l~~lvl~~~Yta~L~s~Lt~~  165 (225)
                      .++.+++|+.+.++...|. +..|.+..+|++..++++.++.+.+..++.+++.+...
T Consensus        39 ~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~~~~~~i~~~~~~~   96 (103)
T d1r3jc_          39 ITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGR   96 (103)
T ss_dssp             CSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4678999999999999997 89999999999999999999999999999999887654
>d2a5sa1 c.94.1.1 (A:7-142,A:145-285) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus), subtype 2A [TaxId: 10116]} Back     information, alignment and structure
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1mqia_ c.94.1.1 (A:) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR2 [TaxId: 10116]} Back     information, alignment and structure
>d1pb7a_ c.94.1.1 (A:) N-methyl-D-aspartate receptor subunit 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f34a1 c.94.1.1 (A:5-116,A:119-252) Glutamate receptor ligand binding core {Rat (Rattus norvegicus), GluR5 [TaxId: 10116]} Back     information, alignment and structure
>d1wdna_ c.94.1.1 (A:) Glutamine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xt8a1 c.94.1.1 (A:10-257) Putative amino-acid transporter CjaA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1lsta_ c.94.1.1 (A:) Lysine-,arginine-,ornithine-binding (LAO) protein {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure