Psyllid ID: psy2875


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MSYARRQVEYEQEQQIPAQGKSIQERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEEHVKSHQNRRFKCPCCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHAKFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYHHSQNNIESESNQSSGFMYNDETSSYSHIKQEDDSCDTYMDDTTENSNTYLKQETPDNEDIDTTPVPESSDILAINYEDKVKDEP
cccccccccccccccccHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccHHHHcccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccHHHHHHccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHHccccccccccccccccccccHHHHHHHccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccHHcccccccccccccccccccHHcccccHHccccc
cccHccccEcccccHHEHEHccccccccccccccccEccccHHHHHHHHHcccccccccccccccEccccHHHHHEHHcccccccEcccccccEcccccHHHHHHcccccccccccccccEcccccHHHHEHEccccccEccccccEEcccccHHEEEEEEcccccccEcccccccEccccHHHHHHHHcccccccccccccEccccHHHHHHHHHcccccccccccccccEccccHHHEHEEcccccccccccccEEEcccccEEcccccccccccccccEccccHHHHHHHHcccccccccccccccEcccccccEcccccHHHHEHHccccccccccccccccEcccccHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccccccccEEcccccHHEHEEEccccccccccccccccEcccccHHEHEcccccccccccccccEcccccHHHHHEEEccccccccccHccHHHHHHHHHHHHHcccccccccccccccEccccHHHHHHHHcccccccccHHcHHHHHcHcccHEcccccccEccccccccccccHHHHEcHcccccc
MSYARRQVEyeqeqqipaqgksIQERkfkcemcpksfdhksnIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLkmhkgpkiftcaqcdkafslksnLSKHVRHHMENVKQCKICLEIFEDDEVLEEHVKShqnrrfkcpcceriftsetrmrnhidmkhadenLFKCKKCLKVFSDEIKFhlhgrahakfyrcsecekrFATEDIMRQHFRnyhnkedayVCNYCYDSFETKSTLVDHffhhgnpymcnhcflmfpdeknlrnhectscftcpfcqrkYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLychkvfkkstsfdkhmehhnrnvlhkchlctkaypseknldrhllthnvrrsfrckscgrrfeseELLIVHQVIherkfhkctqceesfkNKKHLKQHLLAHEKvkvfhcpkcpklfrheshlqnhvivhdesevhkCLYCFKVFVHkahldkhlilhetsemhncdfchltfttdndlirhmrsheeyhtkhtcdicgekFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYhhsqnniesesnqssgfmyndetssyshikqeddscdtymddttensntylkqetpdnedidttpvpessdilainyedkvkdep
msyarrqveyeqeqqipaqgksiqerKFKCEMCPKSFDHKSNIRRHMaathdlqkkyKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEEHvkshqnrrfkcpcceRIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLhgrahakfyrcSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIEsciqlnptttvLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYHHSQNNIESESNQSSGFMYNDETSSYSHIKQEDDSCDTYMDDTTENSNtylkqetpdnedidttpvpessdilainyedkvkdep
MSYARRQVEYEQEQQIPAQGKSIQERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEEHVKSHQNRRFKCPCCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHAKFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYHHsqnniesesnqssGFMYNDETSSYSHIKQEDDSCDTYMDDTTENSNTYLKQETPDNEDIDTTPVPESSDILAINYEDKVKDEP
******************************************IRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEEHVKSHQNRRFKCPCCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHAKFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYH************************************************************************************
MSYARRQVEYEQEQQIPAQGKSIQERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEEHVKSHQNRRFKCPCCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHAKFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYHHSQNNIESESNQSSGFMYNDETSSYSHIKQEDDSCDTYMDDTTENSNTYLKQETPDNEDIDTTPVPES****************
**********************IQERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEE*********FKCPCCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHAKFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYHHSQNNIESESNQSSGFMYNDETSSYSHIKQEDDSCDTYMDDTTENSNTYLKQETPDNEDIDTTPVPESSDILAINYEDKVKDEP
MSYARRQVEYEQEQQIPAQGKSIQERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEEHVKSHQNRRFKCPCCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHAKFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYHHSQNNIESESNQSSGFMYNDETSSYSHIKQEDDSCDTYMDDTTENSNTYLKQETPDNEDIDTTPVPESSDI*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYARRQVEYEQEQQIPAQGKSIQERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRHHMENVKQCKICLEIFEDDEVLEEHVKSHQNRRFKCPCCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHAKFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGNPYMCNHCFLMFPDEKNLRNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHIKIIHNLFTCIHCGDTLNNAKDYASHLLIIHNIESSQQVEKNLNNMYNLLTTHIEYHHSQNNIESESNQSSGFMYNDETSSYSHIKQEDDSCDTYMDDTTENSNTYLKQETPDNEDIDTTPVPESSDILAINYEDKVKDEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
P10076861 Zinc finger protein 26 OS no N/A 0.782 0.629 0.292 3e-62
A6NN141173 Zinc finger protein 729 O yes N/A 0.845 0.499 0.305 2e-61
Q054811191 Zinc finger protein 91 OS yes N/A 0.783 0.455 0.309 2e-59
Q96IR2970 Zinc finger protein 845 O no N/A 0.780 0.557 0.302 2e-59
Q5R8X1613 Zinc finger protein 665 O no N/A 0.714 0.807 0.303 2e-58
Q9H7R5613 Zinc finger protein 665 O no N/A 0.725 0.820 0.298 6e-58
A6QLU5752 Zinc finger protein 184 O no N/A 0.712 0.656 0.314 7e-58
O433451167 Zinc finger protein 208 O no N/A 0.784 0.466 0.305 2e-57
Q8IYB9648 Zinc finger protein 595 O no N/A 0.711 0.760 0.311 2e-57
Q6ZNA1936 Zinc finger protein 836 O no N/A 0.784 0.581 0.292 2e-57
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function desciption
 Score =  240 bits (612), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 166/568 (29%), Positives = 251/568 (44%), Gaps = 26/568 (4%)

Query: 25  ERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKI 84
           E+ + C+ C K+F  +S++  H+   H  +K Y+CK C + +     L  H++ H G K 
Sbjct: 271 EKPYDCKECGKAFTERSSLIVHLRQ-HTREKSYECKECGKTFIQPSRLTEHMRSHTGEKP 329

Query: 85  FTCAQCDKAFSLKSNLSKHVRHHM-ENVKQCKICLEIFEDDEVLEEHVKSHQNRR-FKCP 142
           + C QC  AF+  S L+ H+R H  E   +C IC + F     L  H+++H   + ++C 
Sbjct: 330 YQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGEKPYECK 389

Query: 143 CCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHA--KFYRCSECE 200
            C + F+  + +  H+  KH  E  + C +C K F+   +   H + H   K +RC  C 
Sbjct: 390 VCGKAFSGRSWLTIHL-RKHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCA 448

Query: 201 KRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHGN--PYMCNHCFLMF 258
           + F     ++ HFR  H     Y CNYC  +F  +S L  H   H    PY C  C   F
Sbjct: 449 RTFRNSSCLKTHFR-IHTGIKPYKCNYCGKAFTARSGLTKHVLIHNGEKPYECKECGKAF 507

Query: 259 PDEKNL----RNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYC 314
                L    R H     F C  C +       L  H+ +     P         +C  C
Sbjct: 508 STSSGLVEHIRIHTGEKPFECYQCGKALAHSSSLVGHLRTHTGEKPF--------ECNQC 559

Query: 315 QRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKA 374
            + F     L  H  +HT EK  Y+C  C K F + +   KH+  H     ++C  C K 
Sbjct: 560 DKTFTRSSYLRIHMRTHTGEKP-YECKECGKTFPERSCLTKHIRTHTGERPYECKECGKG 618

Query: 375 YPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHER-KFHKCTQCEESFKNK 433
           + S   L  H+ TH+  R F+CK C + F +   L  H  IH   K +KC+ C ++F  +
Sbjct: 619 FISFAQLTVHIKTHSSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTAR 678

Query: 434 KHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLD 493
             L  HL  H   K + C +C K F   S L  H+  H   +  +C +C K F   ++L+
Sbjct: 679 SGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLN 738

Query: 494 KHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHI 553
            HL +H   +   C  C  TFT  + L  HMR+H        C ICG+ F+    L+ H+
Sbjct: 739 VHLKIHTGEKPFQCTVCGKTFTCSSYLPVHMRTHTG-EKPFQCIICGKSFLWSSYLRVHM 797

Query: 554 KI--IHNLFTCIHCGDTLNNAKDYASHL 579
           +I      + C +CG           HL
Sbjct: 798 RIHTGEKPYVCQYCGKAFTEHSGLNKHL 825




May be involved in transcriptional regulation.
Mus musculus (taxid: 10090)
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function description
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|Q96IR2|ZN845_HUMAN Zinc finger protein 845 OS=Homo sapiens GN=ZNF845 PE=2 SV=3 Back     alignment and function description
>sp|Q5R8X1|ZN665_PONAB Zinc finger protein 665 OS=Pongo abelii GN=ZNF665 PE=2 SV=1 Back     alignment and function description
>sp|Q9H7R5|ZN665_HUMAN Zinc finger protein 665 OS=Homo sapiens GN=ZNF665 PE=2 SV=2 Back     alignment and function description
>sp|A6QLU5|ZN184_BOVIN Zinc finger protein 184 OS=Bos taurus GN=ZNF184 PE=2 SV=1 Back     alignment and function description
>sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=1 Back     alignment and function description
>sp|Q8IYB9|ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens GN=ZNF595 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
326667289 1202 PREDICTED: zinc finger protein 729-like 0.796 0.459 0.306 8e-69
326665700 1573 PREDICTED: zinc finger protein 91-like [ 0.813 0.358 0.292 5e-66
326667110 1395 PREDICTED: zinc finger protein 729-like, 0.796 0.395 0.3 2e-65
326667255 908 PREDICTED: zinc finger protein 91-like [ 0.858 0.655 0.299 2e-64
326680667 1782 PREDICTED: zinc finger protein 729-like 0.832 0.323 0.289 2e-64
326667299 1069 PREDICTED: zinc finger protein 91-like, 0.808 0.523 0.305 2e-64
390478794 1513 PREDICTED: zinc finger protein 729-like 0.825 0.378 0.304 2e-64
326667106 941 PREDICTED: zinc finger protein 729-like 0.782 0.575 0.303 4e-64
326666983 853 PREDICTED: zinc finger protein 91-like [ 0.776 0.630 0.303 8e-64
326667247 943 PREDICTED: zinc finger protein 850-like 0.783 0.575 0.306 1e-63
>gi|326667289|ref|XP_003198555.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
 Score =  268 bits (685), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 181/590 (30%), Positives = 265/590 (44%), Gaps = 38/590 (6%)

Query: 25  ERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKI 84
           E+ F C  C KSF + +N+ +HM   H  +K + C  C + +    +L  H+++H G K 
Sbjct: 7   EKLFTCTQCGKSFSNSANLNQHMRI-HTGEKPFTCSQCGKSFSQSSSLNLHMRIHTGEKP 65

Query: 85  FTCAQCDKAFSLKSNLSKHVR-HHMENVKQCKICLEIFEDDEVLEEHVKSHQNRR-FKCP 142
           FTC+QC K+FS  S+L+ H+R H  E    C  C + F     L  H+  H   + F C 
Sbjct: 66  FTCSQCGKSFSQSSSLNLHMRIHTGEKPFTCTQCGKSFSQSSNLNLHMMIHTGEKPFTCT 125

Query: 143 CCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHA--KFYRCSECE 200
            C + F+  + +  H+   H  E  F C +C K FS     + H R H   K Y+CS+C 
Sbjct: 126 QCGKSFSQSSNLNIHMR-NHTGEKPFTCLQCGKSFSRSTSLNRHQRVHTGEKPYKCSQCS 184

Query: 201 KRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHF-FHHGN-PYMCNHCFLMF 258
           KRFA    ++ H R  H  E  + C  C  SF   S+L  H   H G  P+ C  C   F
Sbjct: 185 KRFARSGTLKTHER-IHTGEKPFTCTQCGKSFSKSSSLNQHMRIHTGKKPFTCTQCGKSF 243

Query: 259 PDEKNLRNHECTSCF----TCPFCQRKYKIEKHLEKHIE--------SCIQLNPTTTVLK 306
               +L  H           C  C + +    +L KH+         SC Q   + +   
Sbjct: 244 SQSSSLNYHMMIHAGEKPSACSQCGKSFSCSSYLNKHMRIHTGEKPFSCTQCGKSFSQSS 303

Query: 307 TLQ------------KCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFD 354
           +L              C  C + FR    L  H   HT EK  + C  C K F++S+S  
Sbjct: 304 SLNHHIRIHTGEKPFTCTQCGKSFRRSSHLNHHMRIHTEEKP-FSCTQCGKSFRRSSSLR 362

Query: 355 KHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQV 414
           +HM  H       C  C K++     L+RH+  H   + F C  CG+ F       +H  
Sbjct: 363 QHMRIHTGEKPFTCTQCGKSFIQSSQLNRHMRIHTGEKPFTCTQCGKSFSRSSYFNLHMR 422

Query: 415 IH-ERKFHKCTQCEESFKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDE 473
           IH   K   CTQC +SF+    LK+H+  H   K F C +C K F   SHL  H+++H  
Sbjct: 423 IHTGEKLFSCTQCGKSFRCSSSLKEHMRIHSGEKPFTCTQCGKSFSRSSHLNEHMMIHTG 482

Query: 474 SEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTK 533
            +   C  C+K F   +HL++H+++H   +   C  C  +F  + DL  HM  H   +T 
Sbjct: 483 EKPFTCTQCWKSFSRSSHLNQHMMIHTGEKPFTCTLCGKSFGRNFDLKTHMTIHTGENT- 541

Query: 534 HTCDICGEKFINDLKLKAHIKI--IHNLFTCIHCGDTLNNAKDYASHLLI 581
            TC  CG+ F  +  LK H++I      FTC  CG + + +     H+ I
Sbjct: 542 FTCTQCGKSFGRNFDLKIHMRIHTGEKPFTCTLCGKSFSRSSHLNEHMKI 591




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326665700|ref|XP_003198088.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667110|ref|XP_003198489.1| PREDICTED: zinc finger protein 729-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|326667255|ref|XP_003198540.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326680667|ref|XP_003201586.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667299|ref|XP_002661787.2| PREDICTED: zinc finger protein 91-like, partial [Danio rerio] Back     alignment and taxonomy information
>gi|390478794|ref|XP_003735581.1| PREDICTED: zinc finger protein 729-like [Callithrix jacchus] Back     alignment and taxonomy information
>gi|326667106|ref|XP_003198487.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666983|ref|XP_003198441.1| PREDICTED: zinc finger protein 91-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667247|ref|XP_003198537.1| PREDICTED: zinc finger protein 850-like [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
ZFIN|ZDB-GENE-110914-160 1003 si:dkey-240n22.7 "si:dkey-240n 0.822 0.568 0.302 1.1e-80
ZFIN|ZDB-GENE-110913-159733 si:ch211-197f20.2 "si:ch211-19 0.822 0.777 0.304 1.6e-79
ZFIN|ZDB-GENE-110913-148 1029 si:dkey-14o6.6 "si:dkey-14o6.6 0.819 0.551 0.306 5.4e-79
ZFIN|ZDB-GENE-110913-173819 si:dkey-78k22.1 "si:dkey-78k22 0.819 0.693 0.309 8.7e-79
UNIPROTKB|F1RWD7592 LOC100511574 "Uncharacterized 0.818 0.957 0.311 1.4e-78
ZFIN|ZDB-GENE-110913-157981 si:ch211-245n8.1 "si:ch211-245 0.858 0.606 0.297 2.3e-78
ZFIN|ZDB-GENE-110913-38987 si:ch211-208f21.5 "si:ch211-20 0.822 0.577 0.309 3e-78
ZFIN|ZDB-GENE-120214-24704 si:dkey-195o9.2 "si:dkey-195o9 0.821 0.808 0.303 4.8e-78
ZFIN|ZDB-GENE-110913-117898 si:ch211-120c15.2 "si:ch211-12 0.857 0.661 0.295 1.6e-77
UNIPROTKB|Q05481 1191 ZNF91 "Zinc finger protein 91" 0.875 0.509 0.295 2.4e-77
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 810 (290.2 bits), Expect = 1.1e-80, P = 1.1e-80
 Identities = 182/601 (30%), Positives = 288/601 (47%)

Query:    25 ERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKI 84
             E+ F C+ C KSF  K N++ HM   H  +  Y C+ C R +  K NL+ H  +H G K 
Sbjct:     4 EKPFTCQHCGKSFAQKQNLKVHMRV-HTRETPYTCQDCGRSFNQKTNLEIHRIIHTGEKP 62

Query:    85 FTCAQCDKAFSLKSNLSKHVRHHM-ENVKQCKICLEIFEDDEVLEEHVKSHQ-NRRFKCP 142
             FTC QC K+FS K  L  H+R H  E    C  C + F D + L  H++ H  ++ + C 
Sbjct:    63 FTCQQCGKSFSQKQTLKVHMRIHTGEKPFSCHHCGKTFTDKQNLMVHMRIHTGDKPYICT 122

Query:   143 CCERIFTSETRMRNHIDMKHADENLFKCKKCLKVFSDEIKFHLHGRAHA--KFYRCSECE 200
              C + F+ +  +  H+ + H  E  ++C++C K F+ +    +H   H+  K Y+C +C 
Sbjct:   123 VCGKNFSQKPSLDVHVGI-HTGEKPYQCQQCGKSFNRKQNLQVHMSIHSGDKPYQCQQCG 181

Query:   201 KRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHF-FHHGN-PYMCNHCFLMF 258
             K F  +  ++ H R  H  E  + C+ C  SF  K  L  H   H G  PY C  C   F
Sbjct:   182 KSFNRKQNLQVHMR-IHTGEKPFSCHQCGKSFSQKRNLAIHRRIHTGERPYTCQQCGKSF 240

Query:   259 PDEKNL----RNHECTSCFTCPFCQRKYKIEKHLEKHIESCIQLNPTTTVLKTLQKCRYC 314
               ++NL    R H     + C  C + +  ++HL+ H+   I         K  Q C+ C
Sbjct:   241 TQKQNLKVHMRIHTGDKPYQCQECGKSFIDKQHLKVHMR--IHTGD-----KPYQ-CQQC 292

Query:   315 QRMFRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKA 374
              + F  +     H   HT EK  + C  C + F +  +   HM  H  +  ++C  C K+
Sbjct:   293 GKSFNRKQNFQVHMRIHTKEKP-FSCHQCGRSFNRKQNLKVHMRVHTGDKPYQCQQCGKS 351

Query:   375 YPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHER-KFHKCTQCEESFKNK 433
             +  +  LD H+ TH+   +F C+ CG+ F  ++ L +H  IH R K +KC  C ESF  K
Sbjct:   352 FSQKATLDAHMRTHSGLNAFTCQQCGKSFGQKQKLQLHMRIHSREKPYKCQHCGESFSQK 411

Query:   434 KHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLD 493
              HL  H   H K K + C +C K F  + +L+ HV +H   + ++C +C K F  ++HL 
Sbjct:   412 AHLTGHERVHTKEKPYTCLQCGKCFSLKQNLKLHVRIHSGEKPYQCQHCGKSFNQRSHLT 471

Query:   494 KHLILHETSEMHNCDFCHLTFTTDNDLIRHMRSHEEYHTKHTCDICGEKFINDLKLKAHI 553
              H  +H   +  +C  C  +F    +L  HMR H      +TC  CG++F +   LK H+
Sbjct:   472 GHTRIHTGEKPFSCQQCGKSFAQQTNLKVHMRVHTR-ERPYTCQDCGKRFFHKQNLKVHM 530

Query:   554 KII--HNLFTCIHCGDTLNNAKDYASHLLIIHNIESS---QQVEKNLNNMYNLLTTHIEY 608
             ++      + C  CG + +   +  +H+   H++ +    QQ  K+  +  NL   H+  
Sbjct:   531 RVHTGEKPYVCQQCGKSFSQKTNLDAHMGT-HSVVNPFICQQCGKSFGHKQNL-KIHMRV 588

Query:   609 H 609
             H
Sbjct:   589 H 589


GO:0008270 "zinc ion binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
ZFIN|ZDB-GENE-110913-159 si:ch211-197f20.2 "si:ch211-197f20.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-148 si:dkey-14o6.6 "si:dkey-14o6.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-173 si:dkey-78k22.1 "si:dkey-78k22.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWD7 LOC100511574 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-120214-24 si:dkey-195o9.2 "si:dkey-195o9.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-117 si:ch211-120c15.2 "si:ch211-120c15.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q05481 ZNF91 "Zinc finger protein 91" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
KOG1074|consensus958 99.95
KOG1074|consensus958 99.95
KOG2462|consensus279 99.94
KOG2462|consensus279 99.93
KOG3608|consensus467 99.93
KOG3608|consensus467 99.93
KOG3623|consensus1007 99.88
KOG3623|consensus1007 99.87
KOG3576|consensus267 99.7
KOG3576|consensus267 99.65
PLN03086567 PRLI-interacting factor K; Provisional 99.28
PLN03086567 PRLI-interacting factor K; Provisional 99.15
PHA00733128 hypothetical protein 99.01
PHA00733128 hypothetical protein 99.01
PHA0276855 hypothetical protein; Provisional 98.75
PHA0276855 hypothetical protein; Provisional 98.72
KOG3993|consensus500 98.69
KOG3993|consensus500 98.65
KOG1146|consensus 1406 98.58
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.5
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.48
PHA0073279 hypothetical protein 98.33
PHA0061644 hypothetical protein 98.23
PHA0061644 hypothetical protein 98.22
KOG1146|consensus1406 98.19
PHA0073279 hypothetical protein 98.15
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.81
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.72
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.43
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.39
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.33
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.11
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.05
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.01
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.96
COG5189423 SFP1 Putative transcriptional repressor regulating 96.9
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 96.78
COG5189423 SFP1 Putative transcriptional repressor regulating 96.77
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.76
KOG2231|consensus 669 96.34
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.22
KOG2231|consensus669 96.0
smart0035526 ZnF_C2H2 zinc finger. 95.96
smart0035526 ZnF_C2H2 zinc finger. 95.96
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.91
PRK04860160 hypothetical protein; Provisional 95.7
PRK04860160 hypothetical protein; Provisional 95.51
COG5236493 Uncharacterized conserved protein, contains RING Z 95.47
COG5048467 FOG: Zn-finger [General function prediction only] 94.97
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.96
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 94.78
COG5048467 FOG: Zn-finger [General function prediction only] 94.46
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.84
KOG2785|consensus390 93.59
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.55
KOG2482|consensus423 92.7
COG5236493 Uncharacterized conserved protein, contains RING Z 92.58
KOG2785|consensus390 90.59
KOG2893|consensus341 90.08
KOG4173|consensus253 89.85
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 89.78
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 88.94
KOG2482|consensus423 88.68
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 88.51
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 88.38
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 86.13
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 85.51
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 84.04
KOG2893|consensus 341 84.0
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 83.97
>KOG1074|consensus Back     alignment and domain information
Probab=99.95  E-value=5.8e-29  Score=262.76  Aligned_cols=160  Identities=19%  Similarity=0.397  Sum_probs=99.4

Q ss_pred             CccccccccccCCChHHHHHHHhhhcCCCCCccccccCccccccccccccccccC-CcccCCccCCcCCChhhhhccccc
Q psy2875         192 KFYRCSECEKRFATEDIMRQHFRNYHNKEDAYVCNYCYDSFETKSTLVDHFFHHG-NPYMCNHCFLMFPDEKNLRNHECT  270 (693)
Q Consensus       192 ~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~-~~~~C~~C~~~f~~~~~l~~H~~~  270 (693)
                      .|-+|-+|-+...-+++|+.|++ .|+||+||+|.+||+.|.++.+|+.|+-+|. +|-.                   .
T Consensus       604 dPNqCiiC~rVlSC~saLqmHyr-tHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~-------------------R  663 (958)
T KOG1074|consen  604 DPNQCIICLRVLSCPSALQMHYR-THTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPA-------------------R  663 (958)
T ss_pred             Cccceeeeeecccchhhhhhhhh-cccCcCccccccccchhccccchhhcccccccCccc-------------------c
Confidence            46789999999999999999999 8999999999999999999999999998885 2210                   0


Q ss_pred             CcccCC---cccccccchHHHHHHHHHhhccC-CCc----ccccccccccccCcccCCchhhhhhhhcccccCceeeeee
Q psy2875         271 SCFTCP---FCQRKYKIEKHLEKHIESCIQLN-PTT----TVLKTLQKCRYCQRMFRNEDKLTAHELSHTMEKTLYKCLY  342 (693)
Q Consensus       271 ~~~~C~---~C~k~f~~~~~l~~H~~~~~~~~-~~~----~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~C~~  342 (693)
                      ..+.|+   +|.+.|.....|..|++++.... +..    ...-...+|..|.+.|.....+..++..+.+..       
T Consensus       664 ~q~ScP~~~ic~~kftn~V~lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~-------  736 (958)
T KOG1074|consen  664 VQFSCPSTFICQKKFTNAVTLPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPE-------  736 (958)
T ss_pred             ccccCCchhhhcccccccccccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcc-------
Confidence            234555   66666666666666666644211 111    000112345555555555555555554443331       


Q ss_pred             cCeeecCCccccccccccCCCc----ccccCCCCccCCCchhhhhh
Q psy2875         343 CHKVFKKSTSFDKHMEHHNRNV----LHKCHLCTKAYPSEKNLDRH  384 (693)
Q Consensus       343 C~k~f~~~~~L~~H~~~h~~~~----~~~C~~C~k~f~~~~~L~~H  384 (693)
                            +......+.+.+.++.    +..+..|+..+.....+..+
T Consensus       737 ------s~~~~~~~~~t~t~~~~~tp~~~e~~~~~~~~~e~~i~~~  776 (958)
T KOG1074|consen  737 ------SEPDEQMDERTETEELDVTPPPPENSCGRELEGEMAISVR  776 (958)
T ss_pred             ------cCCcccccccccccccccCCCccccccccccCcccccccc
Confidence                  1223333334444433    55666666666655554443



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 4e-20
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-19
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-17
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-08
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-08
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-07
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-06
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-07
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-05
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-06
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-04
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 8e-04
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 2e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-06
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-04
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-04
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-05
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-06
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-04
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-04
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 4e-04
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 1e-05
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 3e-04
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 8e-04
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-05
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 1e-04
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-05
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 8e-05
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 3e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 4e-04
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 96.7 bits (239), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 58/180 (32%), Positives = 86/180 (47%), Gaps = 5/180 (2%) Query: 47 MAATHDLQKKYKCKLCARMYRYKWNLKAHLKMHKGPKIFTCAQCDKAFSLKSNLSKHVRH 106 AA +K Y C C + + +L H + H G K + C +C K+FS K +L++H R Sbjct: 12 QAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRT 71 Query: 107 HM-ENVKQCKICLEIFEDDEVLEEHVKSHQNRR-FKCPCCERIFTSETRMRNHIDMKHAD 164 H E +C C + F L H ++H + + CP C + F+ +R H H Sbjct: 72 HTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAH-QRTHTG 130 Query: 165 ENLFKCKKCLKVFSDEIKFHLHGRAHA--KFYRCSECEKRFATEDIMRQHFRNYHNKEDA 222 E +KC +C K FS E H H R H K Y+C EC K F+ D + H R + K+ + Sbjct: 131 EKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS 190
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-21
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-19
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-19
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-16
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 9e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-10
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-08
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 7e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-13
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-12
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-12
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-09
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-12
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-11
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-09
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-08
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-11
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-09
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-05
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-09
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-07
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-11
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-08
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-07
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 9e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-10
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 7e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 8e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-08
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 5e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 4e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 6e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 4e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 89.4 bits (223), Expect = 9e-21
 Identities = 57/184 (30%), Positives = 79/184 (42%), Gaps = 4/184 (2%)

Query: 318 FRNEDKLTAHELSHTMEKTLYKCLYCHKVFKKSTSFDKHMEHHNRNVLHKCHLCTKAYPS 377
                   A       EK  Y C  C K F +S    +H   H     +KC  C K++  
Sbjct: 3   EFGSSSSVAQAALEPGEKP-YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSD 61

Query: 378 EKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIH--ERKFHKCTQCEESFKNKKH 435
           +K+L RH  TH   + ++C  CG+ F     L  HQ  H  E K + C +C +SF    H
Sbjct: 62  KKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGE-KPYACPECGKSFSQLAH 120

Query: 436 LKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKH 495
           L+ H   H   K + CP+C K F  E +L  H   H   + +KC  C K F  +  L+ H
Sbjct: 121 LRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVH 180

Query: 496 LILH 499
              H
Sbjct: 181 QRTH 184


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.98
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.95
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.9
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.76
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.75
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.68
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.67
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.66
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.65
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.64
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.61
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.6
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.57
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.56
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.56
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.54
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.53
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.53
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.52
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.51
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.51
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.5
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.49
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.49
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.48
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.46
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.46
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.46
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.45
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.45
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.43
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.42
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.42
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.4
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.4
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.4
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.4
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.37
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.35
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.34
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.32
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.32
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.3
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.26
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.22
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.21
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.18
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.13
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.12
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.12
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.12
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.11
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.11
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.11
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.1
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.09
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.07
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.02
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.02
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.02
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.02
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.02
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.0
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.99
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.99
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.99
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.98
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.98
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.98
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.98
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.98
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.98
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.98
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.97
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.97
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.97
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.97
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.97
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.97
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.96
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.96
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.96
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.96
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.96
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.95
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.95
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.95
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.95
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.95
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.94
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.94
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.94
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.93
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.92
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.91
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.9
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.9
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.89
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.88
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.87
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.85
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.85
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.85
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.84
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.83
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.82
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.81
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.76
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.74
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.68
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.61
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.59
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.57
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.54
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.54
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.49
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.49
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.47
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.42
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.39
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.38
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.33
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.31
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.29
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.26
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.23
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.21
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.2
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.2
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.19
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.18
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.15
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.11
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.1
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.09
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.09
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.0
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.98
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.98
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.97
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.97
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.95
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.95
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.93
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.93
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.92
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.91
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.9
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.9
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.9
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.9
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.89
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.89
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.89
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.89
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.88
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.87
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.87
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.86
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.86
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.85
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.05
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.05
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.02
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.78
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.77
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.75
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.87
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.83
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.47
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.46
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.09
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.75
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.35
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.02
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.57
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.53
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 94.88
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.57
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.41
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 86.77
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 85.84
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 80.69
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=1.1e-37  Score=298.78  Aligned_cols=183  Identities=27%  Similarity=0.507  Sum_probs=93.0

Q ss_pred             ccccccccccCCCcccccCCCCccCCCchhhhhhhhhccCCcccccCccccccCChhHhhhcccccc-cccccCCCCccc
Q psy2875         351 TSFDKHMEHHNRNVLHKCHLCTKAYPSEKNLDRHLLTHNVRRSFRCKSCGRRFESEELLIVHQVIHE-RKFHKCTQCEES  429 (693)
Q Consensus       351 ~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~H~~~h~-~k~~~C~~C~k~  429 (693)
                      ..|..|+..+.++++|.|++|++.|.+...|..|+++|.++++|.|++|++.|.+...|..|+++|. +++|.|++|++.
T Consensus         7 ~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~   86 (190)
T 2i13_A            7 SSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKS   86 (190)
T ss_dssp             ------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCE
T ss_pred             ccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCc
Confidence            3455566666666666666666666666666666666666666666666666666666666655553 455666666666


Q ss_pred             cCChHHHHHHHHhccCCCccccCcCcccccchhHHHHHHHhcCCCCceeccccCccccchhhHHHHHHhhCCCCcccCCc
Q psy2875         430 FKNKKHLKQHLLAHEKVKVFHCPKCPKLFRHESHLQNHVIVHDESEVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDF  509 (693)
Q Consensus       430 f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~  509 (693)
                      |.+...|..|+++|.++++|.|++|++.|.+...|..|+++|++++||.|++|++.|.+.+.|..|+++|++++||.|++
T Consensus        87 f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~  166 (190)
T 2i13_A           87 FSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPE  166 (190)
T ss_dssp             ESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTT
T ss_pred             cCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCC
Confidence            66666666666666666666666666666666666666666666666666666666666666666666666666666666


Q ss_pred             CcccCCChhHHHHHHhhhcCCCCcc
Q psy2875         510 CHLTFTTDNDLIRHMRSHEEYHTKH  534 (693)
Q Consensus       510 C~~~f~~~~~L~~H~~~H~~~~~~~  534 (693)
                      ||+.|.+...|..|+++|+|+ +||
T Consensus       167 C~~~f~~~~~L~~H~~~H~~~-k~~  190 (190)
T 2i13_A          167 CGKSFSRRDALNVHQRTHTGK-KTS  190 (190)
T ss_dssp             TCCEESSHHHHHHHHTTC-------
T ss_pred             CCCccCCHHHHHHHHHhcCCC-CCC
Confidence            666666666666666666655 554



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 693
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: PATZ1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 40.4 bits (95), Expect = 1e-05
 Identities = 8/37 (21%), Positives = 19/37 (51%)

Query: 25 ERKFKCEMCPKSFDHKSNIRRHMAATHDLQKKYKCKL 61
           + + C+ C K F    ++  H+   H  ++ +KC++
Sbjct: 3  GKPYICQSCGKGFSRPDHLNGHIKQVHTSERPHKCQV 39


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.58
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.58
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.21
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.15
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.12
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.12
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.05
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.04
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.03
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.01
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.96
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.94
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.9
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.88
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.85
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.85
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.84
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.84
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.83
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.81
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.77
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.76
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.74
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.66
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.64
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.58
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.56
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.53
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.52
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.47
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.4
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.28
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.27
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.27
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.26
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.19
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.18
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.14
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.05
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.01
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.93
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.78
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.68
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.6
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.43
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.37
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.35
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.33
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.22
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.21
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.17
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.14
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.04
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.04
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.78
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.74
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.73
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.73
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.72
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.71
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.65
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.6
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.59
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.55
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.51
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.45
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.45
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.38
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.34
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.31
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.3
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.22
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.11
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.04
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.01
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.58
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.45
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.39
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.7
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.54
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.42
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.26
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 93.86
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.82
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.39
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 92.87
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 92.64
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.28
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 91.32
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.98
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.85
d1y0jb136 U-shaped transcription factor, different fingers { 90.17
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 89.13
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.0
d1y0jb136 U-shaped transcription factor, different fingers { 88.72
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.21
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 86.84
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 83.41
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 83.37
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 82.32
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 81.15
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 80.3
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 80.17
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.58  E-value=4.3e-16  Score=111.33  Aligned_cols=51  Identities=29%  Similarity=0.615  Sum_probs=22.0

Q ss_pred             CceeccccCccccchhhHHHHHHhhCCCCcccCCcCcccCCChhHHHHHHhh
Q psy2875         475 EVHKCLYCFKVFVHKAHLDKHLILHETSEMHNCDFCHLTFTTDNDLIRHMRS  526 (693)
Q Consensus       475 ~~~~C~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~  526 (693)
                      +||+|. ||++|..++.|..|+++|+|++||.|++||++|.+.+.|..||++
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            344442 444444444444444444444444444444444444444444443



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure