Psyllid ID: psy3262


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP
cHHHHHHHHHHHHcccccccHHHHHHHHcHHHHHHHHHHHHHHcHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHccc
cHHHHHHHHHHHHHHcHHHHcHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHEcccccEccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccc
MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSsagkycvgddisvadcclipqvfnarrfhvdlrpfpiVLRIDRELENHP
MIGKVREICEViasgiqplqnlTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNarrfhvdlrpfpivlridrelenhp
MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP
****VREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRID*******
MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP
MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP
MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
Q9VHD2227 Probable maleylacetoaceta yes N/A 0.980 0.444 0.821 2e-45
Q9VHD3246 Probable maleylacetoaceta no N/A 0.951 0.398 0.571 2e-31
Q9WVL0216 Maleylacetoacetate isomer no N/A 0.922 0.439 0.6 4e-29
P57113216 Maleylacetoacetate isomer yes N/A 0.922 0.439 0.589 9e-28
O43708216 Maleylacetoacetate isomer no N/A 0.941 0.449 0.546 7e-26
Q54YN2219 Maleylacetoacetate isomer yes N/A 0.922 0.433 0.48 2e-21
Q9KSB2215 Probable maleylacetoaceta yes N/A 0.970 0.465 0.386 6e-18
Q18938214 Probable maleylacetoaceta no N/A 0.951 0.457 0.415 1e-17
P57108225 Glutathione S-transferase N/A N/A 0.941 0.431 0.401 3e-16
D2YW48231 Probable glutathione S-tr N/A N/A 0.922 0.411 0.432 8e-16
>sp|Q9VHD2|MAAI2_DROME Probable maleylacetoacetate isomerase 2 OS=Drosophila melanogaster GN=CG9363 PE=2 SV=1 Back     alignment and function desciption
 Score =  180 bits (456), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 83/101 (82%), Positives = 94/101 (93%)

Query: 3   GKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVG 62
            KVREI E+I SGIQPLQNL VLI+VGEEKK+EWAQHWI RG RAVEK LS+SAGKYCVG
Sbjct: 107 AKVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVG 166

Query: 63  DDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
           D+IS+ADCCL+PQVFNARRFHVDLRP+PI+LRIDRELE++P
Sbjct: 167 DEISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNP 207





Drosophila melanogaster (taxid: 7227)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 2
>sp|Q9VHD3|MAAI1_DROME Probable maleylacetoacetate isomerase 1 OS=Drosophila melanogaster GN=CG9362 PE=2 SV=1 Back     alignment and function description
>sp|Q9WVL0|MAAI_MOUSE Maleylacetoacetate isomerase OS=Mus musculus GN=Gstz1 PE=1 SV=1 Back     alignment and function description
>sp|P57113|MAAI_RAT Maleylacetoacetate isomerase OS=Rattus norvegicus GN=Gstz1 PE=1 SV=2 Back     alignment and function description
>sp|O43708|MAAI_HUMAN Maleylacetoacetate isomerase OS=Homo sapiens GN=GSTZ1 PE=1 SV=3 Back     alignment and function description
>sp|Q54YN2|MAAI_DICDI Maleylacetoacetate isomerase OS=Dictyostelium discoideum GN=mai PE=3 SV=1 Back     alignment and function description
>sp|Q9KSB2|MAAI_VIBCH Probable maleylacetoacetate isomerase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=maiA PE=3 SV=1 Back     alignment and function description
>sp|Q18938|MAAI_CAEEL Probable maleylacetoacetate isomerase OS=Caenorhabditis elegans GN=gst-42 PE=1 SV=1 Back     alignment and function description
>sp|P57108|GSTZ_EUPES Glutathione S-transferase zeta class OS=Euphorbia esula PE=2 SV=1 Back     alignment and function description
>sp|D2YW48|GST_COCIM Probable glutathione S-transferase OS=Coccidioides immitis (strain RS) GN=CIMG_01314 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
242010719 217 glutathione-S-transferase theta, GST, pu 0.980 0.465 0.881 3e-48
387413743 217 glutathione s-transferase Z1 [Sogatella 0.980 0.465 0.881 6e-48
373940155 217 glutathione S-transferase Z1 [Laodelphax 0.980 0.465 0.881 7e-48
189239333 215 PREDICTED: similar to glutathione S-tran 0.980 0.469 0.891 1e-47
387413769 217 glutathione s transferase zeta 1 [Nilapa 0.980 0.465 0.871 3e-47
112984030 215 glutathione S-transferase zeta 1 [Bombyx 0.980 0.469 0.851 7e-47
301312606 215 glutathione s-transferase [Chironomus ri 0.980 0.469 0.851 2e-46
347968784 263 AGAP002898-PB [Anopheles gambiae str. PE 0.980 0.384 0.831 3e-46
289177028 217 glutathione S-transferase Z1 [Nasonia vi 0.980 0.465 0.831 4e-46
312380295182 hypothetical protein AND_07698 [Anophele 0.980 0.554 0.851 4e-46
>gi|242010719|ref|XP_002426106.1| glutathione-S-transferase theta, GST, putative [Pediculus humanus corporis] gi|212510153|gb|EEB13368.1| glutathione-S-transferase theta, GST, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  195 bits (496), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 89/101 (88%), Positives = 98/101 (97%)

Query: 3   GKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVG 62
            KVREICEVIASGIQPLQNL VLIYVGEEKK+EWAQHWI+RG RAVEKLLS+SAGKYCVG
Sbjct: 98  AKVREICEVIASGIQPLQNLIVLIYVGEEKKKEWAQHWINRGFRAVEKLLSASAGKYCVG 157

Query: 63  DDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
           D++++ADCCL+PQVFNARRFHVDLRPFPI+LRIDRELENHP
Sbjct: 158 DEVTLADCCLVPQVFNARRFHVDLRPFPIILRIDRELENHP 198




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|387413743|gb|AFJ75819.1| glutathione s-transferase Z1 [Sogatella furcifera] Back     alignment and taxonomy information
>gi|373940155|gb|AEY80030.1| glutathione S-transferase Z1 [Laodelphax striatella] Back     alignment and taxonomy information
>gi|189239333|ref|XP_973541.2| PREDICTED: similar to glutathione S-transferase [Tribolium castaneum] gi|270010448|gb|EFA06896.1| hypothetical protein TcasGA2_TC009842 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|387413769|gb|AFJ75820.1| glutathione s transferase zeta 1 [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|112984030|ref|NP_001037418.1| glutathione S-transferase zeta 1 [Bombyx mori] gi|85740627|gb|ABC79691.1| glutathione S-transferase 4 [Bombyx mori] gi|95102880|gb|ABF51381.1| glutathione-S-transferase [Bombyx mori] Back     alignment and taxonomy information
>gi|301312606|gb|ADK66969.1| glutathione s-transferase [Chironomus riparius] Back     alignment and taxonomy information
>gi|347968784|ref|XP_003436289.1| AGAP002898-PB [Anopheles gambiae str. PEST] gi|333467832|gb|EGK96713.1| AGAP002898-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|289177028|ref|NP_001165931.1| glutathione S-transferase Z1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|312380295|gb|EFR26331.1| hypothetical protein AND_07698 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
FB|FBgn0037697227 GstZ2 "Glutathione S transfera 0.970 0.440 0.83 4.5e-43
FB|FBgn0037696246 GstZ1 "Glutathione S transfera 0.941 0.394 0.577 4.9e-30
ZFIN|ZDB-GENE-040718-184220 gstz1 "glutathione S-transfera 0.912 0.427 0.589 5.7e-27
MGI|MGI:1341859216 Gstz1 "glutathione transferase 0.922 0.439 0.6 9.4e-27
RGD|1589363216 Gstz1 "glutathione S-transfera 0.922 0.439 0.589 2.2e-25
UNIPROTKB|F1S2N0216 GSTZ1 "Uncharacterized protein 0.932 0.444 0.552 4.6e-25
UNIPROTKB|K7GQV5217 GSTZ1 "Uncharacterized protein 0.932 0.442 0.552 4.6e-25
UNIPROTKB|K7GR50184 GSTZ1 "Uncharacterized protein 0.932 0.521 0.552 4.6e-25
UNIPROTKB|G3V267189 GSTZ1 "Maleylacetoacetate isom 0.922 0.502 0.557 6.8e-24
UNIPROTKB|G3V4T6217 GSTZ1 "Maleylacetoacetate isom 0.922 0.437 0.557 6.8e-24
FB|FBgn0037697 GstZ2 "Glutathione S transferase Z2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 455 (165.2 bits), Expect = 4.5e-43, P = 4.5e-43
 Identities = 83/100 (83%), Positives = 94/100 (94%)

Query:     4 KVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGD 63
             KVREI E+I SGIQPLQNL VLI+VGEEKK+EWAQHWI RG RAVEK LS+SAGKYCVGD
Sbjct:   108 KVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGD 167

Query:    64 DISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
             +IS+ADCCL+PQVFNARRFHVDLRP+PI+LRIDRELE++P
Sbjct:   168 EISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNP 207




GO:0004364 "glutathione transferase activity" evidence=ISS;IDA
GO:0016034 "maleylacetoacetate isomerase activity" evidence=ISS
GO:0006559 "L-phenylalanine catabolic process" evidence=ISS
GO:0006572 "tyrosine catabolic process" evidence=ISS
GO:0005737 "cytoplasm" evidence=IEA;ISS
GO:0009072 "aromatic amino acid family metabolic process" evidence=IEA
GO:0006749 "glutathione metabolic process" evidence=IDA
FB|FBgn0037696 GstZ1 "Glutathione S transferase Z1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-184 gstz1 "glutathione S-transferase zeta 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1341859 Gstz1 "glutathione transferase zeta 1 (maleylacetoacetate isomerase)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1589363 Gstz1 "glutathione S-transferase zeta 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2N0 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GQV5 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GR50 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3V267 GSTZ1 "Maleylacetoacetate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V4T6 GSTZ1 "Maleylacetoacetate isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9VHD2MAAI2_DROME5, ., 2, ., 1, ., 20.82170.98050.4449yesN/A
P57113MAAI_RAT2, ., 5, ., 1, ., 1, 80.58940.92230.4398yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
cd03191121 cd03191, GST_C_Zeta, C-terminal, alpha helical dom 7e-54
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 3e-43
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 9e-12
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 6e-06
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 3e-04
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 6e-04
cd03192104 cd03192, GST_C_Sigma_like, C-terminal, alpha helic 0.002
cd03177117 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he 0.003
>gnl|CDD|198300 cd03191, GST_C_Zeta, C-terminal, alpha helical domain of Class Zeta Glutathione S-transferases Back     alignment and domain information
 Score =  163 bits (415), Expect = 7e-54
 Identities = 59/106 (55%), Positives = 76/106 (71%), Gaps = 6/106 (5%)

Query: 4   KVREICEVIASGIQPLQNLTVLIYVG------EEKKREWAQHWIHRGLRAVEKLLSSSAG 57
           +VR I  +IA  I PLQNL VL Y+       EE+K  WAQHWI RG +A+EKLL+S+AG
Sbjct: 6   RVRAIALIIACDIHPLQNLRVLKYLTEKLGVSEEEKLAWAQHWIERGFQALEKLLASTAG 65

Query: 58  KYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
           KYCVGD+ ++AD CL+PQV+NARRF VDL P+P ++RI+      P
Sbjct: 66  KYCVGDEPTLADICLVPQVYNARRFGVDLSPYPTIVRINEACLELP 111


Glutathione S-transferase (GST) C-terminal domain family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Zeta GSTs, also known as maleylacetoacetate (MAA) isomerases, catalyze the isomerization of MAA to fumarylacetoacetate, the penultimate step in tyrosine/phenylalanine catabolism, using GSH as a cofactor. They show little GSH-conjugating activity towards traditional GST substrates, but display modest GSH peroxidase activity. They are also implicated in the detoxification of the carcinogen dichloroacetic acid by catalyzing its dechlorination to glyoxylic acid. Length = 121

>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|198301 cd03192, GST_C_Sigma_like, C-terminal, alpha helical domain of Class Sigma-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.88
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.87
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.86
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.86
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 99.84
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.84
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.84
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.84
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 99.83
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.81
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.81
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.81
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 99.8
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 99.8
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 99.8
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.79
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 99.79
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.79
PRK10542201 glutathionine S-transferase; Provisional 99.77
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.77
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.76
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 99.76
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.75
KOG0868|consensus217 99.73
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.73
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 99.71
PRK09481211 sspA stringent starvation protein A; Provisional 99.71
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 99.7
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 99.7
PLN02395215 glutathione S-transferase 99.69
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 99.67
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.67
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 99.67
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 99.65
PLN02473214 glutathione S-transferase 99.65
PRK15113214 glutathione S-transferase; Provisional 99.65
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 99.64
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.64
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 99.62
PRK11752264 putative S-transferase; Provisional 99.62
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.62
PTZ00057205 glutathione s-transferase; Provisional 99.61
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 99.6
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 99.58
PRK10357202 putative glutathione S-transferase; Provisional 99.57
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 99.54
PRK10387210 glutaredoxin 2; Provisional 99.54
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 99.53
KOG0867|consensus226 99.51
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 99.45
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.44
PLN02378213 glutathione S-transferase DHAR1 99.42
KOG0406|consensus231 99.39
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.39
PLN02817265 glutathione dehydrogenase (ascorbate) 99.36
PLN02907 722 glutamate-tRNA ligase 99.32
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 99.31
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 99.28
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 99.26
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 99.15
KOG4420|consensus325 99.1
KOG1695|consensus206 98.94
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 98.82
KOG2903|consensus319 98.63
KOG1422|consensus221 98.37
KOG4244|consensus281 98.2
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 97.7
KOG3027|consensus257 97.68
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 97.6
KOG3028|consensus313 97.24
KOG3029|consensus370 97.17
KOG1147|consensus 712 96.39
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 92.13
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 91.29
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
Probab=99.88  E-value=1.5e-21  Score=114.78  Aligned_cols=103  Identities=51%  Similarity=0.974  Sum_probs=82.6

Q ss_pred             ChhHHHHHHHHHHcCCCCCchHHHhhhc----C--hHHHHHHHHHHHHHHHHHHHHHhhcCCCCeeecCCCchhHHhhHH
Q psy3262           1 MIGKVREICEVIASGIQPLQNLTVLIYV----G--EEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIP   74 (103)
Q Consensus         1 ~ra~~~~~~~~~~~~l~~~~~~~~~~~~----~--~~~~~~~~~~~~~~~l~~le~~l~~~~~~~l~G~~~s~ADi~l~~   74 (103)
                      +|+++++|+.|+++++++.+...++...    +  .+...+...+.+.+.++.+|++|++++++|++|+++|+|||++++
T Consensus         3 ~ra~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~t~ADi~~~~   82 (121)
T cd03191           3 KRARVRALALIIACDIHPLNNLRVLKYLTEELGLDEEAKNAWYRHWIARGFAALEKLLAQTAGKFCFGDEPTLADICLVP   82 (121)
T ss_pred             hHHHHHHHHHHHHccCCccccHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCeecCCcCCHHHHHHHH
Confidence            5899999999999999987433333221    2  223444556778999999999998532479999999999999999


Q ss_pred             HHHHHHhhcCCCCCCchHHHHHHHhhcCC
Q psy3262          75 QVFNARRFHVDLRPFPIVLRIDRELENHP  103 (103)
Q Consensus        75 ~~~~~~~~~~~~~~~p~l~~~~~ri~~~p  103 (103)
                      .+.+....+++++.+|+|++|++++.+||
T Consensus        83 ~~~~~~~~~~~~~~~p~l~~w~~~~~~~p  111 (121)
T cd03191          83 QVYNARRFGVDLSPYPTIARINEACLELP  111 (121)
T ss_pred             HHHHHHHhCCCcccCcHHHHHHHHHHhCh
Confidence            99988777777788999999999999987



The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Zeta GSTs, also known as maleylacetoacetate (MAA) isomerases, catalyze the isomerization of MAA to fumarylacetoacetate, the penultimate step in tyrosine/phenylalanine catabolism, using GSH as a cofactor. They show little GSH-conjugating activity towards traditional GST substrates, but display modest GSH peroxidase activity. They are also implicated in the detoxification of th

>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PLN02395 glutathione S-transferase Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>KOG1147|consensus Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
2cz2_A223 Crystal Structure Of Glutathione Transferase Zeta 1 5e-30
1fw1_A216 Glutathione Transferase ZetaMALEYLACETOACETATE ISOM 5e-27
4igj_A242 Crystal Structure Of Maleylacetoacetate Isomerase F 1e-19
3lg6_A235 Crystal Structure Of Putative Glutathione Transfera 7e-17
1e6b_A221 Crystal Structure Of A Zeta Class Glutathione S-Tra 5e-15
2v6k_A214 Structure Of Maleyl Pyruvate Isomerase, A Bacterial 5e-14
2jl4_A213 Holo Structure Of Maleyl Pyruvate Isomerase, A Bact 5e-14
3niv_A222 The Crystal Structure Of Glutathione S-Transferase 1e-13
>pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 Back     alignment and structure

Iteration: 1

Score = 125 bits (315), Expect = 5e-30, Method: Compositional matrix adjust. Identities = 57/95 (60%), Positives = 73/95 (76%) Query: 5 VREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDD 64 VR I ++IASGIQPLQNL+VL VG+E + +WAQ I G A+EK+L S+AGKYCVGD+ Sbjct: 106 VRXISDLIASGIQPLQNLSVLKQVGQENQXQWAQKVITSGFNALEKILQSTAGKYCVGDE 165 Query: 65 ISVADCCLIPQVFNARRFHVDLRPFPIVLRIDREL 99 +S AD CL+PQV NA RF VDL P+P + I++EL Sbjct: 166 VSXADVCLVPQVANAERFKVDLSPYPTISHINKEL 200
>pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 Back     alignment and structure
>pdb|4IGJ|A Chain A, Crystal Structure Of Maleylacetoacetate Isomerase From Anaeromyxobacter Dehalogenans 2cp-1, Target Efi-507175 Length = 242 Back     alignment and structure
>pdb|3LG6|A Chain A, Crystal Structure Of Putative Glutathione Transferase From Coccidioides Immitis Length = 235 Back     alignment and structure
>pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 Back     alignment and structure
>pdb|2V6K|A Chain A, Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-s-transferase In Zeta Class, In Complex With Substrate Analogue Dicarboxyethyl Glutathione Length = 214 Back     alignment and structure
>pdb|2JL4|A Chain A, Holo Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-S-Transferase In Zeta Class Length = 213 Back     alignment and structure
>pdb|3NIV|A Chain A, The Crystal Structure Of Glutathione S-Transferase From Legionella Pneumophila Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 2e-39
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 5e-39
3n5o_A235 Glutathione transferase; seattle structural genomi 6e-38
3niv_A222 Glutathione S-transferase; structural genomics, PS 2e-33
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 5e-32
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 2e-22
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 1e-20
3lxz_A229 Glutathione S-transferase family protein; structur 2e-19
3lyp_A215 Stringent starvation protein A; structural genomic 2e-15
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 5e-15
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 2e-14
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 3e-14
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 6e-14
3lyk_A216 Stringent starvation protein A homolog; structural 4e-13
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 2e-12
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 2e-12
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 4e-12
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 1e-11
4dej_A231 Glutathione S-transferase related protein; transfe 3e-11
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 8e-11
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 9e-11
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 1e-10
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 2e-10
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 1e-09
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 3e-08
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 3e-08
1r5a_A218 Glutathione transferase; glutathione S-transferase 5e-08
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 6e-08
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 7e-08
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 1e-07
2ahe_A267 Chloride intracellular channel protein 4; glutathi 1e-07
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 1e-07
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 2e-07
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 2e-07
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 3e-07
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 3e-07
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 4e-07
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 4e-07
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 4e-07
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 5e-07
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 5e-07
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 6e-07
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 1e-06
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 1e-06
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 2e-06
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 2e-06
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 3e-06
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 3e-06
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 3e-06
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 3e-06
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 4e-06
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 6e-06
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 6e-06
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 1e-05
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 1e-05
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 2e-05
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 2e-05
1f2e_A201 Glutathione S-transferase; GST complexed with glut 4e-05
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 5e-05
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 5e-05
2fhe_A216 GST, glutathione S-transferase; transferase-substr 9e-05
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 1e-04
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 1e-04
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 1e-04
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 1e-04
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 1e-04
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 2e-04
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 2e-04
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 2e-04
1axd_A209 Glutathione S-transferase I; transferase, herbicid 2e-04
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 2e-04
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 3e-04
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 4e-04
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 4e-04
3tou_A226 Glutathione S-transferase protein; GSH binding sit 4e-04
2r4v_A247 XAP121, chloride intracellular channel protein 2; 6e-04
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 8e-04
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 8e-04
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 8e-04
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
 Score =  129 bits (327), Expect = 2e-39
 Identities = 57/100 (57%), Positives = 74/100 (74%)

Query: 4   KVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGD 63
            VR I ++IASGIQPLQNL+VL  VG+E + +WAQ  I  G  A+EK+L S+AGKYCVGD
Sbjct: 105 IVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGD 164

Query: 64  DISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
           ++S+AD CL+PQV NA RF VDL P+P +  I++EL    
Sbjct: 165 EVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALE 204


>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.84
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.79
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.79
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.79
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.79
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 99.79
3n5o_A235 Glutathione transferase; seattle structural genomi 99.79
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.78
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.78
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.78
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.78
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.78
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.77
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.77
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.77
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.77
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.77
3lyp_A215 Stringent starvation protein A; structural genomic 99.77
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.76
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.76
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.76
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.76
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.75
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.75
4exj_A238 Uncharacterized protein; transferase-like protein, 99.75
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.75
3lyk_A216 Stringent starvation protein A homolog; structural 99.74
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.74
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.74
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.74
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.74
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.74
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.74
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.74
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.74
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.73
4glt_A225 Glutathione S-transferase-like protein; structural 99.73
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.72
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.72
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.72
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.72
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.72
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.72
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.71
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.71
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.71
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.71
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.71
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.7
3lxz_A229 Glutathione S-transferase family protein; structur 99.7
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.7
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.7
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.7
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.7
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.69
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.69
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.69
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.69
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.69
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.69
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.68
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.68
4dej_A231 Glutathione S-transferase related protein; transfe 99.68
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.68
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.68
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.67
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.67
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.67
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.67
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.67
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.67
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.67
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.67
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.66
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.66
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.66
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.66
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.65
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.65
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.65
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.64
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.64
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.64
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.63
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.63
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.63
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.63
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.62
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.62
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.61
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.61
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.61
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.61
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.6
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.6
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.57
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.56
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 99.55
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.55
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.54
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.53
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.51
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.51
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.5
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.47
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.46
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.46
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.46
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.45
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.41
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.39
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.37
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.32
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 98.89
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 98.34
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
Probab=99.84  E-value=9.5e-21  Score=119.51  Aligned_cols=100  Identities=14%  Similarity=0.172  Sum_probs=85.8

Q ss_pred             ChhHHHHHHHHHHcCCCCCchHHHhhhcChHHHHHHHHHHHHHHHHHHHHHhhcCCCCeeecCCCchhHHhhHHHHHHHH
Q psy3262           1 MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNAR   80 (103)
Q Consensus         1 ~ra~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~l~~~~~~~l~G~~~s~ADi~l~~~~~~~~   80 (103)
                      +|+++++|+.++...+++.+. ..+....+++..+...+.+.+.++.+|++|+++  +|++|+++|+|||++++.+.+..
T Consensus        93 ~ra~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~--~~l~G~~~t~ADi~~~~~l~~~~  169 (211)
T 4gci_A           93 SRYHAIEWLNFIATELHKGFS-PLFNPNTPDEYKTIVRERLDKQFSYVDSVLAEH--DYLLGKKFSVADAYLFTVSRWAN  169 (211)
T ss_dssp             HHHHHHHHHHHHHHHTTGGGH-HHHCTTSCHHHHHHHHHHHHHHHHHHHHHHTSS--SSSSSSSCCHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHhhhhH-HHhccccchhhHhhhHHHHHHHHHHHHHHHhcC--CccCCCCccHHHHHHHHHHHHHH
Confidence            378999999999999988763 344333345566667788999999999999876  99999999999999999999998


Q ss_pred             hhcCCCCCCchHHHHHHHhhcCC
Q psy3262          81 RFHVDLRPFPIVLRIDRELENHP  103 (103)
Q Consensus        81 ~~~~~~~~~p~l~~~~~ri~~~p  103 (103)
                      ..+++++++|+|++|++||.+||
T Consensus       170 ~~~~~~~~~p~l~~w~~r~~~rP  192 (211)
T 4gci_A          170 ALNLQIKERSHLDQYMARVAERP  192 (211)
T ss_dssp             HTTCCCSSCHHHHHHHHHHTTSH
T ss_pred             HcCCCcccCHHHHHHHHHHHhCH
Confidence            88888899999999999999997



>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d1e6ba1133 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres 4e-20
d1fw1a1125 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa 2e-17
d1k3ya1142 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s 3e-12
d1f2ea1121 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p 2e-10
d1tw9a1129 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid 3e-10
d1n2aa1121 a.45.1.1 (A:81-201) Class beta GST {Escherichia co 9e-10
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 1e-09
d1b48a1143 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu 1e-09
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 4e-08
d1pmta1121 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi 8e-08
d1jlva1123 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano 3e-07
d1oe8a1123 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( 3e-07
d2gsqa1127 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast 8e-07
d1okta1126 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla 1e-06
d1r5aa1129 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano 2e-06
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 7e-06
d1jlwa1127 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano 8e-06
d1tu7a1131 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu 4e-05
d1m0ua1127 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D 5e-05
d2cvda1124 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s 3e-04
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class zeta GST
species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 76.8 bits (188), Expect = 4e-20
 Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 4   KVREICEVIASGIQPLQNLTVLIYV----GEEKKREWAQHWIHRGLRAVEKLLSSSAGKY 59
              +   ++ SGIQP QNL V+ Y+      E+K  W  + I +G  A+EKLL + AGK+
Sbjct: 12  VNYQAMSIVLSGIQPHQNLAVIRYIEEKINVEEKTAWVNNAITKGFTALEKLLVNCAGKH 71

Query: 60  CVGDDISVADCCLIPQVFNA-RRFHVDLRPFPIVLRIDRELENHP 103
             GD+I +AD  L PQ+  A  RF +++ P+P + +        P
Sbjct: 72  ATGDEIYLADLFLAPQIHGAINRFQINMEPYPTLAKCYESYNELP 116


>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.93
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.93
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.93
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.92
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.91
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.91
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.91
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.91
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.9
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.9
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.88
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.87
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.87
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.86
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.82
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.82
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.81
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.8
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.8
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.8
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.8
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.79
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.78
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.78
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.78
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.77
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.76
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.73
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.73
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.73
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.73
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.71
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 99.69
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 99.67
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.64
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 99.4
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.29
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 98.94
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 97.47
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 95.59
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class beta GST
species: Sphingomonas paucimobilis [TaxId: 13689]
Probab=99.93  E-value=4.6e-27  Score=136.34  Aligned_cols=100  Identities=15%  Similarity=0.162  Sum_probs=88.4

Q ss_pred             ChhHHHHHHHHHHcCCCCCchHHHhhhcChHHHHHHHHHHHHHHHHHHHHHhhcCCCCeeecCCCchhHHhhHHHHHHHH
Q psy3262           1 MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNAR   80 (103)
Q Consensus         1 ~ra~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~l~~~~~~~l~G~~~s~ADi~l~~~~~~~~   80 (103)
                      +|+++++|++|+++++++.+. .++.....++..+...+.+.+.++.||++|.++  +|++|+++|+|||++++++.|..
T Consensus        10 ~Ra~~~~wl~f~~~~~~~~~~-~l~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~--~yl~Gd~~TiaDi~~~~~~~~~~   86 (121)
T d1f2ea1          10 DRYRLLSRLSFLGSEFHKAFV-PLFAPATSDEAKAAAAESVKNHLAALDKELAGR--DHYAGNAFSVADIYLYVMLGWPA   86 (121)
T ss_dssp             HHHHHHHHHHHHHHTHHHHHH-HHHCSSCCHHHHHHHHHHHHHHHHHHHHHHHSC--SSSSSSSCCHHHHHHHHHTTSGG
T ss_pred             HHHHHHHHHHHHhcchHHHHH-HHHCcCCCHHHHHHHHHHHHHHHHHHHHHHccC--CCchhcCCCHHHHHHHHHHHHHH
Confidence            589999999999999998763 444444455667778899999999999999986  99999999999999999999998


Q ss_pred             hhcCCCCCCchHHHHHHHhhcCC
Q psy3262          81 RFHVDLRPFPIVLRIDRELENHP  103 (103)
Q Consensus        81 ~~~~~~~~~p~l~~~~~ri~~~p  103 (103)
                      ..++++++||+|++|+++|++||
T Consensus        87 ~~~~~~~~~p~l~~w~~~~~~rp  109 (121)
T d1f2ea1          87 YVGIDMAAYPALGAYAGKIAQRP  109 (121)
T ss_dssp             GGTCCGGGCHHHHHHHHHHTTSH
T ss_pred             HcCCChhhCHHHHHHHHHHHCCH
Confidence            88999999999999999999997



>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure