Psyllid ID: psy3262
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| 242010719 | 217 | glutathione-S-transferase theta, GST, pu | 0.980 | 0.465 | 0.881 | 3e-48 | |
| 387413743 | 217 | glutathione s-transferase Z1 [Sogatella | 0.980 | 0.465 | 0.881 | 6e-48 | |
| 373940155 | 217 | glutathione S-transferase Z1 [Laodelphax | 0.980 | 0.465 | 0.881 | 7e-48 | |
| 189239333 | 215 | PREDICTED: similar to glutathione S-tran | 0.980 | 0.469 | 0.891 | 1e-47 | |
| 387413769 | 217 | glutathione s transferase zeta 1 [Nilapa | 0.980 | 0.465 | 0.871 | 3e-47 | |
| 112984030 | 215 | glutathione S-transferase zeta 1 [Bombyx | 0.980 | 0.469 | 0.851 | 7e-47 | |
| 301312606 | 215 | glutathione s-transferase [Chironomus ri | 0.980 | 0.469 | 0.851 | 2e-46 | |
| 347968784 | 263 | AGAP002898-PB [Anopheles gambiae str. PE | 0.980 | 0.384 | 0.831 | 3e-46 | |
| 289177028 | 217 | glutathione S-transferase Z1 [Nasonia vi | 0.980 | 0.465 | 0.831 | 4e-46 | |
| 312380295 | 182 | hypothetical protein AND_07698 [Anophele | 0.980 | 0.554 | 0.851 | 4e-46 |
| >gi|242010719|ref|XP_002426106.1| glutathione-S-transferase theta, GST, putative [Pediculus humanus corporis] gi|212510153|gb|EEB13368.1| glutathione-S-transferase theta, GST, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 195 bits (496), Expect = 3e-48, Method: Compositional matrix adjust.
Identities = 89/101 (88%), Positives = 98/101 (97%)
Query: 3 GKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVG 62
KVREICEVIASGIQPLQNL VLIYVGEEKK+EWAQHWI+RG RAVEKLLS+SAGKYCVG
Sbjct: 98 AKVREICEVIASGIQPLQNLIVLIYVGEEKKKEWAQHWINRGFRAVEKLLSASAGKYCVG 157
Query: 63 DDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
D++++ADCCL+PQVFNARRFHVDLRPFPI+LRIDRELENHP
Sbjct: 158 DEVTLADCCLVPQVFNARRFHVDLRPFPIILRIDRELENHP 198
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|387413743|gb|AFJ75819.1| glutathione s-transferase Z1 [Sogatella furcifera] | Back alignment and taxonomy information |
|---|
| >gi|373940155|gb|AEY80030.1| glutathione S-transferase Z1 [Laodelphax striatella] | Back alignment and taxonomy information |
|---|
| >gi|189239333|ref|XP_973541.2| PREDICTED: similar to glutathione S-transferase [Tribolium castaneum] gi|270010448|gb|EFA06896.1| hypothetical protein TcasGA2_TC009842 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|387413769|gb|AFJ75820.1| glutathione s transferase zeta 1 [Nilaparvata lugens] | Back alignment and taxonomy information |
|---|
| >gi|112984030|ref|NP_001037418.1| glutathione S-transferase zeta 1 [Bombyx mori] gi|85740627|gb|ABC79691.1| glutathione S-transferase 4 [Bombyx mori] gi|95102880|gb|ABF51381.1| glutathione-S-transferase [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|301312606|gb|ADK66969.1| glutathione s-transferase [Chironomus riparius] | Back alignment and taxonomy information |
|---|
| >gi|347968784|ref|XP_003436289.1| AGAP002898-PB [Anopheles gambiae str. PEST] gi|333467832|gb|EGK96713.1| AGAP002898-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|289177028|ref|NP_001165931.1| glutathione S-transferase Z1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|312380295|gb|EFR26331.1| hypothetical protein AND_07698 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| FB|FBgn0037697 | 227 | GstZ2 "Glutathione S transfera | 0.970 | 0.440 | 0.83 | 4.5e-43 | |
| FB|FBgn0037696 | 246 | GstZ1 "Glutathione S transfera | 0.941 | 0.394 | 0.577 | 4.9e-30 | |
| ZFIN|ZDB-GENE-040718-184 | 220 | gstz1 "glutathione S-transfera | 0.912 | 0.427 | 0.589 | 5.7e-27 | |
| MGI|MGI:1341859 | 216 | Gstz1 "glutathione transferase | 0.922 | 0.439 | 0.6 | 9.4e-27 | |
| RGD|1589363 | 216 | Gstz1 "glutathione S-transfera | 0.922 | 0.439 | 0.589 | 2.2e-25 | |
| UNIPROTKB|F1S2N0 | 216 | GSTZ1 "Uncharacterized protein | 0.932 | 0.444 | 0.552 | 4.6e-25 | |
| UNIPROTKB|K7GQV5 | 217 | GSTZ1 "Uncharacterized protein | 0.932 | 0.442 | 0.552 | 4.6e-25 | |
| UNIPROTKB|K7GR50 | 184 | GSTZ1 "Uncharacterized protein | 0.932 | 0.521 | 0.552 | 4.6e-25 | |
| UNIPROTKB|G3V267 | 189 | GSTZ1 "Maleylacetoacetate isom | 0.922 | 0.502 | 0.557 | 6.8e-24 | |
| UNIPROTKB|G3V4T6 | 217 | GSTZ1 "Maleylacetoacetate isom | 0.922 | 0.437 | 0.557 | 6.8e-24 |
| FB|FBgn0037697 GstZ2 "Glutathione S transferase Z2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 455 (165.2 bits), Expect = 4.5e-43, P = 4.5e-43
Identities = 83/100 (83%), Positives = 94/100 (94%)
Query: 4 KVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGD 63
KVREI E+I SGIQPLQNL VLI+VGEEKK+EWAQHWI RG RAVEK LS+SAGKYCVGD
Sbjct: 108 KVREIVEIICSGIQPLQNLIVLIHVGEEKKKEWAQHWITRGFRAVEKALSTSAGKYCVGD 167
Query: 64 DISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
+IS+ADCCL+PQVFNARRFHVDLRP+PI+LRIDRELE++P
Sbjct: 168 EISMADCCLVPQVFNARRFHVDLRPYPIILRIDRELESNP 207
|
|
| FB|FBgn0037696 GstZ1 "Glutathione S transferase Z1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040718-184 gstz1 "glutathione S-transferase zeta 1" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1341859 Gstz1 "glutathione transferase zeta 1 (maleylacetoacetate isomerase)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1589363 Gstz1 "glutathione S-transferase zeta 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S2N0 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GQV5 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7GR50 GSTZ1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V267 GSTZ1 "Maleylacetoacetate isomerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V4T6 GSTZ1 "Maleylacetoacetate isomerase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| cd03191 | 121 | cd03191, GST_C_Zeta, C-terminal, alpha helical dom | 7e-54 | |
| TIGR01262 | 210 | TIGR01262, maiA, maleylacetoacetate isomerase | 3e-43 | |
| COG0625 | 211 | COG0625, Gst, Glutathione S-transferase [Posttrans | 9e-12 | |
| cd00299 | 100 | cd00299, GST_C_family, C-terminal, alpha helical d | 6e-06 | |
| pfam13410 | 69 | pfam13410, GST_C_2, Glutathione S-transferase, C-t | 3e-04 | |
| pfam00043 | 92 | pfam00043, GST_C, Glutathione S-transferase, C-ter | 6e-04 | |
| cd03192 | 104 | cd03192, GST_C_Sigma_like, C-terminal, alpha helic | 0.002 | |
| cd03177 | 117 | cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he | 0.003 |
| >gnl|CDD|198300 cd03191, GST_C_Zeta, C-terminal, alpha helical domain of Class Zeta Glutathione S-transferases | Back alignment and domain information |
|---|
Score = 163 bits (415), Expect = 7e-54
Identities = 59/106 (55%), Positives = 76/106 (71%), Gaps = 6/106 (5%)
Query: 4 KVREICEVIASGIQPLQNLTVLIYVG------EEKKREWAQHWIHRGLRAVEKLLSSSAG 57
+VR I +IA I PLQNL VL Y+ EE+K WAQHWI RG +A+EKLL+S+AG
Sbjct: 6 RVRAIALIIACDIHPLQNLRVLKYLTEKLGVSEEEKLAWAQHWIERGFQALEKLLASTAG 65
Query: 58 KYCVGDDISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
KYCVGD+ ++AD CL+PQV+NARRF VDL P+P ++RI+ P
Sbjct: 66 KYCVGDEPTLADICLVPQVYNARRFGVDLSPYPTIVRINEACLELP 111
|
Glutathione S-transferase (GST) C-terminal domain family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Zeta GSTs, also known as maleylacetoacetate (MAA) isomerases, catalyze the isomerization of MAA to fumarylacetoacetate, the penultimate step in tyrosine/phenylalanine catabolism, using GSH as a cofactor. They show little GSH-conjugating activity towards traditional GST substrates, but display modest GSH peroxidase activity. They are also implicated in the detoxification of the carcinogen dichloroacetic acid by catalyzing its dechlorination to glyoxylic acid. Length = 121 |
| >gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family | Back alignment and domain information |
|---|
| >gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|198301 cd03192, GST_C_Sigma_like, C-terminal, alpha helical domain of Class Sigma-like Glutathione S-transferases | Back alignment and domain information |
|---|
| >gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| cd03191 | 121 | GST_C_Zeta GST_C family, Class Zeta subfamily; GST | 99.88 | |
| cd03189 | 119 | GST_C_GTT1_like GST_C family, Saccharomyces cerevi | 99.87 | |
| cd03188 | 114 | GST_C_Beta GST_C family, Class Beta subfamily; GST | 99.86 | |
| cd03180 | 110 | GST_C_2 GST_C family, unknown subfamily 2; compose | 99.86 | |
| cd03178 | 113 | GST_C_Ure2p_like GST_C family, Ure2p-like subfamil | 99.84 | |
| cd03186 | 107 | GST_C_SspA GST_N family, Stringent starvation prot | 99.84 | |
| cd03196 | 115 | GST_C_5 GST_C family, unknown subfamily 5; compose | 99.84 | |
| cd03177 | 118 | GST_C_Delta_Epsilon GST_C family, Class Delta and | 99.84 | |
| cd03182 | 117 | GST_C_GTT2_like GST_C family, Saccharomyces cerevi | 99.83 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 99.81 | |
| cd03187 | 118 | GST_C_Phi GST_C family, Class Phi subfamily; compo | 99.81 | |
| cd03206 | 100 | GST_C_7 GST_C family, unknown subfamily 7; compose | 99.81 | |
| cd03183 | 126 | GST_C_Theta GST_C family, Class Theta subfamily; c | 99.8 | |
| cd03179 | 105 | GST_C_1 GST_C family, unknown subfamily 1; compose | 99.8 | |
| cd03181 | 123 | GST_C_EFB1gamma GST_C family, Gamma subunit of Elo | 99.8 | |
| cd03185 | 126 | GST_C_Tau GST_C family, Class Tau subfamily; GSTs | 99.79 | |
| cd03195 | 114 | GST_C_4 GST_C family, unknown subfamily 4; compose | 99.79 | |
| cd03184 | 124 | GST_C_Omega GST_C family, Class Omega subfamily; G | 99.79 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 99.77 | |
| cd03190 | 142 | GST_C_ECM4_like GST_C family, ECM4-like subfamily; | 99.77 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 99.76 | |
| cd03207 | 103 | GST_C_8 GST_C family, unknown subfamily 8; compose | 99.76 | |
| PF00043 | 95 | GST_C: Glutathione S-transferase, C-terminal domai | 99.75 | |
| KOG0868|consensus | 217 | 99.73 | ||
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 99.73 | |
| cd03209 | 121 | GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar | 99.71 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 99.71 | |
| cd03204 | 111 | GST_C_GDAP1 GST_C family, Ganglioside-induced diff | 99.7 | |
| cd03210 | 126 | GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar | 99.7 | |
| PLN02395 | 215 | glutathione S-transferase | 99.69 | |
| cd00299 | 100 | GST_C_family Glutathione S-transferase (GST) famil | 99.67 | |
| cd03203 | 120 | GST_C_Lambda GST_C family, Class Lambda subfamily; | 99.67 | |
| cd03194 | 114 | GST_C_3 GST_C family, unknown subfamily 3; compose | 99.67 | |
| cd03208 | 137 | GST_C_Alpha GST_C family, Class Alpha subfamily; G | 99.65 | |
| PLN02473 | 214 | glutathione S-transferase | 99.65 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 99.65 | |
| cd03192 | 104 | GST_C_Sigma_like GST_C family, Class Sigma_like; c | 99.64 | |
| PF14497 | 99 | GST_C_3: Glutathione S-transferase, C-terminal dom | 99.64 | |
| cd03198 | 134 | GST_C_CLIC GST_C family, Chloride Intracellular Ch | 99.62 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 99.62 | |
| PF13410 | 69 | GST_C_2: Glutathione S-transferase, C-terminal dom | 99.62 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 99.61 | |
| cd03200 | 96 | GST_C_JTV1 GST_C family, JTV-1 subfamily; composed | 99.6 | |
| cd03201 | 121 | GST_C_DHAR GST_C family, Dehydroascorbate Reductas | 99.58 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 99.57 | |
| cd03202 | 124 | GST_C_etherase_LigE GST_C family, Beta etherase Li | 99.54 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 99.54 | |
| cd03193 | 88 | GST_C_Metaxin GST_C family, Metaxin subfamily; com | 99.53 | |
| KOG0867|consensus | 226 | 99.51 | ||
| cd03205 | 98 | GST_C_6 GST_C family, unknown subfamily 6; compose | 99.45 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 99.44 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 99.42 | |
| KOG0406|consensus | 231 | 99.39 | ||
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 99.39 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 99.36 | |
| PLN02907 | 722 | glutamate-tRNA ligase | 99.32 | |
| cd03197 | 149 | GST_C_mPGES2 GST_C family; microsomal Prostaglandi | 99.31 | |
| cd03212 | 137 | GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, | 99.28 | |
| cd03211 | 126 | GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me | 99.26 | |
| PF14834 | 117 | GST_C_4: Glutathione S-transferase, C-terminal dom | 99.15 | |
| KOG4420|consensus | 325 | 99.1 | ||
| KOG1695|consensus | 206 | 98.94 | ||
| COG0435 | 324 | ECM4 Predicted glutathione S-transferase [Posttran | 98.82 | |
| KOG2903|consensus | 319 | 98.63 | ||
| KOG1422|consensus | 221 | 98.37 | ||
| KOG4244|consensus | 281 | 98.2 | ||
| PF04399 | 132 | Glutaredoxin2_C: Glutaredoxin 2, C terminal domain | 97.7 | |
| KOG3027|consensus | 257 | 97.68 | ||
| cd03199 | 128 | GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub | 97.6 | |
| KOG3028|consensus | 313 | 97.24 | ||
| KOG3029|consensus | 370 | 97.17 | ||
| KOG1147|consensus | 712 | 96.39 | ||
| PF11801 | 168 | Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 | 92.13 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 91.29 |
| >cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
Probab=99.88 E-value=1.5e-21 Score=114.78 Aligned_cols=103 Identities=51% Similarity=0.974 Sum_probs=82.6
Q ss_pred ChhHHHHHHHHHHcCCCCCchHHHhhhc----C--hHHHHHHHHHHHHHHHHHHHHHhhcCCCCeeecCCCchhHHhhHH
Q psy3262 1 MIGKVREICEVIASGIQPLQNLTVLIYV----G--EEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIP 74 (103)
Q Consensus 1 ~ra~~~~~~~~~~~~l~~~~~~~~~~~~----~--~~~~~~~~~~~~~~~l~~le~~l~~~~~~~l~G~~~s~ADi~l~~ 74 (103)
+|+++++|+.|+++++++.+...++... + .+...+...+.+.+.++.+|++|++++++|++|+++|+|||++++
T Consensus 3 ~ra~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~~~l~G~~~t~ADi~~~~ 82 (121)
T cd03191 3 KRARVRALALIIACDIHPLNNLRVLKYLTEELGLDEEAKNAWYRHWIARGFAALEKLLAQTAGKFCFGDEPTLADICLVP 82 (121)
T ss_pred hHHHHHHHHHHHHccCCccccHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHHHHhcCCCeecCCcCCHHHHHHHH
Confidence 5899999999999999987433333221 2 223444556778999999999998532479999999999999999
Q ss_pred HHHHHHhhcCCCCCCchHHHHHHHhhcCC
Q psy3262 75 QVFNARRFHVDLRPFPIVLRIDRELENHP 103 (103)
Q Consensus 75 ~~~~~~~~~~~~~~~p~l~~~~~ri~~~p 103 (103)
.+.+....+++++.+|+|++|++++.+||
T Consensus 83 ~~~~~~~~~~~~~~~p~l~~w~~~~~~~p 111 (121)
T cd03191 83 QVYNARRFGVDLSPYPTIARINEACLELP 111 (121)
T ss_pred HHHHHHHhCCCcccCcHHHHHHHHHHhCh
Confidence 99988777777788999999999999987
|
The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Zeta GSTs, also known as maleylacetoacetate (MAA) isomerases, catalyze the isomerization of MAA to fumarylacetoacetate, the penultimate step in tyrosine/phenylalanine catabolism, using GSH as a cofactor. They show little GSH-conjugating activity towards traditional GST substrates, but display modest GSH peroxidase activity. They are also implicated in the detoxification of th |
| >cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs | Back alignment and domain information |
|---|
| >cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha | Back alignment and domain information |
|---|
| >PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B | Back alignment and domain information |
|---|
| >cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene | Back alignment and domain information |
|---|
| >cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >KOG0867|consensus | Back alignment and domain information |
|---|
| >cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >PLN02907 glutamate-tRNA ligase | Back alignment and domain information |
|---|
| >cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins | Back alignment and domain information |
|---|
| >cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A | Back alignment and domain information |
|---|
| >KOG4420|consensus | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2903|consensus | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >KOG3027|consensus | Back alignment and domain information |
|---|
| >cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >KOG3028|consensus | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >KOG1147|consensus | Back alignment and domain information |
|---|
| >PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 103 | ||||
| 2cz2_A | 223 | Crystal Structure Of Glutathione Transferase Zeta 1 | 5e-30 | ||
| 1fw1_A | 216 | Glutathione Transferase ZetaMALEYLACETOACETATE ISOM | 5e-27 | ||
| 4igj_A | 242 | Crystal Structure Of Maleylacetoacetate Isomerase F | 1e-19 | ||
| 3lg6_A | 235 | Crystal Structure Of Putative Glutathione Transfera | 7e-17 | ||
| 1e6b_A | 221 | Crystal Structure Of A Zeta Class Glutathione S-Tra | 5e-15 | ||
| 2v6k_A | 214 | Structure Of Maleyl Pyruvate Isomerase, A Bacterial | 5e-14 | ||
| 2jl4_A | 213 | Holo Structure Of Maleyl Pyruvate Isomerase, A Bact | 5e-14 | ||
| 3niv_A | 222 | The Crystal Structure Of Glutathione S-Transferase | 1e-13 |
| >pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 | Back alignment and structure |
|
| >pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 | Back alignment and structure |
| >pdb|4IGJ|A Chain A, Crystal Structure Of Maleylacetoacetate Isomerase From Anaeromyxobacter Dehalogenans 2cp-1, Target Efi-507175 Length = 242 | Back alignment and structure |
| >pdb|3LG6|A Chain A, Crystal Structure Of Putative Glutathione Transferase From Coccidioides Immitis Length = 235 | Back alignment and structure |
| >pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 | Back alignment and structure |
| >pdb|2V6K|A Chain A, Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-s-transferase In Zeta Class, In Complex With Substrate Analogue Dicarboxyethyl Glutathione Length = 214 | Back alignment and structure |
| >pdb|2JL4|A Chain A, Holo Structure Of Maleyl Pyruvate Isomerase, A Bacterial Glutathione-S-Transferase In Zeta Class Length = 213 | Back alignment and structure |
| >pdb|3NIV|A Chain A, The Crystal Structure Of Glutathione S-Transferase From Legionella Pneumophila Length = 222 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 2e-39 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 5e-39 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 6e-38 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 2e-33 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 5e-32 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 2e-22 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 1e-20 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 2e-19 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 2e-15 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 5e-15 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 2e-14 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 3e-14 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 6e-14 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 4e-13 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 2e-12 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 2e-12 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 4e-12 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 1e-11 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 3e-11 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 8e-11 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 9e-11 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 1e-10 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 2e-10 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 1e-09 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 3e-08 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 3e-08 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 5e-08 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 6e-08 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 7e-08 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 1e-07 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 1e-07 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 1e-07 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 2e-07 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 2e-07 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 3e-07 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 3e-07 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 4e-07 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 4e-07 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 4e-07 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 5e-07 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 5e-07 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 6e-07 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 1e-06 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 1e-06 | |
| 4g9h_A | 211 | Glutathione S-transferase; GST, enzyme function in | 2e-06 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 2e-06 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 3e-06 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 3e-06 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 3e-06 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 3e-06 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 4e-06 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 6e-06 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 6e-06 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 1e-05 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 1e-05 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 2e-05 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 2e-05 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 4e-05 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 5e-05 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 5e-05 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 9e-05 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 1e-04 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 1e-04 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 1e-04 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 1e-04 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 1e-04 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 2e-04 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 2e-04 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 2e-04 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 2e-04 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 2e-04 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 3e-04 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 4e-04 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 4e-04 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 4e-04 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 6e-04 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 8e-04 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 8e-04 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 8e-04 |
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 | Back alignment and structure |
|---|
Score = 129 bits (327), Expect = 2e-39
Identities = 57/100 (57%), Positives = 74/100 (74%)
Query: 4 KVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGD 63
VR I ++IASGIQPLQNL+VL VG+E + +WAQ I G A+EK+L S+AGKYCVGD
Sbjct: 105 IVRMISDLIASGIQPLQNLSVLKQVGQENQMQWAQKVITSGFNALEKILQSTAGKYCVGD 164
Query: 64 DISVADCCLIPQVFNARRFHVDLRPFPIVLRIDRELENHP 103
++S+AD CL+PQV NA RF VDL P+P + I++EL
Sbjct: 165 EVSMADVCLVPQVANAERFKVDLSPYPTISHINKELLALE 204
|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 | Back alignment and structure |
|---|
| >4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 99.84 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 99.79 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 99.79 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 99.79 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 99.79 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 99.79 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 99.79 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 99.78 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 99.78 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 99.78 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 99.78 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 99.78 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 99.77 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 99.77 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 99.77 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 99.77 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 99.77 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 99.77 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 99.76 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 99.76 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 99.76 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 99.76 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 99.75 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 99.75 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 99.75 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 99.75 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 99.74 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 99.74 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 99.74 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 99.74 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 99.74 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 99.74 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 99.74 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 99.74 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 99.74 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 99.73 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 99.73 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 99.72 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 99.72 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 99.72 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 99.72 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 99.72 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 99.72 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 99.71 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 99.71 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 99.71 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 99.71 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 99.71 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 99.7 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 99.7 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 99.7 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 99.7 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 99.7 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 99.7 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 99.69 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 99.69 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 99.69 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 99.69 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 99.69 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 99.69 | |
| 2hra_A | 209 | Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l | 99.68 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 99.68 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 99.68 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 99.68 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 99.68 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 99.67 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 99.67 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 99.67 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 99.67 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 99.67 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 99.67 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 99.67 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 99.67 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 99.66 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 99.66 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 99.66 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 99.66 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 99.65 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 99.65 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 99.65 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 99.64 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 99.64 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 99.64 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 99.63 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 99.63 | |
| 4fqu_A | 313 | Putative glutathione transferase; glutathionyl-hyd | 99.63 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 99.63 | |
| 4g0i_A | 328 | Protein YQJG; glutathionyl-hydroquinone reductase, | 99.62 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 99.62 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 99.61 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 99.61 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 99.61 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 99.61 | |
| 2uz8_A | 174 | Eukaryotic translation elongation factor 1 epsilon | 99.6 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 99.6 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 99.57 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 99.56 | |
| 2hqt_A | 124 | GU4 nucleic-binding protein 1; GST-fold, biosynthe | 99.55 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 99.55 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 99.54 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.53 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 99.51 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 99.51 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 99.5 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 99.47 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 99.46 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 99.46 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 99.46 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 99.45 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 99.41 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 99.39 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 99.37 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 99.32 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 98.89 | |
| 2hsn_A | 160 | Methionyl-tRNA synthetase, cytoplasmic; protein co | 98.34 |
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
Probab=99.84 E-value=9.5e-21 Score=119.51 Aligned_cols=100 Identities=14% Similarity=0.172 Sum_probs=85.8
Q ss_pred ChhHHHHHHHHHHcCCCCCchHHHhhhcChHHHHHHHHHHHHHHHHHHHHHhhcCCCCeeecCCCchhHHhhHHHHHHHH
Q psy3262 1 MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNAR 80 (103)
Q Consensus 1 ~ra~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~l~~~~~~~l~G~~~s~ADi~l~~~~~~~~ 80 (103)
+|+++++|+.++...+++.+. ..+....+++..+...+.+.+.++.+|++|+++ +|++|+++|+|||++++.+.+..
T Consensus 93 ~ra~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~--~~l~G~~~t~ADi~~~~~l~~~~ 169 (211)
T 4gci_A 93 SRYHAIEWLNFIATELHKGFS-PLFNPNTPDEYKTIVRERLDKQFSYVDSVLAEH--DYLLGKKFSVADAYLFTVSRWAN 169 (211)
T ss_dssp HHHHHHHHHHHHHHHTTGGGH-HHHCTTSCHHHHHHHHHHHHHHHHHHHHHHTSS--SSSSSSSCCHHHHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHhhhhH-HHhccccchhhHhhhHHHHHHHHHHHHHHHhcC--CccCCCCccHHHHHHHHHHHHHH
Confidence 378999999999999988763 344333345566667788999999999999876 99999999999999999999998
Q ss_pred hhcCCCCCCchHHHHHHHhhcCC
Q psy3262 81 RFHVDLRPFPIVLRIDRELENHP 103 (103)
Q Consensus 81 ~~~~~~~~~p~l~~~~~ri~~~p 103 (103)
..+++++++|+|++|++||.+||
T Consensus 170 ~~~~~~~~~p~l~~w~~r~~~rP 192 (211)
T 4gci_A 170 ALNLQIKERSHLDQYMARVAERP 192 (211)
T ss_dssp HTTCCCSSCHHHHHHHHHHTTSH
T ss_pred HcCCCcccCHHHHHHHHHHHhCH
Confidence 88888899999999999999997
|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 103 | ||||
| d1e6ba1 | 133 | a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres | 4e-20 | |
| d1fw1a1 | 125 | a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa | 2e-17 | |
| d1k3ya1 | 142 | a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s | 3e-12 | |
| d1f2ea1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p | 2e-10 | |
| d1tw9a1 | 129 | a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid | 3e-10 | |
| d1n2aa1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Escherichia co | 9e-10 | |
| d1gula1 | 140 | a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s | 1e-09 | |
| d1b48a1 | 143 | a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu | 1e-09 | |
| d1v2aa1 | 125 | a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano | 4e-08 | |
| d1pmta1 | 121 | a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi | 8e-08 | |
| d1jlva1 | 123 | a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano | 3e-07 | |
| d1oe8a1 | 123 | a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( | 3e-07 | |
| d2gsqa1 | 127 | a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast | 8e-07 | |
| d1okta1 | 126 | a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla | 1e-06 | |
| d1r5aa1 | 129 | a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano | 2e-06 | |
| d1k0da1 | 151 | a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni | 7e-06 | |
| d1jlwa1 | 127 | a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano | 8e-06 | |
| d1tu7a1 | 131 | a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu | 4e-05 | |
| d1m0ua1 | 127 | a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D | 5e-05 | |
| d2cvda1 | 124 | a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s | 3e-04 |
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class zeta GST species: Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]
Score = 76.8 bits (188), Expect = 4e-20
Identities = 37/105 (35%), Positives = 57/105 (54%), Gaps = 5/105 (4%)
Query: 4 KVREICEVIASGIQPLQNLTVLIYV----GEEKKREWAQHWIHRGLRAVEKLLSSSAGKY 59
+ ++ SGIQP QNL V+ Y+ E+K W + I +G A+EKLL + AGK+
Sbjct: 12 VNYQAMSIVLSGIQPHQNLAVIRYIEEKINVEEKTAWVNNAITKGFTALEKLLVNCAGKH 71
Query: 60 CVGDDISVADCCLIPQVFNA-RRFHVDLRPFPIVLRIDRELENHP 103
GD+I +AD L PQ+ A RF +++ P+P + + P
Sbjct: 72 ATGDEIYLADLFLAPQIHGAINRFQINMEPYPTLAKCYESYNELP 116
|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 | Back information, alignment and structure |
|---|
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| d1f2ea1 | 121 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 99.93 | |
| d1fw1a1 | 125 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 99.93 | |
| d1n2aa1 | 121 | Class beta GST {Escherichia coli [TaxId: 562]} | 99.93 | |
| d1pmta1 | 121 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 99.92 | |
| d1jlva1 | 123 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.91 | |
| d1v2aa1 | 125 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.91 | |
| d1jlwa1 | 127 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.91 | |
| d1r5aa1 | 129 | Class delta GST {Mosquito (Anopheles dirus b), iso | 99.91 | |
| d1e6ba1 | 133 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 99.9 | |
| d1nhya1 | 144 | GST-like domain of elongation factor 1-gamma {Bake | 99.9 | |
| d1axda1 | 129 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 99.88 | |
| d1aw9a1 | 135 | Class phi GST {Maize (Zea mays), type III [TaxId: | 99.87 | |
| d1ljra1 | 165 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 99.87 | |
| d1gnwa1 | 126 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 99.86 | |
| d1eema1 | 139 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 99.82 | |
| d1k0da1 | 151 | Yeast prion protein ure2p, nitrogen regulation fra | 99.82 | |
| d1gwca1 | 138 | Class tau GST {Aegilops tauschii, also known as Tr | 99.81 | |
| d1tw9a1 | 129 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 99.8 | |
| d1b48a1 | 143 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 99.8 | |
| d1k3ya1 | 142 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.8 | |
| d2gsqa1 | 127 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 99.8 | |
| d2cvda1 | 124 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 99.79 | |
| d3gtub1 | 140 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d2gsta1 | 133 | Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 | 99.78 | |
| d2c4ja1 | 133 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 99.78 | |
| d1gula1 | 140 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 99.77 | |
| d1gsua1 | 133 | Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 | 99.76 | |
| d2a2ra1 | 132 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1m0ua1 | 127 | Class sigma GST {Fruit fly (Drosophila melanogaste | 99.73 | |
| d1duga1 | 140 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 99.73 | |
| d2fhea1 | 136 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 99.73 | |
| d1oyja1 | 145 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 99.71 | |
| d1okta1 | 126 | Pf GST {Malarial parasite (Plasmodium falciparum) | 99.69 | |
| d1oe8a1 | 123 | Class alpha GST {Blood fluke (Schistosoma haematob | 99.67 | |
| d1tu7a1 | 131 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 99.64 | |
| d1k0ma1 | 149 | Chloride intracellular channel 1 (clic1) {Human (H | 99.4 | |
| d2hrkb1 | 118 | GU4 nucleic-binding protein 1, Arc1p {Baker's yeas | 99.29 | |
| d1z9ha1 | 161 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.94 | |
| d1g7oa1 | 140 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 97.47 | |
| d2fnoa1 | 149 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 95.59 |
| >d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: GST C-terminal domain-like superfamily: GST C-terminal domain-like family: Glutathione S-transferase (GST), C-terminal domain domain: Class beta GST species: Sphingomonas paucimobilis [TaxId: 13689]
Probab=99.93 E-value=4.6e-27 Score=136.34 Aligned_cols=100 Identities=15% Similarity=0.162 Sum_probs=88.4
Q ss_pred ChhHHHHHHHHHHcCCCCCchHHHhhhcChHHHHHHHHHHHHHHHHHHHHHhhcCCCCeeecCCCchhHHhhHHHHHHHH
Q psy3262 1 MIGKVREICEVIASGIQPLQNLTVLIYVGEEKKREWAQHWIHRGLRAVEKLLSSSAGKYCVGDDISVADCCLIPQVFNAR 80 (103)
Q Consensus 1 ~ra~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~l~~~~~~~l~G~~~s~ADi~l~~~~~~~~ 80 (103)
+|+++++|++|+++++++.+. .++.....++..+...+.+.+.++.||++|.++ +|++|+++|+|||++++++.|..
T Consensus 10 ~Ra~~~~wl~f~~~~~~~~~~-~l~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~--~yl~Gd~~TiaDi~~~~~~~~~~ 86 (121)
T d1f2ea1 10 DRYRLLSRLSFLGSEFHKAFV-PLFAPATSDEAKAAAAESVKNHLAALDKELAGR--DHYAGNAFSVADIYLYVMLGWPA 86 (121)
T ss_dssp HHHHHHHHHHHHHHTHHHHHH-HHHCSSCCHHHHHHHHHHHHHHHHHHHHHHHSC--SSSSSSSCCHHHHHHHHHTTSGG
T ss_pred HHHHHHHHHHHHhcchHHHHH-HHHCcCCCHHHHHHHHHHHHHHHHHHHHHHccC--CCchhcCCCHHHHHHHHHHHHHH
Confidence 589999999999999998763 444444455667778899999999999999986 99999999999999999999998
Q ss_pred hhcCCCCCCchHHHHHHHhhcCC
Q psy3262 81 RFHVDLRPFPIVLRIDRELENHP 103 (103)
Q Consensus 81 ~~~~~~~~~p~l~~~~~ri~~~p 103 (103)
..++++++||+|++|+++|++||
T Consensus 87 ~~~~~~~~~p~l~~w~~~~~~rp 109 (121)
T d1f2ea1 87 YVGIDMAAYPALGAYAGKIAQRP 109 (121)
T ss_dssp GGTCCGGGCHHHHHHHHHHTTSH
T ss_pred HcCCChhhCHHHHHHHHHHHCCH
Confidence 88999999999999999999997
|
| >d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} | Back information, alignment and structure |
|---|
| >d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|