Psyllid ID: psy3263


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MFIFVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVSSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVAMNQNTNQDMN
ccccccccccccccHHHHHHHHcccEEEccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEcccccccccEEEccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHcccccccccccHHHHcEEEEEEccccccEEccccccccccccccc
cEEEEEccccccccEEEEEEEccccEEEccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEEcEEEEEEEEcccccHHHHHHHcccEEEEccccccccEEEEcccccccHHHHHHHHHHHHHHHHccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccEEEEEEccccHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccccEEcEEEEccccccccc
mfifvvpsinpfgckIKALRAKTntyiktpvrgeepvfvvTGRKEDVARAKREILSAADHFSALRAsrksgalsplspptgvpghvtieVRVPYKVVGLvvgpkgatiKRIQHQtntyivtpsrdkepvfevtgnfpegpgfeshhgQKIVFILTSnlysffdcrifqrmnhhvfsgssgcssasssssssacaphsstqldlgsiwsgmssldkdeglgdspsfdaspvnpssiwsyppvsstspsgsisgsrqcylcndrevthalipcghnffcsecaertcdfdrtcpmcrvpvNQAMRIIFNQFlfgklwepvamnqntnqdmn
mfifvvpsinpfgckikALRAKTntyiktpvrgeepvfvvtgrkedVARAKREILSAADHFSALRASRksgalsplspptgvpghvTIEVRVPYKVVGLVVgpkgatikriqhqtntyivtpsrdkepVFEVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVSSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVAMNQNTNQDMN
MFIFVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMNHHVFsgssgcssasssssssacaphssTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWsyppvsstspsgsisgsRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVAMNQNTNQDMN
*FIFVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVA*********************************VPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMNHHVF*******************************************************************************QCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVA**********
**IFVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDV****************************************IEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPE*P*****HGQKIVFILTSNLYSFFDCRIFQRMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDS***************************ISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVAM*********
MFIFVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMNHHV*************************QLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSY***************RQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVAMNQNTNQDMN
MFIFVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRK********PPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMN****************************************S****************************************SRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVAMNQN******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFIFVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVSSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIFNQFLFGKLWEPVAMNQNTNQDMN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query329 2.2.26 [Sep-21-2011]
Q05A36652 RNA-binding E3 ubiquitin- yes N/A 0.735 0.371 0.477 2e-51
Q5U5Q3659 RNA-binding E3 ubiquitin- yes N/A 0.735 0.367 0.477 2e-51
Q69Z36 601 RNA-binding protein MEX3B no N/A 0.410 0.224 0.764 2e-50
A1L3F4 507 RNA-binding protein MEX3B N/A N/A 0.544 0.353 0.598 7e-50
Q6ZN04 569 RNA-binding protein MEX3B no N/A 0.379 0.219 0.804 1e-49
A1L020520 RNA-binding protein MEX3A no N/A 0.364 0.230 0.788 8e-49
Q86XN8 651 RNA-binding protein MEX3D no N/A 0.379 0.192 0.765 2e-47
Q3UE17 643 RNA-binding protein MEX3D no N/A 0.376 0.192 0.773 5e-47
Q8JHV9401 Baculoviral IAP repeat-co N/A N/A 0.203 0.167 0.323 6e-06
A9ULZ2345 Baculoviral IAP repeat-co N/A N/A 0.203 0.194 0.323 1e-05
>sp|Q05A36|MEX3C_MOUSE RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Mus musculus GN=Mex3c PE=2 SV=2 Back     alignment and function desciption
 Score =  203 bits (516), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 136/285 (47%), Positives = 168/285 (58%), Gaps = 43/285 (15%)

Query: 13  GCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASR-KSG 71
           GCKIKALRAKTNTYIKTPVRGEEP+FVVTGRKEDVA AKREILSAA+HFS +RASR K+G
Sbjct: 245 GCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNG 304

Query: 72  -ALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVF 130
            AL  LS    +PG  T++VRVPY+VVGLVVGPKGATIKRIQ QT+TYIVTPSRDKEPVF
Sbjct: 305 PALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVF 364

Query: 131 EVTGNFPEGPGFESHHGQKIVFILTSNLYSFFDCRIFQRMNHHV-FSGSSGCSSASSSS- 188
           EVTG  PE         +  + + T N     +   F      V F G +  S+  SS+ 
Sbjct: 365 EVTG-MPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLGSAWLSSNP 423

Query: 189 -----------------------------SSSACAPHSSTQ-LDLGSIWSG--MSSLDKD 216
                                         S+  A  S T     G+ W G  + S+  +
Sbjct: 424 VPPSRARMMSNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFSTGNFWFGDTLPSVGSE 483

Query: 217 EGLGDSPSFDASPVNPSSIWS-YPPVSSTS-----PSGSISGSRQ 255
           +   DSP+FD+ P +  +IW+ + PV+  S     PSG++   R+
Sbjct: 484 DLTVDSPAFDSLPTSAQTIWTPFEPVNPLSGFGSDPSGNMKTQRR 528




RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms.
Mus musculus (taxid: 10090)
>sp|Q5U5Q3|MEX3C_HUMAN RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Homo sapiens GN=MEX3C PE=1 SV=3 Back     alignment and function description
>sp|Q69Z36|MEX3B_MOUSE RNA-binding protein MEX3B OS=Mus musculus GN=Mex3b PE=2 SV=2 Back     alignment and function description
>sp|A1L3F4|MEX3B_XENLA RNA-binding protein MEX3B OS=Xenopus laevis GN=mex3b PE=2 SV=1 Back     alignment and function description
>sp|Q6ZN04|MEX3B_HUMAN RNA-binding protein MEX3B OS=Homo sapiens GN=MEX3B PE=1 SV=1 Back     alignment and function description
>sp|A1L020|MEX3A_HUMAN RNA-binding protein MEX3A OS=Homo sapiens GN=MEX3A PE=1 SV=1 Back     alignment and function description
>sp|Q86XN8|MEX3D_HUMAN RNA-binding protein MEX3D OS=Homo sapiens GN=MEX3D PE=1 SV=3 Back     alignment and function description
>sp|Q3UE17|MEX3D_MOUSE RNA-binding protein MEX3D OS=Mus musculus GN=Mex3d PE=2 SV=2 Back     alignment and function description
>sp|Q8JHV9|BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis GN=birc7-a PE=1 SV=1 Back     alignment and function description
>sp|A9ULZ2|BIR7B_XENLA Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis GN=birc7-b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
219522040428 mex-3 protein [Tribolium castaneum] gi|2 0.866 0.665 0.578 2e-85
270002843410 hypothetical protein TcasGA2_TC001207 [T 0.866 0.695 0.578 3e-85
66510891425 PREDICTED: RNA-binding protein MEX3B-lik 0.869 0.672 0.550 1e-80
350414446425 PREDICTED: RNA-binding protein MEX3B-lik 0.869 0.672 0.550 1e-80
340715365425 PREDICTED: RNA-binding protein MEX3B-lik 0.869 0.672 0.550 1e-80
380020079425 PREDICTED: RNA-binding protein MEX3B-lik 0.869 0.672 0.544 2e-79
383860805418 PREDICTED: RNA-binding protein MEX3B-lik 0.857 0.674 0.549 4e-79
332022800422 RNA-binding protein MEX3A [Acromyrmex ec 0.838 0.654 0.548 1e-75
345483953 444 PREDICTED: RNA-binding protein MEX3B-lik 0.875 0.648 0.495 1e-74
322797035326 hypothetical protein SINV_16493 [Solenop 0.875 0.883 0.556 1e-74
>gi|219522040|ref|NP_001137201.1| mex-3 protein [Tribolium castaneum] gi|218464687|emb|CAM28380.2| KH domain protein [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  322 bits (824), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 187/323 (57%), Positives = 220/323 (68%), Gaps = 38/323 (11%)

Query: 13  GCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRK--- 69
           GCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVA+AKREILSAA+HFS +RASRK   
Sbjct: 108 GCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAKAKREILSAAEHFSQIRASRKNNL 167

Query: 70  ----SGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRD 125
               SGA +P  PP  +PGHVTI+VRVPY+VVGLVVGPKGATIKRIQHQT+TYIVTPSRD
Sbjct: 168 AGLGSGASTPPGPPANIPGHVTIQVRVPYRVVGLVVGPKGATIKRIQHQTHTYIVTPSRD 227

Query: 126 KEPVFEVTGNFPEGPGFESHHGQKIVFILTSN-----------------LYSFFDCRIFQ 168
           KEPVFEVTG  PE         +  + + T N                 LY      I  
Sbjct: 228 KEPVFEVTG-LPESVESARREIEAHIAMRTGNGASMGLGGLDDGDLFSSLYKSGLSSILN 286

Query: 169 RMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDAS 228
            +    F  +   + +SS S SS+ +  SS   DLG+IW   SS ++DEGLGDSPSFD+S
Sbjct: 287 YIEPEQFPMTGSSTFSSSGSCSSSSS--SSGGRDLGAIW---SSSERDEGLGDSPSFDSS 341

Query: 229 PVNPSSIWSYPPVS------STSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAE 282
               SSIWSYPPV+      STSP+ S+ GS +C +C + +VTHAL+PCGHNFFC ECA 
Sbjct: 342 -TALSSIWSYPPVAPSRPSNSTSPADSLLGSAKCLVCGEAKVTHALVPCGHNFFCMECAN 400

Query: 283 RTCD-FDRTCPMCRVPVNQAMRI 304
           R CD  +  CP+C +P  QA+RI
Sbjct: 401 RVCDGTEAQCPVCSLPAIQAIRI 423




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270002843|gb|EEZ99290.1| hypothetical protein TcasGA2_TC001207 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|66510891|ref|XP_623265.1| PREDICTED: RNA-binding protein MEX3B-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350414446|ref|XP_003490320.1| PREDICTED: RNA-binding protein MEX3B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715365|ref|XP_003396185.1| PREDICTED: RNA-binding protein MEX3B-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380020079|ref|XP_003693924.1| PREDICTED: RNA-binding protein MEX3B-like [Apis florea] Back     alignment and taxonomy information
>gi|383860805|ref|XP_003705879.1| PREDICTED: RNA-binding protein MEX3B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332022800|gb|EGI63073.1| RNA-binding protein MEX3A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345483953|ref|XP_001604798.2| PREDICTED: RNA-binding protein MEX3B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|322797035|gb|EFZ19349.1| hypothetical protein SINV_16493 [Solenopsis invicta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query329
UNIPROTKB|F1N0W7516 MEX3C "Uncharacterized protein 0.379 0.242 0.812 6.5e-68
UNIPROTKB|Q5U5Q3659 MEX3C "RNA-binding E3 ubiquiti 0.379 0.189 0.812 6.5e-68
MGI|MGI:2652843652 Mex3c "mex3 homolog C (C. eleg 0.379 0.191 0.812 6.5e-68
RGD|1309023511 Mex3c "mex-3 homolog C (C. ele 0.379 0.244 0.812 6.5e-68
UNIPROTKB|D4A2R5464 Mex3c "Protein Mex3c" [Rattus 0.379 0.269 0.812 6.5e-68
UNIPROTKB|F1PAZ0621 MEX3C "Uncharacterized protein 0.379 0.201 0.812 8.3e-68
UNIPROTKB|J9P0S0414 MEX3C "Uncharacterized protein 0.379 0.301 0.812 8.3e-68
UNIPROTKB|I3LE70387 MEX3C "Uncharacterized protein 0.379 0.322 0.812 1.3e-67
ZFIN|ZDB-GENE-030131-2628 537 mex3b "mex-3 homolog B (C. ele 0.455 0.279 0.670 6.4e-66
MGI|MGI:1918252 601 Mex3b "mex3 homolog B (C. eleg 0.398 0.217 0.779 1.4e-64
UNIPROTKB|F1N0W7 MEX3C "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 507 (183.5 bits), Expect = 6.5e-68, Sum P(3) = 6.5e-68
 Identities = 104/128 (81%), Positives = 113/128 (88%)

Query:    13 GCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASR-KSG 71
             GCKIKALRAKTNTYIKTPVRGEEP+FVVTGRKEDVA AKREILSAA+HFS +RASR K+G
Sbjct:   109 GCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASRNKNG 168

Query:    72 -ALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVF 130
              AL  LS    +PG  T++VRVPY+VVGLVVGPKGATIKRIQ QT+TYIVTPSRDKEPVF
Sbjct:   169 PALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDKEPVF 228

Query:   131 EVTGNFPE 138
             EVTG  PE
Sbjct:   229 EVTG-MPE 235


GO:0043231 "intracellular membrane-bounded organelle" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
UNIPROTKB|Q5U5Q3 MEX3C "RNA-binding E3 ubiquitin-protein ligase MEX3C" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2652843 Mex3c "mex3 homolog C (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309023 Mex3c "mex-3 homolog C (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2R5 Mex3c "Protein Mex3c" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAZ0 MEX3C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P0S0 MEX3C "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|I3LE70 MEX3C "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2628 mex3b "mex-3 homolog B (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1918252 Mex3b "mex3 homolog B (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-11
smart0032268 smart00322, KH, K homology RNA-binding domain 1e-10
pfam0001359 pfam00013, KH_1, KH domain 3e-10
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 4e-10
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 6e-07
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 2e-06
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 8e-06
smart0032268 smart00322, KH, K homology RNA-binding domain 2e-05
pfam1301442 pfam13014, KH_3, KH domain 3e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-05
pfam0001359 pfam00013, KH_1, KH domain 6e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 7e-05
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 9e-05
cd0240968 cd02409, KH-II, KH-II (K homology RNA-binding doma 0.001
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 0.003
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 0.003
smart0018440 smart00184, RING, Ring finger 0.004
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
 Score = 57.8 bits (140), Expect = 2e-11
 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%)

Query: 253 SRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQ 300
              C +C +R      +PCGH   C ECA+R     + CP+CR P+  
Sbjct: 2   DDLCVICLERPRNVVFLPCGHLCLCEECAKR-LRSKKKCPICRQPIES 48


Length = 49

>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|239092 cd02409, KH-II, KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 329
KOG2113|consensus394 99.97
KOG1676|consensus600 99.9
KOG1676|consensus 600 99.88
KOG2191|consensus402 99.86
KOG2193|consensus584 99.76
KOG2193|consensus584 99.74
KOG2190|consensus 485 99.72
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.67
PRK13763180 putative RNA-processing protein; Provisional 99.6
KOG2192|consensus390 99.57
KOG2192|consensus390 99.57
KOG2113|consensus 394 99.33
KOG2190|consensus485 99.25
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.22
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.21
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.17
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.16
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.15
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.12
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.11
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.08
PF1301443 KH_3: KH domain 99.07
KOG2191|consensus402 99.07
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.06
KOG4172|consensus62 99.04
PF1301443 KH_3: KH domain 99.02
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.01
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.0
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.93
KOG4265|consensus349 98.88
KOG0317|consensus293 98.78
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.77
KOG0823|consensus 230 98.77
smart0032269 KH K homology RNA-binding domain. 98.76
smart0032269 KH K homology RNA-binding domain. 98.75
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.75
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 98.74
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.65
PHA02929238 N1R/p28-like protein; Provisional 98.65
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.6
KOG0287|consensus 442 98.59
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.53
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.52
KOG0320|consensus187 98.51
PRK13763180 putative RNA-processing protein; Provisional 98.49
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.47
KOG2279|consensus 608 98.43
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.43
PHA02926242 zinc finger-like protein; Provisional 98.35
PF1463444 zf-RING_5: zinc-RING finger domain 98.33
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.29
KOG2208|consensus753 98.24
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.22
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.22
KOG1571|consensus355 98.21
KOG2177|consensus 386 98.21
KOG4275|consensus350 98.19
PRK08406140 transcription elongation factor NusA-like protein; 98.19
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.13
COG1094194 Predicted RNA-binding protein (contains KH domains 98.13
KOG2164|consensus 513 98.1
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.07
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.06
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.0
KOG0978|consensus698 97.97
KOG0119|consensus554 97.94
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.89
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.86
KOG0824|consensus 324 97.83
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 97.81
KOG0311|consensus 381 97.73
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 97.72
KOG0336|consensus 629 97.71
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.7
KOG1588|consensus259 97.7
KOG4159|consensus 398 97.69
KOG1785|consensus 563 97.68
KOG0802|consensus 543 97.66
KOG1100|consensus207 97.56
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.54
KOG4628|consensus348 97.51
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 97.36
COG1094194 Predicted RNA-binding protein (contains KH domains 97.36
KOG2208|consensus 753 97.36
KOG2879|consensus298 97.35
KOG2814|consensus345 97.32
COG0195190 NusA Transcription elongation factor [Transcriptio 97.21
KOG1588|consensus259 97.17
KOG4692|consensus489 97.13
KOG2279|consensus608 97.12
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.11
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 97.03
COG5152259 Uncharacterized conserved protein, contains RING a 96.98
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.95
KOG0336|consensus 629 96.88
COG5176269 MSL5 Splicing factor (branch point binding protein 96.88
PRK12328374 nusA transcription elongation factor NusA; Provisi 96.86
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 96.86
TIGR01953341 NusA transcription termination factor NusA. This m 96.83
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.82
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.76
COG5222427 Uncharacterized conserved protein, contains RING Z 96.76
PRK12327362 nusA transcription elongation factor NusA; Provisi 96.73
KOG0297|consensus 391 96.72
KOG1813|consensus313 96.67
KOG1039|consensus344 96.58
PRK09202470 nusA transcription elongation factor NusA; Validat 96.58
KOG2660|consensus 331 96.54
KOG0119|consensus 554 96.5
COG5176269 MSL5 Splicing factor (branch point binding protein 96.47
PRK12329449 nusA transcription elongation factor NusA; Provisi 96.45
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 96.32
KOG0828|consensus636 96.24
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 96.19
KOG0804|consensus 493 96.18
PRK12704520 phosphodiesterase; Provisional 95.99
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 95.9
PRK0046875 hypothetical protein; Provisional 95.69
PRK0282177 hypothetical protein; Provisional 95.65
PRK12704520 phosphodiesterase; Provisional 95.61
KOG4367|consensus 699 95.59
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.59
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 95.42
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 95.39
KOG2814|consensus345 95.38
KOG1734|consensus328 95.32
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 95.27
KOG3002|consensus 299 95.26
KOG0825|consensus 1134 95.17
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 95.16
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 95.14
KOG1002|consensus 791 95.1
COG183776 Predicted RNA-binding protein (contains KH domain) 95.07
PRK00106535 hypothetical protein; Provisional 95.05
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 94.92
PRK0106478 hypothetical protein; Provisional 94.85
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 94.78
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 94.75
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 94.73
PRK00106535 hypothetical protein; Provisional 94.6
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 94.56
KOG1001|consensus 674 94.53
KOG0827|consensus 465 94.35
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 94.16
KOG3039|consensus303 94.15
KOG3800|consensus 300 94.01
PRK0046875 hypothetical protein; Provisional 93.8
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 93.78
COG52191525 Uncharacterized conserved protein, contains RING Z 93.69
PRK0282177 hypothetical protein; Provisional 93.57
PF04641260 Rtf2: Rtf2 RING-finger 93.48
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 93.46
KOG1645|consensus 463 93.45
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 93.41
PRK08406140 transcription elongation factor NusA-like protein; 93.34
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 93.31
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.16
KOG4739|consensus 233 92.96
COG183776 Predicted RNA-binding protein (contains KH domain) 92.89
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 92.79
PRK12705508 hypothetical protein; Provisional 92.11
KOG4185|consensus 296 91.88
KOG0826|consensus357 91.88
KOG3273|consensus252 91.69
PRK0106478 hypothetical protein; Provisional 91.68
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 91.55
KOG1814|consensus 445 91.23
PRK12705508 hypothetical protein; Provisional 91.09
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 91.01
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 91.0
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 90.9
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 90.84
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 90.78
KOG2932|consensus 389 90.75
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.74
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 90.3
COG1855604 ATPase (PilT family) [General function prediction 89.9
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 89.7
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 89.31
KOG4362|consensus 684 89.28
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 88.62
PHA02825162 LAP/PHD finger-like protein; Provisional 88.23
COG1782 637 Predicted metal-dependent RNase, consists of a met 88.13
KOG3579|consensus352 87.95
PRK13764602 ATPase; Provisional 87.85
KOG4369|consensus 2131 87.7
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 86.91
KOG4369|consensus 2131 86.79
KOG1493|consensus84 86.45
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 86.33
KOG1428|consensus 3738 86.17
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 85.04
PF10272358 Tmpp129: Putative transmembrane protein precursor; 84.9
cd02412109 30S_S3_KH K homology RNA-binding (KH) domain of th 84.72
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 84.68
PHA03096284 p28-like protein; Provisional 84.6
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 84.29
PRK06418166 transcription elongation factor NusA-like protein; 84.0
PRK06418166 transcription elongation factor NusA-like protein; 83.73
KOG2930|consensus114 83.72
KOG2874|consensus356 83.64
KOG3161|consensus 861 82.83
PHA02862156 5L protein; Provisional 82.67
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 81.63
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 81.14
cd0241185 archeal_30S_S3_KH K homology RNA-binding domain (K 80.45
KOG1067|consensus760 80.22
>KOG2113|consensus Back     alignment and domain information
Probab=99.97  E-value=3.1e-32  Score=252.61  Aligned_cols=289  Identities=35%  Similarity=0.374  Sum_probs=200.1

Q ss_pred             eeeeeecCCChHHHHHHHHhCCeEEecCCCCcceEEEecCHHHHHHHHHHHHHHhhhhhHhhhcccCCCCCCCCCCCCCC
Q psy3263           4 FVVPSINPFGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVP   83 (329)
Q Consensus         4 ~VG~IIGkgG~~Ik~Lr~~Tga~I~ip~~~~ervi~ItG~~e~v~~A~~~I~~i~e~~~~~~~~~~~~~~~~~~~p~~~~   83 (329)
                      +|+.|+|+||++||.||+||++||+.|.++++++|.|+|.+|+|++|+++|.+.+|||...++.+...++....   ..+
T Consensus        36 ~v~~ivg~qg~kikalr~KTqtyi~tPsr~eePiF~vTg~~edv~~aRrei~saaeH~~l~~~s~s~Sgg~~~~---s~s  112 (394)
T KOG2113|consen   36 HVAEIVGRQGCKIKALRAKTQTYIKTPSRGEEPIFPVTGRHEDVRRARREIPSAAEHFGLIRASRSFSGGTNGA---SAS  112 (394)
T ss_pred             cceeecccCccccchhhhhhcceeccCCCCCCCcceeccCchhHHHHhhcCccccceeeeeeecccccCCCccc---ccc
Confidence            69999999999999999999999999999999999999999999999999999999999999999888776542   357


Q ss_pred             CceEEEEEecCcccceeecCCCchHHHHHHhcCceEEcCCCCCCCeEEEECCCCCCc-------chhhhhh----hhhh-
Q psy3263          84 GHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPEGP-------GFESHHG----QKIV-  151 (329)
Q Consensus        84 g~~t~~i~VP~~~vG~IIGkgG~tIk~Iq~~tga~I~ip~~~~e~~i~ItG~~pe~v-------eie~~i~----d~~~-  151 (329)
                      ++.+.++.+|.++||+++|.+|++||+||+.++.+|..|.++.++++.++| .|++|       |||+++.    |+|. 
T Consensus       113 ~qt~sy~svP~rvvglvv~~~~~ti~~iqq~tnt~I~T~v~~~~~Vf~Vtg-~~~nC~kra~s~eie~ta~~ra~~i~d~  191 (394)
T KOG2113|consen  113 GQTTSYVSVPLRVVGLVVGPKGATIKRIQQFTNTYIATPVRCGEPVFCVTG-APKNCVKRARSCEIEQTAVTRAGQIHDT  191 (394)
T ss_pred             CCCceeeeccceeeeeccccccCccchheecccceEeeeccCCCceEEEec-CCcchhhhccccchhhhhhhhhhccccC
Confidence            889999999999999999999999999999999999999999999999999 99996       8888776    3333 


Q ss_pred             ------hhhcCCCCCCcccc-------cccccccC-----ccCCCC-CCCCCCCCCCC---CCCCCCCCCCCCCcceecC
Q psy3263         152 ------FILTSNLYSFFDCR-------IFQRMNHH-----VFSGSS-GCSSASSSSSS---SACAPHSSTQLDLGSIWSG  209 (329)
Q Consensus       152 ------~~~~~~~~~~~~~~-------~~~~~~~~-----~~~~~~-~~~~~~~~~~~---~~~~~~~~~~~~~~~~~~~  209 (329)
                            ..-+-.+.=++...       .||+.||-     +..... +..+.+.||..   .+..+     -....+|..
T Consensus       192 dndf~~~la~v~l~v~~~~~a~~~~~~~~~~s~f~~~~~~n~~~~~~~~~sss~~~~~s~~~~~~~-----~~~~~~~~s  266 (394)
T KOG2113|consen  192 DNDFAGQLAGVSLMVQKQQQAQQQMQEAQQQSMFYRRAFGNSNPFNQKEMSSSPFGMESSLGLDAL-----LRSFPSMRS  266 (394)
T ss_pred             CccccccccccchhhhhHHHHHHHHhhcCccchHHHhcccCCCccchhhccCCCcccccccccccc-----hhhhhhhhc
Confidence                  22221111122111       22222331     000000 00011111110   00001     123445554


Q ss_pred             CCCCCCCCCCCCCCCcCCC------CCCCCccccCCCC---------------------------CCCCCCCCCCCCccc
Q psy3263         210 MSSLDKDEGLGDSPSFDAS------PVNPSSIWSYPPV---------------------------SSTSPSGSISGSRQC  256 (329)
Q Consensus       210 ~~~~~~~~~~~~w~~~~~~------~~~~~~~~~~~~~---------------------------sp~~~~~~l~~~~~C  256 (329)
                      ....+.++|.+++.+....      +.++...|..-+.                           .--.+++-|-..+.|
T Consensus       267 s~t~~~~~g~g~s~~~~~~~~~~~~~~~~~~~~~~~~s~~~i~~~e~~s~~~~~~~a~~~~~l~~~~~~~~~~~~s~~~~  346 (394)
T KOG2113|consen  267 SLTPESLSGTGLSRPSLGGGQSAKQDLPTYDYWGTNNSLNDIMENEILSRKYDALSAWSSMGLEKREESPTNGLMSSLKG  346 (394)
T ss_pred             cCCcccccccCCCccccCCccccccCCCcCCccccCcchhhhhhhhhhhhhcchhhccccccchhccccccccchhhccc
Confidence            3333445555444333222      1223333332110                           001123445567899


Q ss_pred             ccccccCcccEEeCCCChhccHhhHHhhcCCCCCCcccccccccchh
Q psy3263         257 YLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMR  303 (329)
Q Consensus       257 ~IC~e~~~~~~~lpCgH~~fC~~Cl~~~~~~~~~CP~Cr~~i~~~~~  303 (329)
                      .+|-+.....++.+|+|++||.+|+..  .....||+|.......++
T Consensus       347 ~~~~~~~~st~~~~~~~n~~~~~~a~~--s~~~~~~~c~~~~~~~~~  391 (394)
T KOG2113|consen  347 TSAGFGLLSTIWSGGNMNLSPGSLASA--SASPTSSTCDHNDHTLVP  391 (394)
T ss_pred             ccccCceeeeEeecCCcccChhhhhhc--ccCCccccccccceeeee
Confidence            999999999999999999999999982  236899999876654443



>KOG1676|consensus Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>PRK06418 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>PRK06418 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG2874|consensus Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>cd02411 archeal_30S_S3_KH K homology RNA-binding domain (KH) of the archaeal 30S small ribosomal subunit S3 protein Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
2dgr_A83 Solution Structure Of The Second Kh Domain In Ring 2e-17
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 2e-05
4auq_B62 Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 4e-05
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 1e-04
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 4e-04
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 6e-04
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 7e-04
>pdb|2DGR|A Chain A, Solution Structure Of The Second Kh Domain In Ring Finger And Kh Domain Containing Protein 1 Length = 83 Back     alignment and structure

Iteration: 1

Score = 86.7 bits (213), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 43/54 (79%), Positives = 47/54 (87%), Gaps = 1/54 (1%) Query: 85 HVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGNFPE 138 TI+VRVPY+VVGLVVGPKGATIKRIQ +T+TYIVTP RDKEPVF VTG PE Sbjct: 9 QTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTG-MPE 61
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|4AUQ|B Chain B, Structure Of Birc7-Ubch5b-Ub Complex. Length = 62 Back     alignment and structure
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query329
2dgr_A83 Ring finger and KH domain-containing protein 1; st 6e-25
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-12
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 5e-23
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 6e-09
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 1e-21
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-07
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 2e-04
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 2e-19
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 8e-09
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-19
1j4w_A174 FUSE binding protein; single-stranded DNA binding 2e-08
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 2e-13
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 5e-07
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 5e-13
2ea5_A68 Cell growth regulator with ring finger domain prot 3e-12
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-12
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-08
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 5e-12
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 6e-12
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 8e-04
1x4m_A94 FAR upstream element binding protein 1; KH domain, 7e-12
1x4m_A94 FAR upstream element binding protein 1; KH domain, 7e-04
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 2e-11
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 5e-07
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 5e-11
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-08
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 8e-11
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 1e-10
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 2e-10
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 8e-04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 3e-10
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 1e-09
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 2e-05
1x4n_A92 FAR upstream element binding protein 1; KH domain, 6e-09
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 6e-09
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 3e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 2e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-08
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 1e-07
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 1e-07
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 2e-07
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 3e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 4e-07
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 4e-07
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 5e-05
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 7e-07
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 7e-07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 8e-07
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-06
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 2e-06
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 2e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-06
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 3e-06
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-05
1we8_A104 Tudor and KH domain containing protein; structural 2e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-05
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-05
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 6e-05
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 7e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 8e-05
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 1e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 3e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 4e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 5e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 5e-04
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 6e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 8e-04
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
 Score = 95.4 bits (237), Expect = 6e-25
 Identities = 42/57 (73%), Positives = 46/57 (80%)

Query: 78  PPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTG 134
                 G  TI+VRVPY+VVGLVVGPKGATIKRIQ +T+TYIVTP RDKEPVF VTG
Sbjct: 2   SSGSSGGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTG 58


>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.9
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.9
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.9
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.89
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.89
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.74
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.71
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.62
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.6
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.48
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.46
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.36
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.33
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.32
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.31
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.31
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.31
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.3
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.3
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.29
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.29
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.29
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.29
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.28
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.28
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.28
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.28
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.27
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.27
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.27
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.27
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.26
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.26
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.25
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.25
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.25
1we8_A104 Tudor and KH domain containing protein; structural 99.25
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.25
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.25
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.24
2ea5_A68 Cell growth regulator with ring finger domain prot 99.24
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.23
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.23
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.23
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.22
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.22
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.22
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.21
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.21
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.2
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.19
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.18
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.18
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.18
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.17
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.17
1we8_A104 Tudor and KH domain containing protein; structural 99.16
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.15
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.15
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.13
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.13
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.13
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.12
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.11
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.11
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.09
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.09
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.08
2ect_A78 Ring finger protein 126; metal binding protein, st 99.08
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.07
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.07
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.04
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.04
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.03
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.02
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.02
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.02
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.01
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.01
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.01
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.0
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.0
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.99
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.98
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.98
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 98.97
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.96
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.96
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.95
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.95
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.95
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.94
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 98.94
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.93
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.92
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.92
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.91
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.9
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.87
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.85
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.84
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.84
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.83
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.83
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 98.82
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.79
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.78
3n89_A376 Defective in GERM LINE development protein 3, ISO; 98.78
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.77
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.76
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.75
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.74
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.73
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.7
2cpq_A91 FragIle X mental retardation syndrome related prot 98.69
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.68
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.65
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.59
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.58
2cpq_A91 FragIle X mental retardation syndrome related prot 98.58
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.56
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 98.52
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.51
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.5
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.45
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.39
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.23
1tua_A191 Hypothetical protein APE0754; structural genomics, 98.23
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.18
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.16
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.14
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.04
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.97
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 97.87
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.82
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.67
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.66
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.39
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 97.21
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.83
2asb_A251 Transcription elongation protein NUSA; protein-RNA 96.73
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 96.62
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 96.55
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 96.45
1hh2_P344 NUSA, N utilization substance protein A; transcrip 95.64
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 95.63
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 94.94
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.52
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 94.07
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 92.47
3nw0_A238 Non-structural maintenance of chromosomes element 91.46
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 90.57
2cxc_A144 NUSA; transcription termination, RNA binding prote 89.51
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 83.46
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
Probab=99.90  E-value=5e-25  Score=193.26  Aligned_cols=144  Identities=24%  Similarity=0.275  Sum_probs=108.5

Q ss_pred             eeeeeecCCChHHHHHHHHhCCeEEecCCC------CcceEEEecCHHHHHHHHHHHHHHhhhhhHhhhcccCCCCCCCC
Q psy3263           4 FVVPSINPFGCKIKALRAKTNTYIKTPVRG------EEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLS   77 (329)
Q Consensus         4 ~VG~IIGkgG~~Ik~Lr~~Tga~I~ip~~~------~ervi~ItG~~e~v~~A~~~I~~i~e~~~~~~~~~~~~~~~~~~   77 (329)
                      +||.||||+|++||+||++|||+|+++..+      .+|+|+|+|.+++|++|+.+|.+++..+....+... . .....
T Consensus        16 ~ig~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~~~~~er~v~I~G~~~~v~~A~~~I~~~~~~~~~~~~~~~-~-~~~~~   93 (178)
T 2anr_A           16 AAGSIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQNVAKTE-P-VSILQ   93 (178)
T ss_dssp             HHHHHHCGGGHHHHHHHHHHCCEEEECCTTCBCTTSSEEEEEEEECHHHHHHHHHHHHHHHTCCCCC-------------
T ss_pred             HeeeeECCCcHHHHHHHHHhCCeEEEecCCCCCCCCCCceEEEEeCHHHHHHHHHHHHHHHhccCCccccCC-c-ccccC
Confidence            579999999999999999999999998643      378999999999999999999998642211000000 0 00000


Q ss_pred             C--CCCCCCceEEEEEecCcccceeecCCCchHHHHHHhcCceEEcCCCC-----CCCeEEEECCCCCCcch-hhhhhhh
Q psy3263          78 P--PTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRD-----KEPVFEVTGNFPEGPGF-ESHHGQK  149 (329)
Q Consensus        78 ~--p~~~~g~~t~~i~VP~~~vG~IIGkgG~tIk~Iq~~tga~I~ip~~~-----~e~~i~ItG~~pe~vei-e~~i~d~  149 (329)
                      +  ..+.....+.++.||.+++|.||||+|++||+|+++|||+|++++.+     .++.|+|+| .+++|+. ..+|.+.
T Consensus        94 ~~~~~~~~~~~~~~i~Vp~~~vg~iIGkgG~~Ik~i~~~tga~I~i~~~~~~~~~~~~~v~I~G-~~~~v~~A~~~I~~~  172 (178)
T 2anr_A           94 PQTTVNPDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQNRVVTVSG-EPEQNRKAVELIIQK  172 (178)
T ss_dssp             ------CGGGGEEEEEEEHHHHHHHHCGGGHHHHHHHHHSSCEEEECCCC----CCEEEEEEES-SHHHHHHHHHHHHHH
T ss_pred             CccCCCCCCceEEEEEEchhheeeeECCCcHHHHHHHHHHCCEEEEeCCCCCCCCCceEEEEEc-CHHHHHHHHHHHHHH
Confidence            0  00123457899999999999999999999999999999999998764     468999999 9998833 3366554


Q ss_pred             h
Q psy3263         150 I  150 (329)
Q Consensus       150 ~  150 (329)
                      +
T Consensus       173 i  173 (178)
T 2anr_A          173 I  173 (178)
T ss_dssp             H
T ss_pred             H
Confidence            4



>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 329
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 6e-12
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 2e-08
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 7e-11
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 6e-10
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 3e-05
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 9e-10
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 9e-07
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 9e-10
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 2e-05
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 1e-09
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 6e-04
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-09
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-09
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 9e-06
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 8e-09
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 0.001
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 2e-08
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 2e-08
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 4e-08
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 3e-04
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 5e-08
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 8e-08
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 4e-05
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-07
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 6e-04
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-07
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 3e-07
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 8e-04
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 4e-07
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 1e-06
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 1e-06
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 4e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 2e-06
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 8e-06
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 1e-05
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 8e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 2e-04
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 2e-04
d2bl5a1134 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {Afric 3e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 4e-04
d1k1ga_122 d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo s 5e-04
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 0.002
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 0.004
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Vigilin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 58.6 bits (142), Expect = 6e-12
 Identities = 12/51 (23%), Positives = 23/51 (45%), Gaps = 1/51 (1%)

Query: 86  VTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSR-DKEPVFEVTGN 135
            +  V +P +    V+G  G  ++ ++ +T T I  P   D     ++TG 
Sbjct: 10  ASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGT 60


>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 134 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query329
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.45
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.43
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.4
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.4
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.39
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.39
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.39
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.38
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.38
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.37
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.36
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.35
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.34
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.34
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.32
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.31
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.29
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.29
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.28
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.24
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.17
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.16
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.14
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.13
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.1
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.05
d2cpqa178 Fragile X mental retardation syndrome related prot 99.05
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.98
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.98
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.96
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.95
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.95
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.94
d2cpqa178 Fragile X mental retardation syndrome related prot 98.93
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.91
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.91
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.9
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.85
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.83
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.76
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.73
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.72
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.71
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.7
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.66
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.58
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.56
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.56
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.43
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 98.41
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.32
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.23
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 98.22
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 97.98
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.72
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.53
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 97.49
d1hh2p368 Transcription factor NusA, C-terminal domains {The 94.45
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.18
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 90.79
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 88.48
d1egaa2113 GTPase Era C-terminal domain {Escherichia coli [Ta 82.27
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 80.97
d2uubc1105 Ribosomal protein S3 N-terminal domain {Thermus th 80.89
d1hh2p368 Transcription factor NusA, C-terminal domains {The 80.5
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 80.19
d2asba367 Transcription factor NusA, C-terminal domains {Myc 80.17
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: HnRNP K, KH3
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.45  E-value=3.3e-14  Score=105.69  Aligned_cols=59  Identities=20%  Similarity=0.332  Sum_probs=53.2

Q ss_pred             eeeeeecCCChHHHHHHHHhCCeEEecCCCC---cceEEEecCHHHHHHHHHHHHHHhhhhh
Q psy3263           4 FVVPSINPFGCKIKALRAKTNTYIKTPVRGE---EPVFVVTGRKEDVARAKREILSAADHFS   62 (329)
Q Consensus         4 ~VG~IIGkgG~~Ik~Lr~~Tga~I~ip~~~~---ervi~ItG~~e~v~~A~~~I~~i~e~~~   62 (329)
                      +||.||||+|++||+||++|||+|+++...+   +++|+|+|++++|++|+.+|.++++.|+
T Consensus        14 ~vg~iIG~~G~~I~~I~~~sga~I~i~~~~~~~~~r~i~I~G~~~~v~~A~~~I~~~i~e~S   75 (75)
T d1zzka1          14 LAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQYS   75 (75)
T ss_dssp             TGGGGTCGGGHHHHHHHHHHCCEEEECCTTSCSSEEEEEEEECHHHHHHHHHHHHHHHHHHH
T ss_pred             hcCeeECCCCchHHHHHhhcCCeEEEccCCCCCCceEEEEEeCHHHHHHHHHHHHHHHHhcC
Confidence            6899999999999999999999999974433   7899999999999999999999987664



>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uubc1 d.52.3.1 (C:2-106) Ribosomal protein S3 N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure