Psyllid ID: psy3287

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--

MVLGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYNFPSSF

cccccccEEEEEEccccccccccccccccccccEEEEEEcccEEEEEcccccEEEEEEcccccccccccccccccccEEEEcccccccEEEEccccccccEEEEEEEEcccccEEEEccccc

ccccccEEEEEcccccccccccccccccccEEEEEEEEEcccEEEEEcccccEEEEEEEccccccccccccccccHHEEEHHHHcccccEEEcccccccEEEEEEEEEccccEEEEEEcccc

mvlgstqrltfahkggrnltddplaagipsyvtQEEFsryqgywwqpkttgstqrltfahkggrnltddplaagipsyvtQEEFsryqgywwqpkttdgVYRILYEEidesdvkiynfpssf

MVLGSTQRLTFahkggrnltddplaAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFsryqgywwqpktTDGVYRILYEeidesdvkiynfpssf

MVLGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYNFPSSF

*********************DPLAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYN*****

*****TQRLTFA*KG***LTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYNFPS**

MVLGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYNFPSSF

***GSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYNFPSS*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVLGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYNFPSSF

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		122	2.2.26 [Sep-21-2011]
Q80YA7		892	Dipeptidyl peptidase 8 OS	yes	N/A	0.819	0.112	0.385	2e-13
Q6V1X1		898	Dipeptidyl peptidase 8 OS	yes	N/A	0.819	0.111	0.394	5e-13
Q86TI2		863	Dipeptidyl peptidase 9 OS	no	N/A	0.795	0.112	0.396	1e-10
Q8BVG4		862	Dipeptidyl peptidase 9 OS	no	N/A	0.795	0.112	0.367	7e-09

>sp\|Q80YA7\|DPP8_MOUSE Dipeptidyl peptidase 8 OS=Mus musculus GN=Dpp8 PE=1 SV=1	Back alignment and function desciption

 Score = 73.9 bits (180), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 59/109 (54%), Gaps = 9/109 (8%)

Query: 18  NLTDDP-LAAGIPSYVTQEEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIP 76
           N+  DP L    P ++    F      W     T   +R+T+ H    N+ +DP +AG+ 
Sbjct: 207 NIRMDPKLCPADPDWIA---FIHSNDIWISNLVTREERRITYVHNELANMEEDPRSAGVA 263

Query: 77  SYVTQEEFSRYQGYWWQP---KTTDG--VYRILYEEIDESDVKIYNFPS 120
           ++V QEEF RY GYWW P   +T  G  + RILYEE DES+V+I +  S
Sbjct: 264 TFVLQEEFDRYSGYWWCPQAERTPSGGKILRILYEENDESEVEIIHVTS 312

Dipeptidyl peptidase that cleaves off N-terminal dipeptides from proteins having a Pro or Ala residue at position 2. May play a role in T-cell activation and immune function.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 1EC: 4EC: .EC: 5

>sp\|Q6V1X1\|DPP8_HUMAN Dipeptidyl peptidase 8 OS=Homo sapiens GN=DPP8 PE=1 SV=1	Back alignment and function description

>sp\|Q86TI2\|DPP9_HUMAN Dipeptidyl peptidase 9 OS=Homo sapiens GN=DPP9 PE=1 SV=3	Back alignment and function description

>sp\|Q8BVG4\|DPP9_MOUSE Dipeptidyl peptidase 9 OS=Mus musculus GN=Dpp9 PE=2 SV=2	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		122
328697507		850	PREDICTED: dipeptidyl peptidase 9-like [	0.639	0.091	0.725	3e-28
270001891		808	hypothetical protein TcasGA2_TC000792 [T	0.639	0.096	0.705	6e-27
91076698		825	PREDICTED: similar to AGAP003138-PA [Tri	0.639	0.094	0.705	6e-27
307203807		825	Dipeptidyl peptidase 9 [Harpegnathos sal	0.590	0.087	0.763	4e-26
383856012		836	PREDICTED: dipeptidyl peptidase 9 [Megac	0.590	0.086	0.75	4e-26
156538563		860	PREDICTED: dipeptidyl peptidase 9-like i	0.590	0.083	0.722	4e-25
328779353		836	PREDICTED: dipeptidyl peptidase 9-like [	0.590	0.086	0.722	5e-25
322798100		823	hypothetical protein SINV_11474 [Solenop	0.590	0.087	0.753	5e-25
332018479		851	Dipeptidyl peptidase 9 [Acromyrmex echin	0.590	0.084	0.753	6e-25
307175547		843	Dipeptidyl peptidase 9 [Camponotus flori	0.590	0.085	0.739	1e-24

>gi\|328697507\|ref\|XP_001946860.2\| PREDICTED: dipeptidyl peptidase 9-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  128 bits (322), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 58/80 (72%), Positives = 67/80 (83%), Gaps = 2/80 (2%)

Query: 44  WWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPK--TTDGVY 101
           W     TGST+RLT+AHKGGR L+DDPLAAG+PSYV QEEF+RY GYWWQPK    D +Y
Sbjct: 210 WVTHIATGSTKRLTYAHKGGRCLSDDPLAAGVPSYVMQEEFNRYHGYWWQPKQHKEDNIY 269

Query: 102 RILYEEIDESDVKIYNFPSS 121
           RILYEE+DES+VKI+NFPSS
Sbjct: 270 RILYEEVDESEVKIFNFPSS 289

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|270001891\|gb\|EEZ98338.1\| hypothetical protein TcasGA2_TC000792 [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|91076698\|ref\|XP_971949.1\| PREDICTED: similar to AGAP003138-PA [Tribolium castaneum]	Back alignment and taxonomy information

>gi\|307203807\|gb\|EFN82743.1\| Dipeptidyl peptidase 9 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|383856012\|ref\|XP_003703504.1\| PREDICTED: dipeptidyl peptidase 9 [Megachile rotundata]	Back alignment and taxonomy information

>gi\|156538563\|ref\|XP_001607433.1\| PREDICTED: dipeptidyl peptidase 9-like isoform 1 [Nasonia vitripennis] gi\|345491742\|ref\|XP_003426699.1\| PREDICTED: dipeptidyl peptidase 9-like isoform 2 [Nasonia vitripennis] gi\|345491745\|ref\|XP_003426700.1\| PREDICTED: dipeptidyl peptidase 9-like isoform 3 [Nasonia vitripennis]	Back alignment and taxonomy information

>gi\|328779353\|ref\|XP_623859.3\| PREDICTED: dipeptidyl peptidase 9-like [Apis mellifera]	Back alignment and taxonomy information

>gi\|322798100\|gb\|EFZ19939.1\| hypothetical protein SINV_11474 [Solenopsis invicta]	Back alignment and taxonomy information

>gi\|332018479\|gb\|EGI59069.1\| Dipeptidyl peptidase 9 [Acromyrmex echinatior]	Back alignment and taxonomy information

>gi\|307175547\|gb\|EFN65468.1\| Dipeptidyl peptidase 9 [Camponotus floridanus]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		122
FB\|FBgn0039240		1113	CG3744 [Drosophila melanogaste	0.590	0.064	0.611	1.8e-21
ZFIN\|ZDB-GENE-061013-777		885	dpp9 "dipeptidyl-peptidase 9"	0.786	0.108	0.428	1.3e-16
UNIPROTKB\|Q86TI2		863	DPP9 "Dipeptidyl peptidase 9"	0.631	0.089	0.469	7.5e-16
UNIPROTKB\|F1P1L1		855	DPP9 "Uncharacterized protein"	0.631	0.090	0.481	1.5e-15
UNIPROTKB\|I3LM79		584	DPP9 "Uncharacterized protein"	0.573	0.119	0.513	4.4e-15
UNIPROTKB\|I3LUL8		592	DPP9 "Uncharacterized protein"	0.573	0.118	0.513	4.5e-15
UNIPROTKB\|E2R8Z1		891	DPP9 "Uncharacterized protein"	0.631	0.086	0.469	6.9e-15
UNIPROTKB\|F1NMX9		881	DPP8 "Uncharacterized protein"	0.819	0.113	0.422	1.8e-14
UNIPROTKB\|E1BI31		870	DPP9 "Uncharacterized protein"	0.590	0.082	0.487	7.8e-14
UNIPROTKB\|K7GM49		340	DPP8 "Uncharacterized protein"	0.819	0.294	0.385	1.1e-13

FB\|FBgn0039240 CG3744 [Drosophila melanogaster (taxid:7227)]	Back alignment and assigned GO terms

 Score = 264 (98.0 bits), Expect = 1.8e-21, P = 1.8e-21
 Identities = 44/72 (61%), Positives = 57/72 (79%)

Query:    50 TGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEID 109
             +G  +RLT+   G  +  DD L+AG+PSYV QEEFSRYQG+WWQP + DG+YRI+YEE+D
Sbjct:   451 SGHEKRLTYTSTGRHSYVDDALSAGVPSYVMQEEFSRYQGFWWQPHSNDGIYRIVYEEVD 510

Query:   110 ESDVKIYNFPSS 121
             ES+V +Y FPSS
Sbjct:   511 ESEVSVYTFPSS 522

GO:0008239 "dipeptidyl-peptidase activity" evidence=ISS

GO:0006508 "proteolysis" evidence=IEA

GO:0016020 "membrane" evidence=IEA

GO:0008236 "serine-type peptidase activity" evidence=IEA

ZFIN\|ZDB-GENE-061013-777 dpp9 "dipeptidyl-peptidase 9" [Danio rerio (taxid:7955)]	Back alignment and assigned GO terms

UNIPROTKB\|Q86TI2 DPP9 "Dipeptidyl peptidase 9" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1P1L1 DPP9 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LM79 DPP9 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|I3LUL8 DPP9 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R8Z1 DPP9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|F1NMX9 DPP8 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

UNIPROTKB\|E1BI31 DPP9 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|K7GM49 DPP8 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		122
pfam00930		348	pfam00930, DPPIV_N, Dipeptidyl peptidase IV (DPP I	9e-08

>gnl\|CDD\|216201 pfam00930, DPPIV_N, Dipeptidyl peptidase IV (DPP IV) N-terminal region	Back alignment and domain information

 Score = 48.5 bits (116), Expect = 9e-08
 Identities = 18/59 (30%), Positives = 27/59 (45%), Gaps = 8/59 (13%)

Query: 66  LTDDP---LAAGIPSYVTQEE-FSRYQGYWWQPKTTDGVYRILYEEIDESDVKIYNFPS 120
           +T D    +  G+  +V +EE F     YWW P  +    R+ +   DES+V I   P 
Sbjct: 78  ITSDGSNGIFNGLADWVYEEEVFGSNSAYWWSPDGS----RLAFLRFDESEVPIITLPD 132

This family is an alignment of the region to the N-terminal side of the active site. The Prosite motif does not correspond to this Pfam entry. Length = 348

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		122
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	99.88
KOG2281\|consensus		867		99.81
KOG2100\|consensus		755		99.4
KOG2281\|consensus		867		98.78
PRK04043		419	tolB translocation protein TolB; Provisional	97.01
PRK05137		435	tolB translocation protein TolB; Provisional	96.89
PRK03629		429	tolB translocation protein TolB; Provisional	96.86
PRK01029		428	tolB translocation protein TolB; Provisional	96.48
PRK04043		419	tolB translocation protein TolB; Provisional	96.36
PRK03629		429	tolB translocation protein TolB; Provisional	96.25
PRK04922		433	tolB translocation protein TolB; Provisional	96.18
PRK04792		448	tolB translocation protein TolB; Provisional	96.07
PRK04792		448	tolB translocation protein TolB; Provisional	96.04
PRK00178		430	tolB translocation protein TolB; Provisional	95.96
PRK00178		430	tolB translocation protein TolB; Provisional	95.9
PRK05137		435	tolB translocation protein TolB; Provisional	95.78
PRK01029		428	tolB translocation protein TolB; Provisional	95.64
PRK02889		427	tolB translocation protein TolB; Provisional	95.43
PRK02889		427	tolB translocation protein TolB; Provisional	95.39
PRK01742		429	tolB translocation protein TolB; Provisional	95.18
PRK01742		429	tolB translocation protein TolB; Provisional	95.15
PRK04922		433	tolB translocation protein TolB; Provisional	94.98
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	94.64
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	94.4
COG0823		425	TolB Periplasmic component of the Tol biopolymer t	92.64
PF07676		39	PD40: WD40-like Beta Propeller Repeat; InterPro: I	92.44
TIGR02800		417	propeller_TolB tol-pal system beta propeller repea	92.13
COG4946		668	Uncharacterized protein related to the periplasmic	91.67
PF08450		246	SGL: SMP-30/Gluconolaconase/LRE-like region; Inter	91.08
TIGR02171		912	Fb_sc_TIGR02171 Fibrobacter succinogenes paralogou	88.89
PRK13616		591	lipoprotein LpqB; Provisional	88.21
PF00930		353	DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin	87.55
PF14583		386	Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C	87.23

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

Probab=99.88  E-value=1.3e-23  Score=168.76  Aligned_cols=83  Identities=25%  Similarity=0.524  Sum_probs=68.7

Q ss_pred             Ccceece---EEEEEeCCEEEEeCCCCCeeEEeccccCCcccCCCCeeeccCCccchhe-ecccceEEecCCCCCCceEE
Q psy3287          28 IPSYVTQ---EEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEE-FSRYQGYWWQPKTTDGVYRI  103 (122)
Q Consensus        28 v~~f~~~---~aFvr~~nLyv~~~~~~~~~rlT~~~~g~~~v~~~~i~~G~~d~v~eEE-~~~~~g~wWSPd~~~~~~~i  103 (122)
                      .+.++|+   ++|++++|||+.+++++.++|||++|  +     ..++||+|||||||| |++..++||||||+    +|
T Consensus        47 ~~~~sP~g~~~~~v~~~nly~~~~~~~~~~~lT~dg--~-----~~i~nG~~dwvyeEEv~~~~~~~~WSpd~~----~l  115 (353)
T PF00930_consen   47 DAKWSPDGKYIAFVRDNNLYLRDLATGQETQLTTDG--E-----PGIYNGVPDWVYEEEVFDRRSAVWWSPDSK----YL  115 (353)
T ss_dssp             EEEE-SSSTEEEEEETTEEEEESSTTSEEEESES----T-----TTEEESB--HHHHHHTSSSSBSEEE-TTSS----EE
T ss_pred             cceeecCCCeeEEEecCceEEEECCCCCeEEecccc--c-----eeEEcCccceeccccccccccceEECCCCC----EE
Confidence            4555555   99999999999999999999999995  3     889999999999999 79999999999999    99


Q ss_pred             EEEEEcCCcceeEECCCC
Q psy3287         104 LYEEIDESDVKIYNFPSS  121 (122)
Q Consensus       104 ay~~~Des~V~~~~~~~~  121 (122)
                      ||+++|+++|+.+++++.
T Consensus       116 a~~~~d~~~v~~~~~~~~  133 (353)
T PF00930_consen  116 AFLRFDEREVPEYPLPDY  133 (353)
T ss_dssp             EEEEEE-TTS-EEEEEEE
T ss_pred             EEEEECCcCCceEEeecc
Confidence            999999999999998753

Clans are groups of families for which there is evidence of common ancestry based on a common structural fold: Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases. In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding. Proteolytic enzymes that exploit serine in their catalytic activity are ubiquitous, being found in viruses, bacteria and eukaryotes []. They include a wide range of peptidase activity, including exopeptidase, endopeptidase, oligopeptidase and omega-peptidase activity. Over 20 families (denoted S1 - S66) of serine protease have been identified, these being grouped into clans on the basis of structural similarity and other functional evidence []. Structures are known for members of the clans and the structures indicate that some appear to be totally unrelated, suggesting different evolutionary origins for the serine peptidases []. Not withstanding their different evolutionary origins, there are similarities in the reaction mechanisms of several peptidases. Chymotrypsin, subtilisin and carboxypeptidase C have a catalytic triad of serine, aspartate and histidine in common: serine acts as a nucleophile, aspartate as an electrophile, and histidine as a base []. The geometric orientations of the catalytic residues are similar between families, despite different protein folds []. The linear arrangements of the catalytic residues commonly reflect clan relationships. For example the catalytic triad in the chymotrypsin clan (PA) is ordered HDS, but is ordered DHS in the subtilisin clan (SB) and SDH in the carboxypeptidase clan (SC) [, ]. This domain defines serine peptidases belonging to MEROPS peptidase family S9 (clan SC), subfamily S9B (dipeptidyl-peptidase IV). The protein fold of the peptidase domain for members of this family resembles that of serine carboxypeptidase D, the type example of clan SC. This domain is an alignment of the region to the N-terminal side of the active site, which is found in IPR001375 from INTERPRO. CD26 (3.4.14.5 from EC) is also called adenosine deaminase-binding protein (ADA-binding protein) or dipeptidylpeptidase IV (DPP IV ectoenzyme). The exopeptidase cleaves off N-terminal X-Pro or X-Ala dipeptides from polypeptides (dipeptidyl peptidase IV activity). CD26 serves as the costimulatory molecule in T cell activation and is an associated marker of autoimmune diseases, adenosine deaminase-deficiency and HIV pathogenesis. Dipeptidyl peptidase IV (DPP IV) is responsible for the removal of N-terminal dipeptides sequentially from polypeptides having unsubstituted N termini, provided that the penultimate residue is proline. The enzyme catalyses the reaction: Dipeptidyl-Polypeptide + H(2)O = Dipeptide + Polypeptide It is a type II membrane protein that forms a homodimer. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0006508 proteolysis, 0016020 membrane; PDB: 2RIP_A 3Q8W_B 2AJL_I 1TKR_B 1TK3_B 3C45_A 2G5P_A 3G0C_D 1R9M_C 1RWQ_A ....

>KOG2281\|consensus	Back alignment and domain information

>KOG2100\|consensus	Back alignment and domain information

>KOG2281\|consensus	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04043 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK03629 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04792 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK00178 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK05137 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01029 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK02889 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK01742 tolB translocation protein TolB; Provisional	Back alignment and domain information

>PRK04922 tolB translocation protein TolB; Provisional	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion]	Back alignment and domain information

>PF07676 PD40: WD40-like Beta Propeller Repeat; InterPro: IPR011659 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide	Back alignment and domain information

>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB	Back alignment and domain information

>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown]	Back alignment and domain information

>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species	Back alignment and domain information

>TIGR02171 Fb_sc_TIGR02171 Fibrobacter succinogenes paralogous family TIGR02171	Back alignment and domain information

>PRK13616 lipoprotein LpqB; Provisional	Back alignment and domain information

>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families	Back alignment and domain information

>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		122
2ecf_A		741	Crystal Structure Of Dipeptidyl Aminopeptidase Iv F		8e-04

>pdb|2ECF|A Chain A, Crystal Structure Of Dipeptidyl Aminopeptidase Iv From Stenotrophomonas Maltophilia Length = 741

Back alignment and structure

Iteration: 1
 Score = 38.5 bits (88), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 23/45 (51%), Gaps = 4/45 (8%)
Query: 71  LAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRILYEEIDESDVKI 115
           +  GI  +V  EE  R+ GYWW P  +     I Y  IDES V +
Sbjct: 195 IGNGIAEFVADEEMDRHTGYWWAPDDS----AIAYARIDESPVPV 235

PyMOL of 2ecf

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		122
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	4e-12
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	3e-05
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	3e-11
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	4e-04
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	4e-11
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	7e-04
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	1e-10
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	1e-07

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741	Back alignment and structure

 Score = 60.5 bits (147), Expect = 4e-12
 Identities = 24/77 (31%), Positives = 30/77 (38%), Gaps = 11/77 (14%)

Query: 44  WWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSRYQGYWWQPKTTDGVYRI 103
           W     +G   +LT    G   +       GI  +V  EE  R+ GYWW P   D    I
Sbjct: 175 WVIDLASGRQMQLT--ADGSTTIG-----NGIAEFVADEEMDRHTGYWWAP---DD-SAI 223

Query: 104 LYEEIDESDVKIYNFPS 120
            Y  IDES V +     
Sbjct: 224 AYARIDESPVPVQKRYE 240

PyMOL of 2ecf

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Length = 741	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Length = 740	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Length = 723	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Length = 719	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Length = 706	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		122
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	99.63
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	99.32
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	99.3
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	99.09
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	98.97
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	96.68
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	96.54
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	96.44
3pe7_A		388	Oligogalacturonate lyase; seven-bladed beta-propel	96.17
4a5s_A		740	Dipeptidyl peptidase 4 soluble form; hydrolase, ty	95.71
2ecf_A		741	Dipeptidyl peptidase IV; prolyl oligopeptidase fam	95.55
1k32_A		1045	Tricorn protease; protein degradation, substrate g	95.38
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	94.97
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	94.77
1xfd_A		723	DIP, dipeptidyl aminopeptidase-like protein 6, dip	94.7
2hqs_A		415	Protein TOLB; TOLB, PAL, TOL, transport protein-li	94.67
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	94.62
1z68_A		719	Fibroblast activation protein, alpha subunit; sepr	94.54
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	94.36
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	94.25
2ojh_A		297	Uncharacterized protein ATU1656/AGR_C_3050; TOLB,	93.91
2gop_A		347	Trilobed protease; beta propeller, open velcro, hy	93.68
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	93.37
2z3z_A		706	Dipeptidyl aminopeptidase IV; peptidase family S9,	93.11
1k32_A		1045	Tricorn protease; protein degradation, substrate g	92.72
3azo_A		662	Aminopeptidase; POP family, hydrolase; 2.00A {Stre	91.92
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	91.41
2bkl_A		695	Prolyl endopeptidase; mechanistic study, celiac sp	91.31
3c5m_A		396	Oligogalacturonate lyase; blade-shaped beta-propel	91.12
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	90.83
2xdw_A		710	Prolyl endopeptidase; alpha/beta-hydrolase, amnesi	88.23
1yr2_A		741	Prolyl oligopeptidase; prolyl endopeptidase, mecha	87.07
3o4h_A		582	Acylamino-acid-releasing enzyme; alpha/beta hydrol	85.65
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	85.62
3g4e_A		297	Regucalcin; six bladed beta-propeller, gluconolcat	85.19
2xe4_A		751	Oligopeptidase B; hydrolase-inhibitor complex, hyd	83.06
3iuj_A		693	Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas	82.37
1l0q_A		391	Surface layer protein; SLP, S-layer, 7-bladed beta	81.4
3hfq_A		347	Uncharacterized protein LP_2219; Q88V64_lacpl, NES	80.62
3sre_A		355	PON1, serum paraoxonase; directed evolution, 6-bla	80.59

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

Probab=99.63  E-value=2.3e-16  Score=133.52  Aligned_cols=83  Identities=20%  Similarity=0.468  Sum_probs=74.9

Q ss_pred             CCcceece---EEEEEeCCEEEEeCCCCCeeEEeccccCCcccCCCCeeeccCCccchhee-cccceEEecCCCCCCceE
Q psy3287          27 GIPSYVTQ---EEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEF-SRYQGYWWQPKTTDGVYR  102 (122)
Q Consensus        27 Gv~~f~~~---~aFvr~~nLyv~~~~~~~~~rlT~~~~g~~~v~~~~i~~G~~d~v~eEE~-~~~~g~wWSPd~~~~~~~  102 (122)
                      ..+.|+|+   +||+++++||+.++.+|..+|||.++..      ..+++|.++|||+||+ ++..++||||||+    +
T Consensus       115 ~~~~~SPdG~~la~~~~~~i~~~~~~~~~~~~lt~~g~~------~~~~~g~~~~v~~ee~~~~~~~~~wSpDg~----~  184 (740)
T 4a5s_A          115 QWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYRITWTGKE------DIIYNGITDWVYEEEVFSAYSALWWSPNGT----F  184 (740)
T ss_dssp             EEEEECSSTTCEEEEETTEEEEESSTTSCCEECCSCCBT------TTEEESBCCHHHHHHTSSSSBCEEECTTSS----E
T ss_pred             eeeEECCCCCEEEEEECCeEEEEECCCCceEEEcCCCCc------cceecCcccccccchhcCCCcceEECCCCC----E
Confidence            35678887   9999999999999999999999998543      6799999999999995 9999999999999    9


Q ss_pred             EEEEEEcCCcceeEECC
Q psy3287         103 ILYEEIDESDVKIYNFP  119 (122)
Q Consensus       103 iay~~~Des~V~~~~~~  119 (122)
                      |||.++|++.|+.+.++
T Consensus       185 la~~~~d~~~v~~~~~~  201 (740)
T 4a5s_A          185 LAYAQFNDTEVPLIEYS  201 (740)
T ss_dssp             EEEEEEECTTCCEEEEE
T ss_pred             EEEEEEcccCCceEEEE
Confidence            99999999999988764

PyMOL of 4a5s

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp}	Back alignment and structure

>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ...	Back alignment and structure

>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia}	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24	Back alignment and structure

>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens}	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str}	Back alignment and structure

>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A*	Back alignment and structure

>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A*	Back alignment and structure

>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus}	Back alignment and structure

>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A*	Back alignment and structure

>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum}	Back alignment and structure

>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B	Back alignment and structure

>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major}	Back alignment and structure

>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A*	Back alignment and structure

>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3	Back alignment and structure

>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum}	Back alignment and structure

>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A*	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		122
d1xfda1		465	b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-lik	0.001

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 465	Back information, alignment and structure


class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: DPP6 N-terminal domain-like
family: DPP6 N-terminal domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 34.9 bits (79), Expect = 0.001
 Identities = 17/86 (19%), Positives = 33/86 (38%), Gaps = 11/86 (12%)

Query: 36  EFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEFSR-YQGYWWQP 94
            F      ++         R+    K      +  +  G+  ++ +EE  + +  +WW P
Sbjct: 129 IFIFENNIYYCAHVGKQAIRVVSTGK------EGVIYNGLSDWLYEEEILKTHIAHWWSP 182

Query: 95  KTTDGVYRILYEEIDESDVKIYNFPS 120
             T    R+ Y  I++S V I   P+
Sbjct: 183 DGT----RLAYAAINDSRVPIMELPT 204

PyMOL of d1xfda1

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		122
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	99.86
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	99.65
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	98.38
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	97.93
d1k32a2		281	Tricorn protease N-terminal domain {Archaeon Therm	97.41
d2hqsa1		269	TolB, C-terminal domain {Escherichia coli [TaxId:	96.92
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	96.61
d2bgra1		470	Dipeptidyl peptidase IV/CD26, N-terminal domain {P	96.21
d1xfda1		465	Dipeptidyl aminopeptidase-like protein 6, DPP6, N-	93.11
d1k32a3		360	Tricorn protease domain 2 {Archaeon Thermoplasma a	92.3
d1nr0a1		311	Actin interacting protein 1 {Nematode (Caenorhabdi	84.47
d2p4oa1		302	Hypothetical protein All0351 homologue {Nostoc pun	84.14
d1ri6a_		333	Putative isomerase YbhE {Escherichia coli [TaxId:	83.62
d2dg1a1		319	Lactonase Drp35 {Staphylococcus aureus [TaxId: 128	82.37

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

class: All beta proteins
fold: 8-bladed beta-propeller
superfamily: DPP6 N-terminal domain-like
family: DPP6 N-terminal domain-like
domain: Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.86  E-value=3.2e-22  Score=162.05  Aligned_cols=84  Identities=20%  Similarity=0.406  Sum_probs=77.0

Q ss_pred             Ccceece---EEEEEeCCEEEEeCCCCCeeEEeccccCCcccCCCCeeeccCCccchhee-cccceEEecCCCCCCceEE
Q psy3287          28 IPSYVTQ---EEFSRYQGYWWQPKTTGSTQRLTFAHKGGRNLTDDPLAAGIPSYVTQEEF-SRYQGYWWQPKTTDGVYRI  103 (122)
Q Consensus        28 v~~f~~~---~aFvr~~nLyv~~~~~~~~~rlT~~~~g~~~v~~~~i~~G~~d~v~eEE~-~~~~g~wWSPd~~~~~~~i  103 (122)
                      .+.|+|+   +||++++|||+.+..++.+.|||.++..      +.++||++||+|+||+ +.+.|+||||||+    +|
T Consensus       118 ~~~wSPDG~~iafv~~~nl~~~~~~~~~~~~lt~~g~~------~~i~nG~~d~vyeee~~~~~~a~~WSPDgk----~i  187 (465)
T d1xfda1         118 YAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGKE------GVIYNGLSDWLYEEEILKTHIAHWWSPDGT----RL  187 (465)
T ss_dssp             BCCBCSSTTCEEEEETTEEEEESSSSSCCEEEECCCBT------TTEEEEECCHHHHHTTSSSSEEEEECTTSS----EE
T ss_pred             eeeeccCCceEEEEecceEEEEecCCCceEEEecccCc------ceeeccccchhhhhhhccccceEEECCCCC----eE
Confidence            4778888   9999999999999999999999999654      7899999999999998 6789999999999    99


Q ss_pred             EEEEEcCCcceeEECCCC
Q psy3287         104 LYEEIDESDVKIYNFPSS  121 (122)
Q Consensus       104 ay~~~Des~V~~~~~~~~  121 (122)
                      ||.++|+++|+.++++.+
T Consensus       188 af~~~D~s~V~~~~~~~~  205 (465)
T d1xfda1         188 AYAAINDSRVPIMELPTY  205 (465)
T ss_dssp             EEEEEECTTSCEEEECCC
T ss_pred             EEEEecccccceeecccc
Confidence            999999999999998753

PyMOL of d1xfda1

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}	Back information, alignment and structure

>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]}	Back information, alignment and structure

>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]}	Back information, alignment and structure

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}	Back information, alignment and structure

>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]}	Back information, alignment and structure