Psyllid ID: psy3460

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150---
MFKGSTGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLKKIRRKIKNKISAQESRRKKKEYMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQLNKLQAIIARHTAQLSNNQNNLRVGVAK
ccccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
ccccccccEEEcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcEEEEEccccccccccccEEEEEcc
mfkgstgvlhlTEEEKRTLqaegypiptrlpltktEEKSLKKIRRKIKNKISAQESRRKKKEYMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQLNKLQAIIARHTAQlsnnqnnlrvgvak
mfkgstgvlhlteeekrtlqaegypiptrlpltkteekslKKIRRkiknkisaqesrrkkkeymDALERKveilksencdyKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQLNKLQAIIARHTaqlsnnqnnlrvgvak
MFKGSTGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLkkirrkiknkiSAQESRRKKKEYMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQLNKLQAIIARHTAQLSNNQNNLRVGVAK
**********************************************************************VEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQLNKLQAIIARHTA***************
***************************************************************MDALERKVEILK***CDYKKRISNLEDTNY***************************SLVSQLNKL************************
MFKGSTGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLKKIRRKI***************YMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQLNKLQAIIARHTAQLSNNQNNLRVGVAK
*****TGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLKKIRRKIKNKISAQESRRKKKEYMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQLNKLQAIIARHTAQLSNNQNNLRVGVA*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFKGSTGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLKKIRRKIKNKISAQESxxxxxxxxxxxxxxxxxxxxxNCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLSNVSIVYSLVSQxxxxxxxxxxxxxxxxxxxxxLRVGVAK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query153 2.2.26 [Sep-21-2011]
P29747516 Cyclic AMP response eleme yes N/A 0.699 0.207 0.785 4e-35
Q96BA8 519 Cyclic AMP-responsive ele yes N/A 0.594 0.175 0.681 5e-30
Q9Z125 519 Cyclic AMP-responsive ele yes N/A 0.594 0.175 0.681 1e-29
Q66HA2 520 Cyclic AMP-responsive ele yes N/A 0.594 0.175 0.681 2e-29
A1L224 519 Cyclic AMP-responsive ele no N/A 0.666 0.196 0.696 3e-26
Q68CJ9 461 Cyclic AMP-responsive ele no N/A 0.679 0.225 0.538 7e-26
Q91XE9 479 Cyclic AMP-responsive ele no N/A 0.679 0.217 0.519 5e-25
Q5FVM5 470 Cyclic AMP-responsive ele no N/A 0.679 0.221 0.519 7e-25
Q08CW8428 Cyclic AMP-responsive ele yes N/A 0.640 0.228 0.581 3e-24
Q8TEY5395 Cyclic AMP-responsive ele no N/A 0.751 0.291 0.5 7e-24
>sp|P29747|CREBA_DROME Cyclic AMP response element-binding protein A OS=Drosophila melanogaster GN=CrebA PE=1 SV=2 Back     alignment and function desciption
 Score =  146 bits (369), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 84/107 (78%), Positives = 96/107 (89%)

Query: 3   KGSTGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLKKIRRKIKNKISAQESRRKKKE 62
           KGSTG L LTEEEKRTL AEGYPIP +LPLTK EEKSLKKIRRKIKNKISAQESRRKKKE
Sbjct: 405 KGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKE 464

Query: 63  YMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARH 109
           YMD LER+VEIL +EN DYKKR+  LE+TN +L+SQL+KLQA++++H
Sbjct: 465 YMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSKH 511
Transcriptional activator. Binds to fat body-specific enhancers of alcohol dehydrogenase (ADH) and yolk protein genes. BBF-2 may play a role in fat body gene expression. It binds the consensus sequence 5'-T[AC]NACGTAN[TG]C-3'.
Drosophila melanogaster (taxid: 7227)
>sp|Q96BA8|CR3L1_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Homo sapiens GN=CREB3L1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Z125|CR3L1_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Mus musculus GN=Creb3l1 PE=2 SV=2 Back     alignment and function description
>sp|Q66HA2|CR3L1_RAT Cyclic AMP-responsive element-binding protein 3-like protein 1 OS=Rattus norvegicus GN=Creb3l1 PE=2 SV=1 Back     alignment and function description
>sp|A1L224|CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio GN=creb3l2 PE=2 SV=1 Back     alignment and function description
>sp|Q68CJ9|CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens GN=CREB3L3 PE=1 SV=2 Back     alignment and function description
>sp|Q91XE9|CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus GN=Creb3l3 PE=2 SV=1 Back     alignment and function description
>sp|Q5FVM5|CR3L3_RAT Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Rattus norvegicus GN=Creb3l3 PE=2 SV=1 Back     alignment and function description
>sp|Q08CW8|CR3L4_XENTR Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Xenopus tropicalis GN=creb3l4 PE=2 SV=1 Back     alignment and function description
>sp|Q8TEY5|CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens GN=CREB3L4 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
357616444 406 putative Cyclic AMP-dependent transcript 0.679 0.256 0.798 8e-40
345487342 451 PREDICTED: cyclic AMP response element-b 0.692 0.235 0.735 8e-37
307180180105 cAMP-responsive element-binding protein 0.679 0.990 0.730 2e-36
383855932 442 PREDICTED: cyclic AMP response element-b 0.679 0.235 0.730 3e-36
304651497 574 Creb3L3 [Paracentrotus lividus] 0.771 0.205 0.616 7e-35
390357228 547 PREDICTED: cyclic AMP-responsive element 0.771 0.215 0.608 3e-34
195126575 555 GI13117 [Drosophila mojavensis] gi|19391 0.699 0.192 0.794 5e-34
242011695 376 Cyclic AMP-dependent transcription facto 0.692 0.281 0.811 5e-34
170033901 498 conserved hypothetical protein [Culex qu 0.712 0.218 0.798 9e-34
195454845 528 GK10597 [Drosophila willistoni] gi|19417 0.699 0.202 0.794 1e-33
>gi|357616444|gb|EHJ70197.1| putative Cyclic AMP-dependent transcription factor ATF-6 beta [Danaus plexippus] Back     alignment and taxonomy information
 Score =  168 bits (425), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 83/104 (79%), Positives = 91/104 (87%)

Query: 3   KGSTGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLKKIRRKIKNKISAQESRRKKKE 62
           KGSTG L LTEEEKRTL AEGYP+PTRLPLTK EEKSLKK+RRKIKNKISAQESRRKKKE
Sbjct: 298 KGSTGTLVLTEEEKRTLLAEGYPVPTRLPLTKAEEKSLKKVRRKIKNKISAQESRRKKKE 357

Query: 63  YMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAII 106
           YMD LERKVEIL SEN DY+KR+  LE TN +L+SQL  LQA++
Sbjct: 358 YMDQLERKVEILVSENTDYRKRVETLESTNANLLSQLAALQAMV 401

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345487342|ref|XP_003425676.1| PREDICTED: cyclic AMP response element-binding protein A-like isoform 1 [Nasonia vitripennis] gi|345487344|ref|XP_003425677.1| PREDICTED: cyclic AMP response element-binding protein A-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307180180|gb|EFN68213.1| cAMP-responsive element-binding protein 3-like protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383855932|ref|XP_003703464.1| PREDICTED: cyclic AMP response element-binding protein A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|304651497|gb|ADM47611.1| Creb3L3 [Paracentrotus lividus] Back     alignment and taxonomy information
>gi|390357228|ref|XP_788083.3| PREDICTED: cyclic AMP-responsive element-binding protein 3-like protein 2-like [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|195126575|ref|XP_002007746.1| GI13117 [Drosophila mojavensis] gi|193919355|gb|EDW18222.1| GI13117 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|242011695|ref|XP_002426582.1| Cyclic AMP-dependent transcription factor ATF-6 beta, putative [Pediculus humanus corporis] gi|212510731|gb|EEB13844.1| Cyclic AMP-dependent transcription factor ATF-6 beta, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170033901|ref|XP_001844814.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167875059|gb|EDS38442.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195454845|ref|XP_002074433.1| GK10597 [Drosophila willistoni] gi|194170518|gb|EDW85419.1| GK10597 [Drosophila willistoni] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query153
FB|FBgn0004396516 CrebA "Cyclic-AMP response ele 0.732 0.217 0.660 3.2e-33
UNIPROTKB|F1P1J2 488 CREB3L2 "Uncharacterized prote 0.666 0.209 0.607 6.3e-26
ZFIN|ZDB-GENE-070112-1542 519 creb3l2 "cAMP responsive eleme 0.679 0.200 0.590 6.7e-26
UNIPROTKB|F1SNJ4 490 CREB3L2 "Uncharacterized prote 0.673 0.210 0.596 8.4e-26
UNIPROTKB|F1MQ10 493 CREB3L2 "Uncharacterized prote 0.673 0.208 0.596 8.7e-26
MGI|MGI:2442695 521 Creb3l2 "cAMP responsive eleme 0.673 0.197 0.596 8.8e-26
UNIPROTKB|E2RFY7 520 CREB3L2 "Uncharacterized prote 0.673 0.198 0.596 1.1e-25
UNIPROTKB|Q5RCM9 520 CREB3L2 "Cyclic AMP-responsive 0.673 0.198 0.596 1.1e-25
RGD|1306040 521 Creb3l2 "cAMP responsive eleme 0.673 0.197 0.596 1.1e-25
UNIPROTKB|A2VD01 525 creb3l2 "Cyclic AMP-responsive 0.673 0.196 0.596 2e-25
FB|FBgn0004396 CrebA "Cyclic-AMP response element binding protein A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 362 (132.5 bits), Expect = 3.2e-33, P = 3.2e-33
 Identities = 74/112 (66%), Positives = 87/112 (77%)

Query:     3 KGSTGVLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLXXXXXXXXXXXSAQESRRKKKE 62
             KGSTG L LTEEEKRTL AEGYPIP +LPLTK EEKSL           SAQESRRKKKE
Sbjct:   405 KGSTGTLLLTEEEKRTLLAEGYPIPQKLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKE 464

Query:    63 YMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQLNKLQAIIARHTAQLS 114
             YMD LER+VEIL +EN DYKKR+  LE+TN +L+SQL+KLQA++++H  + S
Sbjct:   465 YMDQLERRVEILVTENHDYKKRLEGLEETNANLLSQLHKLQALVSKHNVKKS 516
GO:0003677 "DNA binding" evidence=NAS;IDA
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=NAS;IDA
GO:0035293 "chitin-based larval cuticle pattern formation" evidence=IMP
GO:0007431 "salivary gland development" evidence=IMP;TAS
GO:0009953 "dorsal/ventral pattern formation" evidence=IGI
GO:0006366 "transcription from RNA polymerase II promoter" evidence=NAS
GO:0007435 "salivary gland morphogenesis" evidence=NAS
GO:0042803 "protein homodimerization activity" evidence=ISS
GO:0008363 "larval chitin-based cuticle development" evidence=IMP
GO:0001158 "enhancer sequence-specific DNA binding" evidence=IDA
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IMP
UNIPROTKB|F1P1J2 CREB3L2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070112-1542 creb3l2 "cAMP responsive element binding protein 3-like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNJ4 CREB3L2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MQ10 CREB3L2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2442695 Creb3l2 "cAMP responsive element binding protein 3-like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFY7 CREB3L2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5RCM9 CREB3L2 "Cyclic AMP-responsive element-binding protein 3-like protein 2" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
RGD|1306040 Creb3l2 "cAMP responsive element binding protein 3-like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A2VD01 creb3l2 "Cyclic AMP-responsive element-binding protein 3-like protein 2" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q08CW8CR3L4_XENTRNo assigned EC number0.58160.64050.2289yesN/A
Q96BA8CR3L1_HUMANNo assigned EC number0.68130.59470.1753yesN/A
Q66HA2CR3L1_RATNo assigned EC number0.68130.59470.175yesN/A
P29747CREBA_DROMENo assigned EC number0.78500.69930.2073yesN/A
Q9Z125CR3L1_MOUSENo assigned EC number0.68130.59470.1753yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
smart0033865 smart00338, BRLZ, basic region leucin zipper 5e-12
pfam0017064 pfam00170, bZIP_1, bZIP transcription factor 2e-11
cd1219354 cd12193, B_zip1, basic leucine zipper DNA-binding 3e-07
pfam0771654 pfam07716, bZIP_2, Basic region leucine zipper 3e-04
>gnl|CDD|197664 smart00338, BRLZ, basic region leucin zipper Back     alignment and domain information 
 Score = 57.2 bits (139), Expect = 5e-12
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 37  EKSLKKIRRKIKNKISAQESRRKKKEYMDALERKVEILKSENCDYKKRISNLEDTNYSLV 96
           E+  K+ RR+ +N+ +A+ SR +KK  ++ LERKVE L++EN   KK I  L      L 
Sbjct: 1   EEDEKRRRRRERNREAARRSRERKKAEIEELERKVEQLEAENERLKKEIERLRRELEKLK 60

Query: 97  SQLNK 101
           S+L +
Sbjct: 61  SELEE 65

Length = 65
>gnl|CDD|201054 pfam00170, bZIP_1, bZIP transcription factor Back     alignment and domain information
>gnl|CDD|213400 cd12193, B_zip1, basic leucine zipper DNA-binding and multimerization region of GCN4 and related proteins Back     alignment and domain information
>gnl|CDD|203738 pfam07716, bZIP_2, Basic region leucine zipper Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 153
KOG0709|consensus 472 99.9
smart0033865 BRLZ basic region leucin zipper. 99.57
PF0017064 bZIP_1: bZIP transcription factor cAMP response el 99.5
KOG3584|consensus348 99.38
KOG4343|consensus 655 99.35
KOG4005|consensus 292 99.32
PF0771654 bZIP_2: Basic region leucine zipper; InterPro: IPR 99.24
PF0313192 bZIP_Maf: bZIP Maf transcription factor; InterPro: 98.8
KOG3863|consensus604 98.78
KOG0837|consensus279 98.52
KOG4571|consensus294 98.17
KOG4196|consensus135 97.89
KOG3119|consensus269 97.67
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 95.52
KOG1414|consensus 395 95.46
PRK13169110 DNA replication intiation control protein YabA; Re 95.03
PF08172248 CASP_C: CASP C terminal; InterPro: IPR012955 This 94.77
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 94.6
KOG4005|consensus 292 94.13
PRK10884206 SH3 domain-containing protein; Provisional 93.0
PF0600572 DUF904: Protein of unknown function (DUF904); Inte 92.99
PF1280852 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2 92.81
PF0218345 HALZ: Homeobox associated leucine zipper; InterPro 92.72
TIGR0244965 conserved hypothetical protein TIGR02449. Members 92.54
KOG1414|consensus395 91.55
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 91.35
PF05266190 DUF724: Protein of unknown function (DUF724); Inte 91.3
COG4467114 Regulator of replication initiation timing [Replic 91.22
PRK1542279 septal ring assembly protein ZapB; Provisional 90.92
PF0410269 SlyX: SlyX; InterPro: IPR007236 The SlyX protein h 90.84
PRK0029568 hypothetical protein; Provisional 90.76
PRK0432574 hypothetical protein; Provisional 90.67
PRK0073668 hypothetical protein; Provisional 90.67
COG307479 Uncharacterized protein conserved in bacteria [Fun 90.56
PRK0440675 hypothetical protein; Provisional 90.24
PRK0211973 hypothetical protein; Provisional 89.88
PRK0279372 phi X174 lysis protein; Provisional 89.79
PF11932 251 DUF3450: Protein of unknown function (DUF3450); In 89.48
COG2433 652 Uncharacterized conserved protein [Function unknow 89.29
PF1022480 DUF2205: Predicted coiled-coil protein (DUF2205); 88.78
PF13851201 GAS: Growth-arrest specific micro-tubule binding 88.75
PRK1542279 septal ring assembly protein ZapB; Provisional 88.58
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 88.47
PF0116659 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 87.94
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 86.86
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 86.58
KOG4196|consensus135 86.34
PRK11637 428 AmiB activator; Provisional 85.96
PRK0084677 hypothetical protein; Provisional 85.9
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 85.51
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 85.47
KOG0996|consensus 1293 84.81
PF0537755 FlaC_arch: Flagella accessory protein C (FlaC); In 84.61
PF06216 389 RTBV_P46: Rice tungro bacilliform virus P46 protei 84.1
KOG0709|consensus472 83.9
PF06156107 DUF972: Protein of unknown function (DUF972); Inte 83.75
TIGR03752 472 conj_TIGR03752 integrating conjugative element pro 83.7
PF08232134 Striatin: Striatin family; InterPro: IPR013258 Thi 83.67
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 83.29
PRK13922 276 rod shape-determining protein MreC; Provisional 82.0
PF05103131 DivIVA: DivIVA protein; InterPro: IPR007793 The Ba 81.94
PRK13169110 DNA replication intiation control protein YabA; Re 81.59
COG307479 Uncharacterized protein conserved in bacteria [Fun 81.55
PF1136596 DUF3166: Protein of unknown function (DUF3166); In 81.47
PF15058 200 Speriolin_N: Speriolin N terminus 81.42
PF1270987 Kinetocho_Slk19: Central kinetochore-associated; I 81.23
PRK00888105 ftsB cell division protein FtsB; Reviewed 80.45
PF0497780 DivIC: Septum formation initiator; InterPro: IPR00 80.08
COG4942 420 Membrane-bound metallopeptidase [Cell division and 80.08
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 80.01
>KOG0709|consensus Back     alignment and domain information 
Probab=99.90  E-value=4.2e-24  Score=190.30  Aligned_cols=107  Identities=53%  Similarity=0.792  Sum_probs=103.1

Q ss_pred             ccccCHHHHhhhhhcCCCCCCCCCCChhHHHHHHHHHHHHHhhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy3460           8 VLHLTEEEKRTLQAEGYPIPTRLPLTKTEEKSLKKIRRKIKNKISAQESRRKKKEYMDALERKVEILKSENCDYKKRISN   87 (153)
Q Consensus         8 ~~~l~~ee~~~l~~~g~~~p~~~p~t~~eek~~Kr~rR~lkNR~SAq~SR~RKKeyl~~LE~~v~~L~~eN~~L~~~~~~   87 (153)
                      -|.||+||+++|.++||.+|+.+|+|++||+.+||+||||||++|||.||+|||+||+.||.+|...+.+|++|+.+++.
T Consensus       218 ~L~LteeEkrLL~kEG~slPs~lPLTKaEEriLKrvRRKIrNK~SAQESRrkKkeYid~LE~rv~~~taeNqeL~kkV~~  297 (472)
T KOG0709|consen  218 PLVLTEEEKRLLTKEGYSLPSKLPLTKAEERILKRVRRKIRNKRSAQESRRKKKEYIDGLESRVSAFTAENQELQKKVEE  297 (472)
T ss_pred             ceeccHHHHHHHHhccCcCcccCCchHHHHHHHHHHHHHHHhhhhhHHHHHhHhhHHHHHhhhhhhcccCcHHHHHHHHH
Confidence            37899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHhhccCCC
Q psy3460          88 LEDTNYSLVSQLNKLQAIIARHTAQLS  114 (153)
Q Consensus        88 L~~eN~~L~~ql~~L~~~v~~~~~~~s  114 (153)
                      |+.+|..|.++|.+|++++.+..++..
T Consensus       298 Le~~N~sLl~qL~klQt~v~q~an~s~  324 (472)
T KOG0709|consen  298 LELSNRSLLAQLKKLQTLVIQVANKST  324 (472)
T ss_pred             HhhccHHHHHHHHHHHHHHhhcccchh
Confidence            999999999999999999998776544

>smart00338 BRLZ basic region leucin zipper Back     alignment and domain information
>PF00170 bZIP_1: bZIP transcription factor cAMP response element binding (CREB) protein signature fos transforming protein signature jun transcription factor signature; InterPro: IPR011616 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotic are proteins that contain a basic region mediating sequence-specific DNA-binding followed by a leucine zipper region (see IPR002158 from INTERPRO) required for dimerization Back     alignment and domain information
>KOG3584|consensus Back     alignment and domain information
>KOG4343|consensus Back     alignment and domain information
>KOG4005|consensus Back     alignment and domain information
>PF07716 bZIP_2: Basic region leucine zipper; InterPro: IPR011700 The basic-leucine zipper (bZIP) transcription factors [, ] of eukaryotes are proteins that contain a basic region mediating sequence-specific DNA-binding, followed by a leucine zipper region (see IPR002158 from INTERPRO), which is required for dimerization Back     alignment and domain information
>PF03131 bZIP_Maf: bZIP Maf transcription factor; InterPro: IPR004826 There are several different types of Maf transcription factors with different roles in the cell Back     alignment and domain information
>KOG3863|consensus Back     alignment and domain information
>KOG0837|consensus Back     alignment and domain information
>KOG4571|consensus Back     alignment and domain information
>KOG4196|consensus Back     alignment and domain information
>KOG3119|consensus Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>KOG1414|consensus Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>PF08172 CASP_C: CASP C terminal; InterPro: IPR012955 This domain is the C-terminal region of the CASP family of proteins Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>KOG4005|consensus Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF06005 DUF904: Protein of unknown function (DUF904); InterPro: IPR009252 Cell division protein ZapB is a non-essential, abundant cell division factor that is required for proper Z-ring formation Back     alignment and domain information
>PF12808 Mto2_bdg: Micro-tubular organiser Mto1 C-term Mto2-binding region; InterPro: IPR024545 This domain occurs at the C terminus of microtubule organising proteins in both budding and fission fungi Back     alignment and domain information
>PF02183 HALZ: Homeobox associated leucine zipper; InterPro: IPR003106 This region is a plant specific leucine zipper that is always found associated with a homeobox [] Back     alignment and domain information
>TIGR02449 conserved hypothetical protein TIGR02449 Back     alignment and domain information
>KOG1414|consensus Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF05266 DUF724: Protein of unknown function (DUF724); InterPro: IPR007930 This family contains several uncharacterised proteins found exclusively in Arabidopsis thaliana Back     alignment and domain information
>COG4467 Regulator of replication initiation timing [Replication, recombination, and repair] Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF04102 SlyX: SlyX; InterPro: IPR007236 The SlyX protein has no known function Back     alignment and domain information
>PRK00295 hypothetical protein; Provisional Back     alignment and domain information
>PRK04325 hypothetical protein; Provisional Back     alignment and domain information
>PRK00736 hypothetical protein; Provisional Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK04406 hypothetical protein; Provisional Back     alignment and domain information
>PRK02119 hypothetical protein; Provisional Back     alignment and domain information
>PRK02793 phi X174 lysis protein; Provisional Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10224 DUF2205: Predicted coiled-coil protein (DUF2205); InterPro: IPR019357 This entry represents a highly conserved 100 residue region which is likely to have a coiled-coil structure Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>PRK15422 septal ring assembly protein ZapB; Provisional Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF01166 TSC22: TSC-22/dip/bun family; InterPro: IPR000580 Several eukaryotic proteins are evolutionary related and are thought to be involved in transcriptional regulation Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>KOG4196|consensus Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK00846 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>PF05377 FlaC_arch: Flagella accessory protein C (FlaC); InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct [] Back     alignment and domain information
>PF06216 RTBV_P46: Rice tungro bacilliform virus P46 protein; InterPro: IPR009347 This family consists of several Rice tungro bacilliform virus P46 proteins Back     alignment and domain information
>KOG0709|consensus Back     alignment and domain information
>PF06156 DUF972: Protein of unknown function (DUF972); InterPro: IPR010377 FUNCTION: Involved in initiation control of chromosome replication Back     alignment and domain information
>TIGR03752 conj_TIGR03752 integrating conjugative element protein, PFL_4705 family Back     alignment and domain information
>PF08232 Striatin: Striatin family; InterPro: IPR013258 This domain is associated with the N terminus of striatin Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK13922 rod shape-determining protein MreC; Provisional Back     alignment and domain information
>PF05103 DivIVA: DivIVA protein; InterPro: IPR007793 The Bacillus subtilis divIVA1 mutation causes misplacement of the septum during cell division, resulting in the formation of small, circular, anucleate minicells [] Back     alignment and domain information
>PRK13169 DNA replication intiation control protein YabA; Reviewed Back     alignment and domain information
>COG3074 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF11365 DUF3166: Protein of unknown function (DUF3166); InterPro: IPR021507 This eukaryotic family of proteins has no known function Back     alignment and domain information
>PF15058 Speriolin_N: Speriolin N terminus Back     alignment and domain information
>PF12709 Kinetocho_Slk19: Central kinetochore-associated; InterPro: IPR024312 This is a family of proteins integrally involved in the central kinetochore Back     alignment and domain information
>PRK00888 ftsB cell division protein FtsB; Reviewed Back     alignment and domain information
>PF04977 DivIC: Septum formation initiator; InterPro: IPR007060 DivIC, from the spore-forming, Gram-positive bacterium Bacillus subtilis, is necessary for both vegetative and sporulation septum formation [] Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query153
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 1e-10
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 1e-09
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 9e-09
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 1e-07
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 8e-07
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 2e-06
2wt7_B90 Transcription factor MAFB; transcription, transcri 4e-06
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 5e-05
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 2e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 7e-04
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 8e-04
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Length = 55 Back     alignment and structure
 Score = 52.8 bits (127), Expect = 1e-10
 Identities = 21/50 (42%), Positives = 36/50 (72%)

Query: 41 KKIRRKIKNKISAQESRRKKKEYMDALERKVEILKSENCDYKKRISNLED 90
          K+  R +KN+ +A+ESRRKKKEY+ +LE +V +L+++N    + +  L+D
Sbjct: 1  KREVRLMKNREAARESRRKKKEYVKSLENRVAVLENQNKTLIEELKALKD 50
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Length = 61 Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Length = 62 Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Length = 107 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Length = 63 Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Length = 63 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Length = 90 Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Length = 87 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Length = 63 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 99.58
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 99.55
2wt7_A63 Proto-oncogene protein C-FOS; transcription, trans 99.53
1jnm_A62 Proto-oncogene C-JUN; BZIP, protein-DNA complex, t 99.52
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 99.33
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 99.22
3a5t_A107 Transcription factor MAFG; protein-DNA complex, BZ 99.13
1hjb_A87 Ccaat/enhancer binding protein beta; transcription 98.93
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 98.91
1gu4_A78 CAAT/enhancer binding protein beta; transcription/ 98.85
2wt7_B90 Transcription factor MAFB; transcription, transcri 98.85
1skn_P92 DNA-binding domain of SKN-1; complex (transcriptio 98.56
2oqq_A42 Transcription factor HY5; homodimer leucine zipper 98.54
2kz5_A91 Transcription factor NF-E2 45 kDa subunit; structu 98.17
2lz1_A90 Nuclear factor erythroid 2-related factor 2; struc 97.77
2c9l_Y63 EB1, zebra, BZLF1 trans-activator protein; viral p 95.8
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 95.05
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 94.45
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 94.37
3m48_A33 General control protein GCN4; leucine zipper, synt 94.32
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 94.11
2yy0_A53 C-MYC-binding protein; conserved hypothetical prot 93.76
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 93.29
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 93.28
2bni_A34 General control protein GCN4; four helix bundle, a 93.14
2wq1_A33 General control protein GCN4; TAA, nucleus, coiled 92.75
1uo4_A34 General control protein GCN4; four helix bundle, c 92.58
2hy6_A34 General control protein GCN4; protein design, para 92.32
2jee_A81 YIIU; FTSZ, septum, coiled-coil, cell division, ce 92.11
1gd2_E70 Transcription factor PAP1; basic leucine zipper, p 91.64
3a2a_A58 Voltage-gated hydrogen channel 1; voltage-gated pr 90.7
3vmx_A48 Voltage-gated hydrogen channel 1; coiled-coil, ION 90.67
2dgc_A63 Protein (GCN4); basic domain, leucine zipper, DNA 90.44
2oxj_A34 Hybrid alpha/beta peptide based on the GCN4-P1 Se 90.14
1kd8_B36 GABH BLL, GCN4 acid base heterodimer base-D12LA16L 89.97
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 89.61
1uii_A83 Geminin; human, DNA replication, cell cycle; 2.00A 89.58
3he5_A49 Synzip1; heterodimeric coiled-coil, de novo protei 89.54
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 89.32
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 88.72
3m48_A33 General control protein GCN4; leucine zipper, synt 88.31
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 88.3
3c3g_A33 Alpha/beta peptide with the GCN4-PLI SIDE chain S 88.29
1kd8_A36 GABH AIV, GCN4 acid base heterodimer acid-D12IA16V 87.7
3s9g_A104 Protein hexim1; cyclin T-binding domain (TBD), cyc 87.34
1ci6_A63 Transcription factor ATF-4; BZIP; 2.60A {Homo sapi 87.27
1dh3_A55 Transcription factor CREB; protein-DNA complex, tr 87.25
3c3f_A34 Alpha/beta peptide with the GCN4-PLI SIDE chain S 86.82
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 86.64
2r2v_A34 GCN4 leucine zipper; coiled coils, anti-parallel t 86.38
3m9b_A 251 Proteasome-associated ATPase; coil COIL with 5 bet 85.55
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 85.15
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 85.08
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 85.06
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 84.85
3m91_A51 Proteasome-associated ATPase; coil COIL alpha heli 84.76
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 84.11
3efg_A78 Protein SLYX homolog; xanthomonas campestris PV. c 84.11
2hy6_A34 General control protein GCN4; protein design, para 83.88
1t2k_D61 Cyclic-AMP-dependent transcription factor ATF-2; p 83.28
2wt7_B90 Transcription factor MAFB; transcription, transcri 82.86
2bni_A34 General control protein GCN4; four helix bundle, a 82.83
1fmh_A33 General control protein GCN4; coiled coil, leucine 82.32
3mq7_A121 Bone marrow stromal antigen 2; HIV, antiviral prot 81.82
1uo4_A34 General control protein GCN4; four helix bundle, c 81.71
3i00_A120 HIP-I, huntingtin-interacting protein 1; transcrip 81.59
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 80.16
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
Probab=99.58  E-value=9.9e-15  Score=97.21  Aligned_cols=59  Identities=29%  Similarity=0.365  Sum_probs=56.5

Q ss_pred             HHHHHHHHhhHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q psy3460          41 KKIRRKIKNKISAQESRRKKKEYMDALERKVEILKSENCDYKKRISNLEDTNYSLVSQL   99 (153)
Q Consensus        41 Kr~rR~lkNR~SAq~SR~RKKeyl~~LE~~v~~L~~eN~~L~~~~~~L~~eN~~L~~ql   99 (153)
                      |+.+|+.+||+||++||+||++|+.+||.++..|+.+|..|..++..|+.++..|++.|
T Consensus         1 kR~~r~erNr~AA~k~R~rKk~~~~~Le~~~~~L~~~n~~L~~~i~~L~~e~~~Lk~~l   59 (61)
T 1t2k_D            1 KRRKFLERNRAAASRSRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTLLRNEVAQLKQLL   59 (61)
T ss_dssp             CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            57899999999999999999999999999999999999999999999999999998876
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_A Proto-oncogene protein C-FOS; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 1fos_E* 1a02_F* 1s9k_D Back     alignment and structure
>1jnm_A Proto-oncogene C-JUN; BZIP, protein-DNA complex, transcription/DNA complex; 2.20A {Homo sapiens} SCOP: h.1.3.1 PDB: 1fos_F 2h7h_A 1t2k_C 1a02_J* 1s9k_E 1jun_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>3a5t_A Transcription factor MAFG; protein-DNA complex, BZIP factor, acetylation, DNA-binding, isopeptide bond, nucleus; 2.80A {Mus musculus} Back     alignment and structure
>1hjb_A Ccaat/enhancer binding protein beta; transcription/DNA, protein-DNA complex; HET: DNA; 3.0A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>1gu4_A CAAT/enhancer binding protein beta; transcription/DNA, protein-DNA complex, transcription factor, BZIP, C/EBP; 1.80A {Homo sapiens} SCOP: h.1.3.1 PDB: 1gtw_A 1gu5_A 1h88_A 1h8a_A 1io4_A 2e43_A* 2e42_A* 1h89_A 1ci6_B 1nwq_A Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>1skn_P DNA-binding domain of SKN-1; complex (transcription factor/DNA), transcription/DNA complex; HET: DNA LDA; 2.50A {Caenorhabditis elegans} SCOP: a.37.1.1 Back     alignment and structure
>2oqq_A Transcription factor HY5; homodimer leucine zipper; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2kz5_A Transcription factor NF-E2 45 kDa subunit; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lz1_A Nuclear factor erythroid 2-related factor 2; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2c9l_Y EB1, zebra, BZLF1 trans-activator protein; viral protein, epstein-BARR virus, EBV; 2.25A {Human herpesvirus 4} SCOP: h.1.3.1 PDB: 2c9n_Y Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>2yy0_A C-MYC-binding protein; conserved hypothetical protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Homo sapiens} Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>2wq1_A General control protein GCN4; TAA, nucleus, coiled coil, DNA-binding, protein export, ION coordination, polar core residues; 1.08A {Saccharomyces cerevisiae} PDB: 2wq0_A 2wq2_A 2wq3_A 2wpz_A 2wpy_A 1ij0_A 1ij1_A 1gcm_A 1rb5_A 1rb6_A 1rb1_A 1rb4_A 1swi_A 3k7z_A 1zii_A 1zij_A 1ij2_A 1ij3_A 1zil_A 1zim_A ... Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>2jee_A YIIU; FTSZ, septum, coiled-coil, cell division, cell cycle, hypothetical protein; 2.8A {Escherichia coli} Back     alignment and structure
>1gd2_E Transcription factor PAP1; basic leucine zipper, protein-DNA complex, transcription/DNA complex; HET: DNA; 2.00A {Schizosaccharomyces pombe} SCOP: h.1.3.1 Back     alignment and structure
>3a2a_A Voltage-gated hydrogen channel 1; voltage-gated proton channel, alternative splicing, coiled C transport, ionic channel, membrane, transmembrane; 2.00A {Homo sapiens} Back     alignment and structure
>3vmx_A Voltage-gated hydrogen channel 1; coiled-coil, ION channel, ION transport, membrane protein; 1.45A {Mus musculus} Back     alignment and structure
>2dgc_A Protein (GCN4); basic domain, leucine zipper, DNA binding, eukaryotic regulatory protein, transcription/DNA complex; HET: DNA; 2.20A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1dgc_A* 1ld4_E 1ysa_C* 3p8m_D Back     alignment and structure
>2oxj_A Hybrid alpha/beta peptide based on the GCN4-P1 Se heptad positions B and F substituted...; helix bundle, foldamer, unknown function; HET: B3K B3D B3E B3S B3Y B3X B3A BAL; 2.00A {Synthetic} PDB: 2oxk_A* Back     alignment and structure
>1kd8_B GABH BLL, GCN4 acid base heterodimer base-D12LA16L; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kd9_B 1kdd_B Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1uii_A Geminin; human, DNA replication, cell cycle; 2.00A {Homo sapiens} SCOP: h.1.28.1 Back     alignment and structure
>3he5_A Synzip1; heterodimeric coiled-coil, de novo protein; 1.75A {Artificial gene} Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3m48_A General control protein GCN4; leucine zipper, synthetic peptide, alpha helix, activa amino-acid biosynthesis, DNA-binding, nucleus; 1.45A {Synthetic} PDB: 3i1g_A 2ahp_A* 2o7h_A Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>3c3g_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-beta) backbone; helix bundle, foldamer, unknown function protein; HET: HMR B3Q B3D B3E B3L BIL B3K BAL GOL; 1.80A {Synthetic} PDB: 3heu_A* 3het_A* 3hev_A* 3hew_A* 3hey_A* 3hex_A* 3c3h_A* Back     alignment and structure
>1kd8_A GABH AIV, GCN4 acid base heterodimer acid-D12IA16V; coiled coil heterodimer, de novo protein; 1.90A {Synthetic} SCOP: h.1.3.1 PDB: 1kdd_A 1kd9_A Back     alignment and structure
>3s9g_A Protein hexim1; cyclin T-binding domain (TBD), cyclin T1/P-TEFB/7SK snRNA, N transcription; 2.10A {Homo sapiens} PDB: 2gd7_A Back     alignment and structure
>1ci6_A Transcription factor ATF-4; BZIP; 2.60A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>1dh3_A Transcription factor CREB; protein-DNA complex, transcription/DNA complex; HET: DNA; 3.00A {Mus musculus} SCOP: h.1.3.1 Back     alignment and structure
>3c3f_A Alpha/beta peptide with the GCN4-PLI SIDE chain S AN (alpha-alpha-alpha-beta) backbone...; helix bundle, foldamer, unknown function, de novo protein; HET: B3K B3D B3E BIL B3L BAL; 2.00A {Synthetic} SCOP: h.1.3.1 Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>2r2v_A GCN4 leucine zipper; coiled coils, anti-parallel tetramer, protein design, de novo protein; HET: CIT; 1.90A {Saccharomyces cerevisiae} SCOP: h.1.3.1 Back     alignment and structure
>3m9b_A Proteasome-associated ATPase; coil COIL with 5 beta-strand barrel inter domain, chaperone; 3.94A {Mycobacterium tuberculosis} PDB: 3m9d_A Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3m91_A Proteasome-associated ATPase; coil COIL alpha helix, ATP-binding, chaperone, nucleotide-BI proteasome, S-nitrosylation; 1.80A {Mycobacterium tuberculosis} PDB: 3m9h_A Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3efg_A Protein SLYX homolog; xanthomonas campestris PV. campestris, coiled-coil, structur genomics, PSI-2, protein structure initiative; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2hy6_A General control protein GCN4; protein design, parallel heptamer, protein structure, biosyn protein; 1.25A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2nrn_A 3crp_A 2b1f_A 3crp_B 2ipz_A 3ck4_A 3ck4_B 2b22_A 1ce9_A Back     alignment and structure
>1t2k_D Cyclic-AMP-dependent transcription factor ATF-2; protein DNA complex, transcription/DNA complex; 3.00A {Homo sapiens} SCOP: h.1.3.1 Back     alignment and structure
>2wt7_B Transcription factor MAFB; transcription, transcription regulation, nucleus, activator, repressor, DNA-binding, phosphoprotein, differentiation; 2.30A {Mus musculus} PDB: 2wty_A* 1k1v_A Back     alignment and structure
>2bni_A General control protein GCN4; four helix bundle, antiparallel four helix bundle acyl transferase; HET: TYZ; 1.5A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 2ccn_A 1w5k_A* 2ccf_A 2cce_A 1w5j_A* 1uo2_A 1gcl_A 1uo1_A 1unv_A 1uo0_A 1unt_A 1uo5_A 1unz_A 1unx_A 1unu_A 1unw_A 1uo4_A 1uo3_A 1uny_A 1u9f_A* ... Back     alignment and structure
>1fmh_A General control protein GCN4; coiled coil, leucine zipper, inter-helical ION pairing, transcription; NMR {Synthetic} SCOP: k.6.1.1 PDB: 1u2u_A Back     alignment and structure
>3mq7_A Bone marrow stromal antigen 2; HIV, antiviral protein; 2.28A {Homo sapiens} PDB: 3mqc_A 3mqb_A 3mkx_A 3nwh_A 2xg7_A* 2x7a_A Back     alignment and structure
>1uo4_A General control protein GCN4; four helix bundle, cavity, iodobenzene; 1.70A {Saccharomyces cerevisiae} SCOP: h.1.3.1 PDB: 1uo3_A 1unt_A 1uo5_A 1unu_A 1unv_A 1uo1_A 2ccf_A 2cce_A 1unx_A 1unw_A 1w5j_A* 1w5k_A* 1u9f_A* 3f86_A* 3f87_A* 3hez_A* 3c3f_A* Back     alignment and structure
>3i00_A HIP-I, huntingtin-interacting protein 1; transcription; 2.30A {Homo sapiens} PDB: 2qa7_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query153
d1sknp_74 Skn-1 {Caenorhabditis elegans [TaxId: 6239]} 98.29
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 87.66
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 84.54
>d1sknp_ a.37.1.1 (P:) Skn-1 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
class: All alpha proteins
fold: A DNA-binding domain in eukaryotic transcription factors
superfamily: A DNA-binding domain in eukaryotic transcription factors
family: A DNA-binding domain in eukaryotic transcription factors
domain: Skn-1
species: Caenorhabditis elegans [TaxId: 6239]

Probab=98.29  E-value=3e-07  Score=61.93  Aligned_cols=54  Identities=24%  Similarity=0.460  Sum_probs=46.0

Q ss_pred             cCHHHHhhhhhcCCCCCCC----------------CCCChhHHHHHHHHHHHHHhhHHHHHHHHhHHHHHH
Q psy3460          11 LTEEEKRTLQAEGYPIPTR----------------LPLTKTEEKSLKKIRRKIKNKISAQESRRKKKEYMD   65 (153)
Q Consensus        11 l~~ee~~~l~~~g~~~p~~----------------~p~t~~eek~~Kr~rR~lkNR~SAq~SR~RKKeyl~   65 (153)
                      .|.+|+++ ...+||+|..                .++|.+.-.-.+.+||.-|||+|||.||+||-....
T Consensus         3 ~srde~ra-~~~~iPfs~~~Iv~lpv~eFne~l~~~~Lte~Ql~lirDIRRRGKNKvAAqnCRKRKld~~d   72 (74)
T d1sknp_           3 QSKDEQLA-SDNELPVSAFQISEMSLSELQQVLKNESLSEYQRQLIRKIRRRGKNKVAARTCRQRRTDRHD   72 (74)
T ss_dssp             CCHHHHHH-HHTTCSSCHHHHHHSCHHHHHHHHHHSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTT
T ss_pred             cchHHHHH-HHcCCCccHHHHHHCCHHHHHHHHHhCCCCHHHHHHHHHHHHhcccHHHHHHHHHhhhhhhc
Confidence            46888888 6899888876                468888888899999999999999999999977543
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure