Psyllid ID: psy3630
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 172 | ||||||
| 149066347 | 262 | annexin A13 (predicted) [Rattus norvegic | 0.901 | 0.591 | 0.392 | 5e-27 | |
| 148697357 | 260 | annexin A13 [Mus musculus] | 0.901 | 0.596 | 0.386 | 7e-26 | |
| 350416896 | 323 | PREDICTED: annexin-B9-like isoform 2 [Bo | 0.744 | 0.396 | 0.464 | 1e-24 | |
| 340711743 | 323 | PREDICTED: annexin-B9-like [Bombus terre | 0.744 | 0.396 | 0.464 | 1e-24 | |
| 383858830 | 323 | PREDICTED: annexin-B9-like [Megachile ro | 0.808 | 0.430 | 0.441 | 2e-24 | |
| 350416894 | 323 | PREDICTED: annexin-B9-like isoform 1 [Bo | 0.633 | 0.337 | 0.504 | 1e-23 | |
| 340711745 | 323 | PREDICTED: annexin-B9-like [Bombus terre | 0.633 | 0.337 | 0.504 | 1e-23 | |
| 307194598 | 319 | Annexin-B9 [Harpegnathos saltator] | 0.732 | 0.394 | 0.468 | 3e-23 | |
| 307189396 | 618 | Annexin-B9 [Camponotus floridanus] | 0.720 | 0.200 | 0.453 | 5e-23 | |
| 332026255 | 404 | Annexin-B9 [Acromyrmex echinatior] | 0.720 | 0.306 | 0.474 | 7e-23 |
| >gi|149066347|gb|EDM16220.1| annexin A13 (predicted) [Rattus norvegicus] | Back alignment and taxonomy information |
|---|
Score = 125 bits (314), Expect = 5e-27, Method: Compositional matrix adjust.
Identities = 66/168 (39%), Positives = 105/168 (62%), Gaps = 13/168 (7%)
Query: 14 YLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKDDTSGDYK 73
Y A++L+ AM G+GT++ LI I+ TRS ++ DIK+ Y +++ +LE +KDDTSG+ +
Sbjct: 93 YAARQLQKAMKGLGTDEAMLIEILCTRSNKEIVDIKEAYQRLFGRSLESDVKDDTSGNLR 152
Query: 74 RLLVAL-------------SETSGSLEDGYLSIVRCVRDKSAYLAQRLENAMAGMGTNDR 120
++LV+L ETSG L+ YL+IVRC +D Y A L AM G+GT++
Sbjct: 153 KILVSLLQLIGKDMEEAIEEETSGDLKKAYLTIVRCAQDLEGYFADLLYKAMKGVGTDEE 212
Query: 121 TLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKVRNEEERRRWVWSI 168
TLIRIIVTR+E+DL IK + + Y+ +L + + + R+ + ++
Sbjct: 213 TLIRIIVTRAEVDLQGIKAKFQEKYQKSLSDMVHSDTSGDFRKLLVAL 260
|
Source: Rattus norvegicus Species: Rattus norvegicus Genus: Rattus Family: Muridae Order: Rodentia Class: Mammalia Phylum: Chordata Superkingdom: Eukaryota |
| >gi|148697357|gb|EDL29304.1| annexin A13 [Mus musculus] | Back alignment and taxonomy information |
|---|
| >gi|350416896|ref|XP_003491157.1| PREDICTED: annexin-B9-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340711743|ref|XP_003394429.1| PREDICTED: annexin-B9-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|383858830|ref|XP_003704902.1| PREDICTED: annexin-B9-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350416894|ref|XP_003491156.1| PREDICTED: annexin-B9-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340711745|ref|XP_003394430.1| PREDICTED: annexin-B9-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307194598|gb|EFN76887.1| Annexin-B9 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307189396|gb|EFN73806.1| Annexin-B9 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332026255|gb|EGI66394.1| Annexin-B9 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 172 | ||||||
| UNIPROTKB|P12429 | 323 | ANXA3 "Annexin A3" [Homo sapie | 0.436 | 0.232 | 0.493 | 1.5e-13 | |
| UNIPROTKB|F1M0L7 | 322 | Anxa3 "Annexin" [Rattus norveg | 0.436 | 0.232 | 0.48 | 1.9e-13 | |
| UNIPROTKB|F1LSV5 | 323 | Anxa3 "Annexin" [Rattus norveg | 0.436 | 0.232 | 0.48 | 1.9e-13 | |
| UNIPROTKB|F1M3H7 | 323 | Anxa3 "Annexin" [Rattus norveg | 0.436 | 0.232 | 0.48 | 1.9e-13 | |
| RGD|2119 | 324 | Anxa3 "annexin A3" [Rattus nor | 0.436 | 0.231 | 0.48 | 1.9e-13 | |
| FB|FBgn0000083 | 324 | AnxB9 "Annexin B9" [Drosophila | 0.761 | 0.404 | 0.425 | 1e-20 | |
| RGD|621172 | 673 | Anxa6 "annexin A6" [Rattus nor | 0.662 | 0.169 | 0.367 | 1.5e-14 | |
| UNIPROTKB|F1S0V3 | 529 | ANXA6 "Annexin" [Sus scrofa (t | 0.662 | 0.215 | 0.367 | 9.9e-15 | |
| UNIPROTKB|P79134 | 673 | ANXA6 "Annexin A6" [Bos taurus | 0.662 | 0.169 | 0.367 | 9.3e-15 | |
| UNIPROTKB|D4ABR6 | 667 | Anxa6 "Annexin" [Rattus norveg | 0.662 | 0.170 | 0.367 | 1.5e-14 |
| UNIPROTKB|P12429 ANXA3 "Annexin A3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 180 (68.4 bits), Expect = 1.5e-13, P = 1.5e-13
Identities = 37/75 (49%), Positives = 54/75 (72%)
Query: 5 LRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERI 64
+ CVR+ A+LA+RL A+ G+GT++ TL RI+V+RSEIDL DI+ ++ K Y +L I
Sbjct: 244 VNCVRNTPAFLAERLHRALKGIGTDEFTLNRIMVSRSEIDLLDIRTEFKKHYGYSLYSAI 303
Query: 65 KDDTSGDYKRLLVAL 79
K DTSGDY+ L+ +
Sbjct: 304 KSDTSGDYEITLLKI 318
|
|
| UNIPROTKB|F1M0L7 Anxa3 "Annexin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LSV5 Anxa3 "Annexin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M3H7 Anxa3 "Annexin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2119 Anxa3 "annexin A3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0000083 AnxB9 "Annexin B9" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| RGD|621172 Anxa6 "annexin A6" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S0V3 ANXA6 "Annexin" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P79134 ANXA6 "Annexin A6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4ABR6 Anxa6 "Annexin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 172 | |||
| pfam00191 | 66 | pfam00191, Annexin, Annexin | 6e-23 | |
| smart00335 | 53 | smart00335, ANX, Annexin repeats | 2e-18 | |
| pfam00191 | 66 | pfam00191, Annexin, Annexin | 5e-14 | |
| smart00335 | 53 | smart00335, ANX, Annexin repeats | 2e-09 |
| >gnl|CDD|201070 pfam00191, Annexin, Annexin | Back alignment and domain information |
|---|
Score = 86.0 bits (214), Expect = 6e-23
Identities = 33/66 (50%), Positives = 47/66 (71%)
Query: 14 YLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKDDTSGDYK 73
Y A+ L AM G+GT++ TLIRI+ TRS L I++ Y K+Y LE+ IK +TSGD++
Sbjct: 1 YDAELLRAAMKGLGTDEDTLIRILATRSNAQLQAIREAYKKLYGKDLEKDIKSETSGDFE 60
Query: 74 RLLVAL 79
+LL+AL
Sbjct: 61 KLLLAL 66
|
This family of annexins also includes giardin that has been shown to function as an annexin. Length = 66 |
| >gnl|CDD|197661 smart00335, ANX, Annexin repeats | Back alignment and domain information |
|---|
| >gnl|CDD|201070 pfam00191, Annexin, Annexin | Back alignment and domain information |
|---|
| >gnl|CDD|197661 smart00335, ANX, Annexin repeats | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 172 | |||
| KOG0819|consensus | 321 | 100.0 | ||
| KOG0819|consensus | 321 | 100.0 | ||
| PF00191 | 66 | Annexin: Annexin; InterPro: IPR018502 The annexins | 99.81 | |
| PF00191 | 66 | Annexin: Annexin; InterPro: IPR018502 The annexins | 99.8 | |
| smart00335 | 53 | ANX Annexin repeats. | 99.59 | |
| smart00335 | 53 | ANX Annexin repeats. | 99.58 |
| >KOG0819|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.8e-53 Score=343.19 Aligned_cols=170 Identities=42% Similarity=0.719 Sum_probs=168.2
Q ss_pred HhhhhhccCchHHHHHHHHHHHhCCCCCHHHHHHHHhhCCHHHHHHHHHHHHHhhcccHHHHHhhCcchhHHHHHHHh--
Q psy3630 2 RKHLRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKDDTSGDYKRLLVAL-- 79 (172)
Q Consensus 2 ~~~~~~~~~~~~~da~~l~~a~~g~g~de~~Li~il~~rs~~~l~~i~~~Y~~~yg~~L~~~i~~~~sg~~~~ll~~l-- 79 (172)
+.+++|+.||+++||.+|++||+|.|||+++||||+|+|||.|+++|+++|+..|+++|+++|.++|||+|+++|+.|
T Consensus 80 ~~i~al~~~p~~~DA~~l~~amkg~gtde~vlIEIlcTRT~~el~~i~~aY~~~y~~sLEeDI~s~TSG~frklLv~L~~ 159 (321)
T KOG0819|consen 80 RAIVALMKPPAEYDAKELKKAMKGLGTDEKVLIEILCTRTNEELRAIRQAYQELYKKSLEEDIASDTSGDFRKLLVSLVQ 159 (321)
T ss_pred HHHHHHcCCHHHhHHHHHHHHHhccCcchhhheeeeccCCHHHHHHHHHHHHHHHcccHHHHhhhccCchHHHHHHHHHh
Confidence 689999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred --------------------------------------------------------------------hhcCCchHHHHH
Q psy3630 80 --------------------------------------------------------------------SETSGSLEDGYL 91 (172)
Q Consensus 80 --------------------------------------------------------------------~e~sg~~~~al~ 91 (172)
.|++|+++++|+
T Consensus 160 ~~R~e~~~vd~~la~~dA~~L~~Age~k~gtde~~~~~Il~tRs~~qL~~vf~~y~~~~g~diek~I~~e~~gd~~~~ll 239 (321)
T KOG0819|consen 160 GNRDEGDRVDDALAKQDAQDLYEAGEKKWGTDEDKFIRILTTRSKAQLRLVFEEYQRISGKDIEKSIKEEFSGDFEKLLL 239 (321)
T ss_pred cCCccCCCcCHHHHHHHHHHHHHHhhhhccCcHHHHHHHHHhCCHHHHHHHHHHHHHhcchhHHHHHhhccCchHHHHHH
Confidence 999999999999
Q ss_pred HHHHHHhhhhHHHHHHHHhHhccCCcChhhhhhhhccCCHHHHHHHHHHHHHhhchhHHHHHhhcChHHHHHHHHHhccc
Q psy3630 92 SIVRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKVRNEEERRRWVWSIQRE 171 (172)
Q Consensus 92 ~~~~~~~~~~~~~a~~l~~A~~g~gtd~~~Li~il~~r~~~~~~~Ik~~y~~~yg~~L~~~i~~~~sG~~~~~ll~l~~~ 171 (172)
++++|++|||.|||+.||+||+|.|||+.+||||+++|++.||..|++.|+++||+||.++|+++|||||+++|++||+.
T Consensus 240 aiv~c~~n~~~yFA~~L~~amkg~GTdd~~LiRI~VsRsEiDl~~Ik~ef~~~Y~ksL~~~I~~dtsGdY~~~LlaL~g~ 319 (321)
T KOG0819|consen 240 AIVKCIRNPPAYFAERLRKAMKGLGTDDKTLIRIVVSRSEIDLLDIKEEFQRKYGKSLYSAIKGDTSGDYKKALLALLGG 319 (321)
T ss_pred HHHHHHcCHHHHHHHHHHHHHhccCCCccceeeeeeeHHHhhHHHHHHHHHHHhCccHHHHHhhhccchHHHHHHHHhCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999986
|
|
| >KOG0819|consensus | Back alignment and domain information |
|---|
| >PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] | Back alignment and domain information |
|---|
| >PF00191 Annexin: Annexin; InterPro: IPR018502 The annexins (or lipocortins) are a family of proteins that bind to phospholipids in a calcium-dependent manner [] | Back alignment and domain information |
|---|
| >smart00335 ANX Annexin repeats | Back alignment and domain information |
|---|
| >smart00335 ANX Annexin repeats | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 172 | ||||
| 1dm5_A | 315 | Annexin Xii E105k Homohexamer Crystal Structure Len | 1e-19 | ||
| 1aei_A | 315 | Crystal Structure Of The Annexin Xii Hexamer Length | 1e-19 | ||
| 1ann_A | 318 | Annexin Iv Length = 318 | 1e-19 | ||
| 1aow_A | 309 | Annexin Iv Length = 309 | 1e-19 | ||
| 1i4a_A | 318 | Crystal Structure Of Phosphorylation-Mimicking Muta | 1e-19 | ||
| 2zhi_A | 322 | Crystal Structure Analysis Of The Sodium-Bound Anne | 2e-19 | ||
| 1m9i_A | 672 | Crystal Structure Of Phosphorylation-Mimicking Muta | 3e-19 | ||
| 2zoc_A | 319 | Crystal Structure Of Recombinant Human Annexin Iv L | 5e-19 | ||
| 1w45_A | 327 | The 2.5 Angstroem Structure Of The K16a Mutant Of A | 2e-18 | ||
| 1w3w_A | 327 | The 2.1 Angstroem Resolution Structure Of Annexin A | 2e-18 | ||
| 1avc_A | 673 | Bovine Annexin Vi (Calcium-Bound) Length = 673 | 4e-18 | ||
| 1ala_A | 321 | Structure Of Chicken Annexin V At 2.25-Angstroms Re | 8e-17 | ||
| 1ain_A | 314 | Crystal Structure Of Human Annexin I At 2.5 Angstro | 8e-17 | ||
| 1ain_A | 314 | Crystal Structure Of Human Annexin I At 2.5 Angstro | 6e-14 | ||
| 1yii_A | 320 | Crystal Structures Of Chicken Annexin V In Complex | 9e-17 | ||
| 1hm6_A | 346 | X-Ray Structure Of Full-Length Annexin 1 Length = 3 | 3e-16 | ||
| 1hm6_A | 346 | X-Ray Structure Of Full-Length Annexin 1 Length = 3 | 4e-13 | ||
| 2h0m_A | 318 | Structure Of A Mutant Of Rat Annexin A5 Length = 31 | 4e-16 | ||
| 2h0m_A | 318 | Structure Of A Mutant Of Rat Annexin A5 Length = 31 | 5e-16 | ||
| 2h0l_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 4e-16 | ||
| 2h0l_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 7e-16 | ||
| 2h0k_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 4e-16 | ||
| 2h0k_A | 318 | Crystal Structure Of A Mutant Of Rat Annexin A5 Len | 7e-16 | ||
| 2ran_A | 316 | Rat Annexin V Crystal Structure: Ca2+-Induced Confo | 5e-16 | ||
| 1bcy_A | 319 | Recombinant Rat Annexin V, T72k Mutant Length = 319 | 5e-16 | ||
| 1bcw_A | 319 | Recombinant Rat Annexin V, T72a Mutant Length = 319 | 5e-16 | ||
| 1bcz_A | 319 | Recombinant Rat Annexin V, T72s Mutant Length = 319 | 6e-16 | ||
| 1g5n_A | 318 | Annexin V Complex With Heparin Oligosaccharides Len | 6e-16 | ||
| 1a8a_A | 319 | Rat Annexin V Complexed With Glycerophosphoserine L | 6e-16 | ||
| 1bc0_A | 319 | Recombinant Rat Annexin V, W185a Mutant Length = 31 | 6e-16 | ||
| 1n44_A | 319 | Crystal Structure Of Annexin V R23e Mutant Length = | 6e-16 | ||
| 1n42_A | 319 | Crystal Structure Of Annexin V R149e Mutant Length | 6e-16 | ||
| 1n41_A | 319 | Crystal Structure Of Annexin V K27e Mutant Length = | 6e-16 | ||
| 1hvf_A | 319 | Structural And Electrophysiological Analysis Of Ann | 9e-16 | ||
| 1anw_A | 319 | The Effect Of Metal Binding On The Structure Of Ann | 1e-15 | ||
| 1avh_A | 320 | Crystal And Molecular Structure Of Human Annexin V | 1e-15 | ||
| 1hvd_A | 319 | Structural And Electrophysiological Analysis Of Ann | 1e-15 | ||
| 1hve_A | 319 | Structural And Electrophysiological Analysis Of Ann | 1e-15 | ||
| 1bc3_A | 319 | Recombinant Rat Annexin V, Triple Mutant (T72k, S14 | 1e-15 | ||
| 1bc3_A | 319 | Recombinant Rat Annexin V, Triple Mutant (T72k, S14 | 2e-15 | ||
| 1sav_A | 320 | Human Annexin V With Proline Substitution By Thiopr | 2e-15 | ||
| 1bc1_A | 319 | Recombinant Rat Annexin V, Quadruple Mutant (T72k, | 2e-15 | ||
| 1axn_A | 323 | The High Resolution Structure Of Annexin Iii Shows | 2e-14 | ||
| 1axn_A | 323 | The High Resolution Structure Of Annexin Iii Shows | 2e-14 | ||
| 1aii_A | 323 | Annexin Iii Length = 323 | 2e-14 | ||
| 1aii_A | 323 | Annexin Iii Length = 323 | 2e-14 | ||
| 2xo2_A | 320 | Human Annexin V With Incorporated Methionine Analog | 2e-14 | ||
| 2xo2_A | 320 | Human Annexin V With Incorporated Methionine Analog | 2e-14 | ||
| 1xjl_A | 319 | Structure Of Human Annexin A2 In The Presence Of Ca | 2e-12 | ||
| 1xjl_A | 319 | Structure Of Human Annexin A2 In The Presence Of Ca | 2e-12 | ||
| 1w7b_A | 339 | Annexin A2: Does It Induce Membrane Aggregation By | 2e-12 | ||
| 1w7b_A | 339 | Annexin A2: Does It Induce Membrane Aggregation By | 2e-12 | ||
| 2hyu_A | 308 | Human Annexin A2 With Heparin Tetrasaccharide Bound | 2e-12 | ||
| 2hyu_A | 308 | Human Annexin A2 With Heparin Tetrasaccharide Bound | 2e-12 | ||
| 1ycn_A | 317 | X-Ray Structure Of Annexin From Arabidopsis Thalian | 3e-09 | ||
| 1ycn_A | 317 | X-Ray Structure Of Annexin From Arabidopsis Thalian | 2e-05 | ||
| 3brx_A | 317 | Crystal Structure Of Calcium-Bound Cotton Annexin G | 1e-06 | ||
| 3brx_A | 317 | Crystal Structure Of Calcium-Bound Cotton Annexin G | 5e-05 | ||
| 1n00_A | 321 | Annexin Gh1 From Cotton Length = 321 | 1e-06 | ||
| 1n00_A | 321 | Annexin Gh1 From Cotton Length = 321 | 5e-05 | ||
| 1dk5_A | 322 | Crystal Structure Of Annexin 24(Ca32) From Capsicum | 9e-06 |
| >pdb|1DM5|A Chain A, Annexin Xii E105k Homohexamer Crystal Structure Length = 315 | Back alignment and structure |
|
| >pdb|1AEI|A Chain A, Crystal Structure Of The Annexin Xii Hexamer Length = 315 | Back alignment and structure |
| >pdb|1ANN|A Chain A, Annexin Iv Length = 318 | Back alignment and structure |
| >pdb|1AOW|A Chain A, Annexin Iv Length = 309 | Back alignment and structure |
| >pdb|1I4A|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T6d Of Annexin Iv Length = 318 | Back alignment and structure |
| >pdb|2ZHI|A Chain A, Crystal Structure Analysis Of The Sodium-Bound Annexin A4 At 1.58 A Resolution Length = 322 | Back alignment and structure |
| >pdb|1M9I|A Chain A, Crystal Structure Of Phosphorylation-Mimicking Mutant T356d Of Annexin Vi Length = 672 | Back alignment and structure |
| >pdb|2ZOC|A Chain A, Crystal Structure Of Recombinant Human Annexin Iv Length = 319 | Back alignment and structure |
| >pdb|1W45|A Chain A, The 2.5 Angstroem Structure Of The K16a Mutant Of Annexin A8, Which Has An Intact N-Terminus. Length = 327 | Back alignment and structure |
| >pdb|1W3W|A Chain A, The 2.1 Angstroem Resolution Structure Of Annexin A8 Length = 327 | Back alignment and structure |
| >pdb|1AVC|A Chain A, Bovine Annexin Vi (Calcium-Bound) Length = 673 | Back alignment and structure |
| >pdb|1ALA|A Chain A, Structure Of Chicken Annexin V At 2.25-Angstroms Resolution Length = 321 | Back alignment and structure |
| >pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 | Back alignment and structure |
| >pdb|1AIN|A Chain A, Crystal Structure Of Human Annexin I At 2.5 Angstroms Resolution Length = 314 | Back alignment and structure |
| >pdb|1YII|A Chain A, Crystal Structures Of Chicken Annexin V In Complex With Ca2+ Length = 320 | Back alignment and structure |
| >pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 | Back alignment and structure |
| >pdb|1HM6|A Chain A, X-Ray Structure Of Full-Length Annexin 1 Length = 346 | Back alignment and structure |
| >pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0M|A Chain A, Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0L|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2H0K|A Chain A, Crystal Structure Of A Mutant Of Rat Annexin A5 Length = 318 | Back alignment and structure |
| >pdb|2RAN|A Chain A, Rat Annexin V Crystal Structure: Ca2+-Induced Conformational Changes Length = 316 | Back alignment and structure |
| >pdb|1BCY|A Chain A, Recombinant Rat Annexin V, T72k Mutant Length = 319 | Back alignment and structure |
| >pdb|1BCW|A Chain A, Recombinant Rat Annexin V, T72a Mutant Length = 319 | Back alignment and structure |
| >pdb|1BCZ|A Chain A, Recombinant Rat Annexin V, T72s Mutant Length = 319 | Back alignment and structure |
| >pdb|1G5N|A Chain A, Annexin V Complex With Heparin Oligosaccharides Length = 318 | Back alignment and structure |
| >pdb|1A8A|A Chain A, Rat Annexin V Complexed With Glycerophosphoserine Length = 319 | Back alignment and structure |
| >pdb|1BC0|A Chain A, Recombinant Rat Annexin V, W185a Mutant Length = 319 | Back alignment and structure |
| >pdb|1N44|A Chain A, Crystal Structure Of Annexin V R23e Mutant Length = 319 | Back alignment and structure |
| >pdb|1N42|A Chain A, Crystal Structure Of Annexin V R149e Mutant Length = 319 | Back alignment and structure |
| >pdb|1N41|A Chain A, Crystal Structure Of Annexin V K27e Mutant Length = 319 | Back alignment and structure |
| >pdb|1HVF|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1ANW|A Chain A, The Effect Of Metal Binding On The Structure Of Annexin V And Implications For Membrane Binding Length = 319 | Back alignment and structure |
| >pdb|1AVH|A Chain A, Crystal And Molecular Structure Of Human Annexin V After Refinement. Implications For Structure, Membrane Binding And Ion Channel Formation Of The Annexin Family Of Proteins Length = 320 | Back alignment and structure |
| >pdb|1HVD|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1HVE|A Chain A, Structural And Electrophysiological Analysis Of Annexin V Mutants. Mutagenesis Of Human Annexin V, An In Vitro Voltage-Gated Calcium Channel, Provides Information About The Structural Features Of The Ion Pathway, The Voltage Sensor And The Ion Selectivity Filter Length = 319 | Back alignment and structure |
| >pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 | Back alignment and structure |
| >pdb|1BC3|A Chain A, Recombinant Rat Annexin V, Triple Mutant (T72k, S144k, S228k) Length = 319 | Back alignment and structure |
| >pdb|1SAV|A Chain A, Human Annexin V With Proline Substitution By Thioproline Length = 320 | Back alignment and structure |
| >pdb|1BC1|A Chain A, Recombinant Rat Annexin V, Quadruple Mutant (T72k, S144k, S228k, S303k) Length = 319 | Back alignment and structure |
| >pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 | Back alignment and structure |
| >pdb|1AXN|A Chain A, The High Resolution Structure Of Annexin Iii Shows Differences With Annexin V Length = 323 | Back alignment and structure |
| >pdb|1AII|A Chain A, Annexin Iii Length = 323 | Back alignment and structure |
| >pdb|1AII|A Chain A, Annexin Iii Length = 323 | Back alignment and structure |
| >pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 | Back alignment and structure |
| >pdb|2XO2|A Chain A, Human Annexin V With Incorporated Methionine Analogue Azidohomoalanine Length = 320 | Back alignment and structure |
| >pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 | Back alignment and structure |
| >pdb|1XJL|A Chain A, Structure Of Human Annexin A2 In The Presence Of Calcium Ions Length = 319 | Back alignment and structure |
| >pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 | Back alignment and structure |
| >pdb|1W7B|A Chain A, Annexin A2: Does It Induce Membrane Aggregation By A New Multimeric State Of The Protein Length = 339 | Back alignment and structure |
| >pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 | Back alignment and structure |
| >pdb|2HYU|A Chain A, Human Annexin A2 With Heparin Tetrasaccharide Bound Length = 308 | Back alignment and structure |
| >pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 | Back alignment and structure |
| >pdb|1YCN|A Chain A, X-Ray Structure Of Annexin From Arabidopsis Thaliana Gene At1g35720 Length = 317 | Back alignment and structure |
| >pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 | Back alignment and structure |
| >pdb|3BRX|A Chain A, Crystal Structure Of Calcium-Bound Cotton Annexin Gh1 Length = 317 | Back alignment and structure |
| >pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 | Back alignment and structure |
| >pdb|1N00|A Chain A, Annexin Gh1 From Cotton Length = 321 | Back alignment and structure |
| >pdb|1DK5|A Chain A, Crystal Structure Of Annexin 24(Ca32) From Capsicum Annuum Length = 322 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 172 | |||
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 7e-33 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 5e-28 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 3e-27 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 4e-26 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 7e-26 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 6e-25 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 7e-25 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 1e-24 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 1e-32 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 2e-21 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 4e-21 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 5e-17 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 2e-31 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 6e-27 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 2e-24 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 2e-23 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 3e-29 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 4e-25 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 1e-24 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 1e-24 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 3e-29 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 2e-25 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 3e-25 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 2e-24 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 6e-29 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 6e-27 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 4e-26 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 2e-25 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 8e-29 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 2e-26 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 2e-26 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 6e-25 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 2e-28 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 1e-26 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 2e-25 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 3e-25 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 6e-28 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 8e-26 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 1e-25 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 8e-25 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 2e-27 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 7e-26 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 2e-25 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 5e-23 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 9e-24 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 3e-22 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 3e-19 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 5e-13 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 1e-23 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 1e-23 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 4e-21 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 1e-19 |
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
Score = 122 bits (306), Expect = 7e-33
Identities = 60/177 (33%), Positives = 88/177 (49%), Gaps = 23/177 (12%)
Query: 1 MRKHLRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTL 60
M ++C+R Y A+RL AM G+GT D TLIRI+V+RSE+D+ DI++ + YE +L
Sbjct: 241 MLAVVKCIRSTPEYFAERLFKAMKGLGTRDNTLIRIMVSRSELDMLDIREIFRTKYEKSL 300
Query: 61 EERIKDDTSGDYKRLLVAL----------------------SETSGSLEDGYLSIVRCVR 98
IK+DTSG+YK+ L+ L E S VR
Sbjct: 301 YSMIKNDTSGEYKKTLLKLSGGDDDAAGQFFPEAAQVAYQMWELSAVARVELKGDVRPAN 360
Query: 99 DKSAYL-AQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIK 154
D + A+ L AM G+GT++ T+I II RS + I+Q + + L +K
Sbjct: 361 DFNPDADAKALRKAMKGLGTDEDTIIDIITHRSNVQRQQIRQTFKSHFGRDLMTDLK 417
|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A Length = 672 | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A Length = 310 | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A Length = 321 | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A Length = 346 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A Length = 327 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A Length = 308 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A Length = 323 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A Length = 322 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A Length = 315 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... Length = 320 | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A Length = 295 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A Length = 337 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 172 | |||
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 100.0 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 100.0 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 100.0 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 100.0 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 100.0 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 100.0 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 100.0 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 100.0 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 100.0 | |
| 1m9i_A | 672 | Annexin VI; calcium-binding, membrane-binding, pho | 100.0 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 100.0 | |
| 1n00_A | 321 | Annexin GH1; membrane-binding, calcium-binding, me | 100.0 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 100.0 | |
| 1yii_A | 320 | Annexin A5, annexin V, lipocortin V, endonexin II; | 100.0 | |
| 1dm5_A | 315 | Annexin XII E105K mutant homohexamer; novel PH-dep | 100.0 | |
| 1w3w_A | 327 | Annexin A8; coagulation, annexin family, calcium a | 100.0 | |
| 2zhj_A | 322 | Annexin A4; zynogen granule, membrane binding prot | 100.0 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 100.0 | |
| 1axn_A | 323 | Annexin III; annexin family, calcium/phospholipid- | 100.0 | |
| 2hyv_A | 308 | Annexin A2; calcium-binding protein, membrane-bind | 100.0 | |
| 1hm6_A | 346 | Annexin 1; phospholipid/Ca(2+)-binding protein, ca | 100.0 | |
| 4evf_A | 295 | Alpha-1 giardin, giardin subunit alpha-1; annexin, | 100.0 | |
| 3chj_A | 337 | Alpha-14 giardin; calcium-binding, annexin, metal | 100.0 | |
| 2ii2_A | 310 | Alpha-11 giardin; helix-turn-helix, metal binding | 100.0 |
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.4e-48 Score=320.03 Aligned_cols=170 Identities=41% Similarity=0.601 Sum_probs=167.1
Q ss_pred HhhhhhccCchHHHHHHHHHHHhCCCCCHHHHHHHHhhCCHHHHHHHHHHHHHhhcccHHHHHhhCcchhHHHHHHHh--
Q psy3630 2 RKHLRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKDDTSGDYKRLLVAL-- 79 (172)
Q Consensus 2 ~~~~~~~~~~~~~da~~l~~a~~g~g~de~~Li~il~~rs~~~l~~i~~~Y~~~yg~~L~~~i~~~~sg~~~~ll~~l-- 79 (172)
++++.|+.+|+++||..|++|++|+|||+..||+|||+||+.|+++|+++|++.||++|+++|++++||+|+++|+++
T Consensus 85 ~ll~~l~~~~~~~DA~~L~~A~~g~Gtde~~lieIL~tRs~~ql~~i~~~Y~~~yg~sLe~dI~~e~sG~~~~~L~~lv~ 164 (327)
T 1w3w_A 85 RLIVALMYPPYRYEAKELHDAMKGLGTKEGVIIEILASRTKNQLREIMKAYEEDYGSSLEEDIQADTSGYLERILVCLLQ 164 (327)
T ss_dssp HHHHHHHSCTTHHHHHHHHHHHHSSSCCHHHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHS
T ss_pred HHHHHhcCCHHHHHHHHHHHHhhccCCCHHHHHHHHHhCCHHHHHHHHHHHHHHhCccHHHHHhhccCchHHHHHHHHHH
Confidence 578999999999999999999999999999999999999999999999999999999999999999999999999987
Q ss_pred ---------------------------------------------------------------------hhcCCchHHHH
Q psy3630 80 ---------------------------------------------------------------------SETSGSLEDGY 90 (172)
Q Consensus 80 ---------------------------------------------------------------------~e~sg~~~~al 90 (172)
+|+||+++++|
T Consensus 165 ~~r~~~~~~vd~~~a~~DA~~L~~A~~~~~GTde~~lirIl~tRs~~~L~~i~~~Y~~~~g~~L~~~I~~e~sGd~~~~L 244 (327)
T 1w3w_A 165 GSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVFEEYEKIANKSIEDSIKSETHGSLEEAM 244 (327)
T ss_dssp CCCCCCCSCCCHHHHHHHHHHHHHHHHCSSSCCHHHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHH
T ss_pred hccCCcccccCHHHHHHHHHHHHHHhhCcCCCcHhHhhHHHhcCCHHHHHHHHHHHHHHHCCCHHHHHhhhcCCcHHHHH
Confidence 99999999999
Q ss_pred HHHHHHHhhhhHHHHHHHHhHhccCCcChhhhhhhhccCCHHHHHHHHHHHHHhhchhHHHHHhhcChHHHHHHHHHhcc
Q psy3630 91 LSIVRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKVRNEEERRRWVWSIQR 170 (172)
Q Consensus 91 ~~~~~~~~~~~~~~a~~l~~A~~g~gtd~~~Li~il~~r~~~~~~~Ik~~y~~~yg~~L~~~i~~~~sG~~~~~ll~l~~ 170 (172)
+++++|++||+.++|+.|++||+|.|||+++|||++++|++.|+..|+++|+++||++|.++|+++|||||+++|++||+
T Consensus 245 lalv~~~~~~~~~fA~~L~~amkg~GTdd~~LiriivsR~e~dl~~Ik~~y~~~yg~sL~~~I~~~tsGdy~~~LlaL~~ 324 (327)
T 1w3w_A 245 LTVVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVG 324 (327)
T ss_dssp HHHHHHHHCHHHHHHHHHHHHHSSSSCCHHHHHHHHHHHTTTTHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHHHHHC
T ss_pred HHHHHHcCCHHHHHHHHHHhhccCCCCChhHeeeeeeECCHHHHHHHHHHHHHHhCCcHHHHHhhhCChHHHHHHHHHhC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999997
Q ss_pred c
Q psy3630 171 E 171 (172)
Q Consensus 171 ~ 171 (172)
+
T Consensus 325 ~ 325 (327)
T 1w3w_A 325 S 325 (327)
T ss_dssp C
T ss_pred C
Confidence 5
|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A | Back alignment and structure |
|---|
| >1m9i_A Annexin VI; calcium-binding, membrane-binding, phosphorylation, mutant T356D, lipid binding protein; 2.65A {Homo sapiens} SCOP: a.65.1.1 a.65.1.1 PDB: 1avc_A | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A | Back alignment and structure |
|---|
| >1n00_A Annexin GH1; membrane-binding, calcium-binding, membrane protein; 2.10A {Gossypium hirsutum} SCOP: a.65.1.1 PDB: 3brx_A 1ycn_A 2q4c_A 1dk5_A | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A | Back alignment and structure |
|---|
| >1yii_A Annexin A5, annexin V, lipocortin V, endonexin II; membrane binding, matrix vessicle, protein and metal binding protein; 1.42A {Gallus gallus} PDB: 1yj0_A 1ala_A 1hvd_A 1anx_A 1anw_A 1avh_A 1avr_A 1hak_B* 1hvf_A 1hve_A 1hvg_A 1a8a_A* 1a8b_A* 2ie7_A 1g5n_A 2ie6_A 1bcz_A 1n41_A 1bcw_A 2ran_A ... | Back alignment and structure |
|---|
| >1dm5_A Annexin XII E105K mutant homohexamer; novel PH-dependent hexamerization switch E76, low calcium form; 1.93A {Hydra vulgaris} SCOP: a.65.1.1 PDB: 1aei_A | Back alignment and structure |
|---|
| >1w3w_A Annexin A8; coagulation, annexin family, calcium and phospholipid binding proteins; 1.99A {Homo sapiens} PDB: 1w45_A | Back alignment and structure |
|---|
| >2zhj_A Annexin A4; zynogen granule, membrane binding protein, metal binding protein, calcium, calcium/phospholipid-binding; 1.35A {Rattus norvegicus} PDB: 2zhi_A 2zoc_A 1ann_A 1i4a_A 1aow_A | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A | Back alignment and structure |
|---|
| >1axn_A Annexin III; annexin family, calcium/phospholipid-binding protein complex; 1.78A {Homo sapiens} SCOP: a.65.1.1 PDB: 1aii_A | Back alignment and structure |
|---|
| >2hyv_A Annexin A2; calcium-binding protein, membrane-binding protein, helix BUN heparin, hexasaccharide, metal binding protein; HET: UAP SGN IDS; 1.42A {Homo sapiens} PDB: 2hyu_A* 2hyw_A 1w7b_A 1xjl_A | Back alignment and structure |
|---|
| >1hm6_A Annexin 1; phospholipid/Ca(2+)-binding protein, calcium-free form, FULL-length protein comprising protein core and N-terminal domain, metal; 1.80A {Sus scrofa} SCOP: a.65.1.1 PDB: 1mcx_A 1ain_A 1bo9_A | Back alignment and structure |
|---|
| >4evf_A Alpha-1 giardin, giardin subunit alpha-1; annexin, calcium-binding protein, membrane-binding protein, binding protein; 1.90A {Giardia intestinalis} PDB: 4evh_A | Back alignment and structure |
|---|
| >3chj_A Alpha-14 giardin; calcium-binding, annexin, metal binding protein; 1.60A {Giardia lamblia} PDB: 3chk_A 3chl_A | Back alignment and structure |
|---|
| >2ii2_A Alpha-11 giardin; helix-turn-helix, metal binding protein; 1.10A {Giardia intestinalis} PDB: 2iic_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 172 | ||||
| d1hm6a_ | 343 | a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: | 2e-30 | |
| d1hm6a_ | 343 | a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: | 3e-30 | |
| d1hm6a_ | 343 | a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: | 3e-23 | |
| d1hm6a_ | 343 | a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: | 2e-17 | |
| d1n00a_ | 318 | a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu | 2e-30 | |
| d1n00a_ | 318 | a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu | 1e-28 | |
| d1n00a_ | 318 | a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu | 8e-22 | |
| d1n00a_ | 318 | a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsu | 6e-17 | |
| d1avca2 | 321 | a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) | 3e-30 | |
| d1avca2 | 321 | a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) | 3e-28 | |
| d1avca2 | 321 | a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) | 1e-21 | |
| d1avca2 | 321 | a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) | 8e-17 | |
| d1axna_ | 323 | a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T | 2e-29 | |
| d1axna_ | 323 | a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T | 6e-29 | |
| d1axna_ | 323 | a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T | 4e-23 | |
| d1axna_ | 323 | a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [T | 1e-18 | |
| d2ie7a1 | 318 | a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic | 2e-29 | |
| d2ie7a1 | 318 | a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic | 2e-28 | |
| d2ie7a1 | 318 | a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic | 3e-24 | |
| d2ie7a1 | 318 | a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegic | 8e-19 | |
| d1avca1 | 341 | a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ | 3e-29 | |
| d1avca1 | 341 | a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ | 6e-28 | |
| d1avca1 | 341 | a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ | 2e-22 | |
| d1avca1 | 341 | a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [ | 4e-18 | |
| d1dm5a_ | 315 | a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: | 1e-28 | |
| d1dm5a_ | 315 | a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: | 1e-27 | |
| d1dm5a_ | 315 | a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: | 3e-22 | |
| d1dm5a_ | 315 | a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: | 3e-16 | |
| d1w7ba_ | 319 | a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta | 4e-28 | |
| d1w7ba_ | 319 | a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta | 2e-27 | |
| d1w7ba_ | 319 | a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta | 1e-22 | |
| d1w7ba_ | 319 | a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [Ta | 7e-17 | |
| d1i4aa_ | 309 | a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: | 1e-27 | |
| d1i4aa_ | 309 | a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: | 4e-26 | |
| d1i4aa_ | 309 | a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: | 6e-23 | |
| d1i4aa_ | 309 | a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: | 2e-17 | |
| d1bo9a_ | 73 | a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax | 1e-21 | |
| d1bo9a_ | 73 | a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [Tax | 3e-13 |
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Annexin superfamily: Annexin family: Annexin domain: Annexin I species: Pig (Sus scrofa) [TaxId: 9823]
Score = 111 bits (278), Expect = 2e-30
Identities = 46/140 (32%), Positives = 69/140 (49%), Gaps = 15/140 (10%)
Query: 16 AQRLENA-MAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKDDTSGDYKR 74
A+ L A GT+ I I+ TRS L + Q Y K + + + +
Sbjct: 202 ARALYEAGERRKGTDLNVFITILTTRSYPHLRRVFQKYSKYSKHDMNKVLD--------- 252
Query: 75 LLVALSETSGSLEDGYLSIVRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDL 134
E G +E+ +V+C K + A++L AM G+GT +TLIRI+V+RSEID+
Sbjct: 253 -----LELKGDIENCLTVVVKCATSKPMFFAEKLHQAMKGIGTRHKTLIRIMVSRSEIDM 307
Query: 135 GDIKQDYLKMYETTLEERIK 154
DIK Y K+Y +L + I
Sbjct: 308 NDIKACYQKLYGISLCQAIL 327
|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} Length = 343 | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} Length = 318 | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 321 | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} Length = 323 | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 318 | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} Length = 341 | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} Length = 315 | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} Length = 319 | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} Length = 309 | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} Length = 73 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 172 | |||
| d1avca2 | 321 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1avca1 | 341 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1i4aa_ | 309 | Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1axna_ | 323 | Annexin III {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1w7ba_ | 319 | Annexin II {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1n00a_ | 318 | Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 | 100.0 | |
| d1hm6a_ | 343 | Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1dm5a_ | 315 | Annexin XII {Hydra vulgaris [TaxId: 6087]} | 100.0 | |
| d2ie7a1 | 318 | Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | 100.0 | |
| d1n00a_ | 318 | Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3 | 100.0 | |
| d1avca2 | 321 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1w7ba_ | 319 | Annexin II {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1hm6a_ | 343 | Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | 100.0 | |
| d1axna_ | 323 | Annexin III {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1dm5a_ | 315 | Annexin XII {Hydra vulgaris [TaxId: 6087]} | 100.0 | |
| d2ie7a1 | 318 | Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | 100.0 | |
| d1avca1 | 341 | Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1i4aa_ | 309 | Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1bo9a_ | 73 | Annexin I {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d1bo9a_ | 73 | Annexin I {Human (Homo sapiens) [TaxId: 9606]} | 99.83 |
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Annexin superfamily: Annexin family: Annexin domain: Annexin VI species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=9e-48 Score=316.10 Aligned_cols=169 Identities=35% Similarity=0.622 Sum_probs=166.5
Q ss_pred HhhhhhccCchHHHHHHHHHHHhCCCCCHHHHHHHHhhCCHHHHHHHHHHHHHhhcccHHHHHhhCcchhHHHHHHHh--
Q psy3630 2 RKHLRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKDDTSGDYKRLLVAL-- 79 (172)
Q Consensus 2 ~~~~~~~~~~~~~da~~l~~a~~g~g~de~~Li~il~~rs~~~l~~i~~~Y~~~yg~~L~~~i~~~~sg~~~~ll~~l-- 79 (172)
++++.|+.+|+++||..||+|++|.|||+..|++|+|+|||.||..|+++|+..|+++|+++|.+++||+|+++|++|
T Consensus 77 ~~l~~l~~~p~~~dA~~l~~A~kG~gtde~~LieIl~trs~~el~~ik~aY~~~y~~~L~~di~~~~sG~~~~ll~~ll~ 156 (321)
T d1avca2 77 RLILGLMMPPAHYDAKQLKKAMEGAGTDEKALIEILATRTNAEIQAINKAYKEDYHKTLEDALSSDTSGHFKRILISLAT 156 (321)
T ss_dssp HHHHHHHSCHHHHHHHHHHHHTSSSSCCHHHHHHHHTTCCHHHHHHHHHHHHHHSSSCHHHHHHHHCCHHHHHHHHHHTT
T ss_pred HHHHHHhCChhHHHHHHHHHHhhcCCchHHHHHHHHhcCCHHHHHHHHHHHHHHhcCcHHHHhHhhcCccHHHHHHHHHh
Confidence 578999999999999999999999999999999999999999999999999999999999999999999999999988
Q ss_pred -------------------------------------------------------------------------hhcCCch
Q psy3630 80 -------------------------------------------------------------------------SETSGSL 86 (172)
Q Consensus 80 -------------------------------------------------------------------------~e~sg~~ 86 (172)
+|+||++
T Consensus 157 ~~R~e~~~~~~~a~~da~~~~~~~~l~~a~~g~~~tde~~~i~Il~~RS~~qL~~i~~~Y~~~~g~~l~~~i~~e~sG~~ 236 (321)
T d1avca2 157 GNREEGGEDRERAREDAQVAAEILEIADTTSGDKSSLETRFMMILCTRSYPDLRRVFQEFVKMTNYDVEHTIKKEMSGDV 236 (321)
T ss_dssp CCCCCSCCCHHHHHHHHHHHHHHC--------------CHHHHHHHHSCHHHHHHHHHHHHHHHSSCHHHHHHHHCCHHH
T ss_pred cccccCCcchhhhhhhHHHHHHHHHHHHhccCCCcccHHHHhHhHhcCCHHHHHHHHHHHHHhcCchHHHHHHHhcCCCH
Confidence 9999999
Q ss_pred HHHHHHHHHHHhhhhHHHHHHHHhHhccCCcChhhhhhhhccCCHHHHHHHHHHHHHhhchhHHHHHhhcChHHHHHHHH
Q psy3630 87 EDGYLSIVRCVRDKSAYLAQRLENAMAGMGTNDRTLIRIIVTRSEIDLGDIKQDYLKMYETTLEERIKVRNEEERRRWVW 166 (172)
Q Consensus 87 ~~al~~~~~~~~~~~~~~a~~l~~A~~g~gtd~~~Li~il~~r~~~~~~~Ik~~y~~~yg~~L~~~i~~~~sG~~~~~ll 166 (172)
+++|+++++|+.||+.++|+.|++||+|+|||+..||||+++|++.|+..|+.+|+++||++|+++|+++|||||+++|+
T Consensus 237 ~~~l~~iv~~~~~~~~~~A~~L~~Am~G~Gtdd~~LiRiivsRse~dl~~Ik~~y~~~yg~sL~~~I~~etsGdy~~~Ll 316 (321)
T d1avca2 237 RDVFVAIVQSVKNKPLFFADKLYKSMKGAGTEEKTLTRIMVSRSEIDLLNIRREFIEKYDKSLHQAIEGDTSGHFLKALL 316 (321)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTSSSSCCHHHHHHHHHHTTTTTHHHHHHHHHHHHSSCHHHHHHHHCCHHHHHHHH
T ss_pred HHHHHHHHHHHhccHHHHHHHHHHHhccCCCChhhheeeeeeccHHHHHHHHHHHHHHhCCcHHHHHhhhCCcHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred Hhcc
Q psy3630 167 SIQR 170 (172)
Q Consensus 167 ~l~~ 170 (172)
+||+
T Consensus 317 aL~g 320 (321)
T d1avca2 317 AICG 320 (321)
T ss_dssp HHHT
T ss_pred HHcC
Confidence 9986
|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1n00a_ a.65.1.1 (A:) Annexin GH1 {Cotton (Gossypium hirsutum) [TaxId: 3635]} | Back information, alignment and structure |
|---|
| >d1avca2 a.65.1.1 (A:351-671) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w7ba_ a.65.1.1 (A:) Annexin II {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hm6a_ a.65.1.1 (A:) Annexin I {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1axna_ a.65.1.1 (A:) Annexin III {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dm5a_ a.65.1.1 (A:) Annexin XII {Hydra vulgaris [TaxId: 6087]} | Back information, alignment and structure |
|---|
| >d2ie7a1 a.65.1.1 (A:2-319) Annexin V {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1avca1 a.65.1.1 (A:10-350) Annexin VI {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1i4aa_ a.65.1.1 (A:) Annexin IV {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bo9a_ a.65.1.1 (A:) Annexin I {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|