Psyllid ID: psy3685
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1042 | ||||||
| 328706819 | 818 | PREDICTED: zinc finger protein 91-like [ | 0.668 | 0.852 | 0.397 | 1e-142 | |
| 358417009 | 1448 | PREDICTED: LOW QUALITY PROTEIN: zinc fin | 0.664 | 0.477 | 0.399 | 1e-138 | |
| 296477336 | 699 | TPA: zinc finger protein 107 [Bos taurus | 0.580 | 0.865 | 0.442 | 1e-135 | |
| 358417007 | 925 | PREDICTED: LOW QUALITY PROTEIN: zinc fin | 0.591 | 0.665 | 0.423 | 1e-132 | |
| 328705603 | 735 | PREDICTED: zinc finger protein 62 homolo | 0.573 | 0.813 | 0.420 | 1e-130 | |
| 426244178 | 1003 | PREDICTED: zinc finger protein 845-like | 0.581 | 0.604 | 0.401 | 1e-127 | |
| 328711363 | 643 | PREDICTED: zinc finger protein 845-like | 0.567 | 0.919 | 0.406 | 1e-124 | |
| 328711727 | 761 | PREDICTED: zinc finger protein 91-like [ | 0.647 | 0.886 | 0.366 | 1e-124 | |
| 334347751 | 1243 | PREDICTED: zinc finger protein 91-like [ | 0.661 | 0.554 | 0.390 | 1e-123 | |
| 328726602 | 740 | PREDICTED: zinc finger protein Xfin-like | 0.645 | 0.909 | 0.365 | 1e-123 |
| >gi|328706819|ref|XP_003243211.1| PREDICTED: zinc finger protein 91-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 513 bits (1321), Expect = e-142, Method: Compositional matrix adjust.
Identities = 301/758 (39%), Positives = 429/758 (56%), Gaps = 61/758 (8%)
Query: 9 YKCDLCSKEFSRKYNLTDHKKIHQGIR-YKCNLCSKEFSRKYNLTDHKKIHQGIR-YKCN 66
Y CD+C K FS LT HK+ H G + Y C++C K FS NLT H+++H G + + C+
Sbjct: 34 YACDVCEKSFSESSQLTKHKRTHTGEKPYACDVCEKSFSTSSNLTIHRRMHTGEKPFPCD 93
Query: 67 LCSKEFSRNCYLTEHMEQHQGIR-YKCDLCSKDFSYKSSLIEHKKLHQGIR-YKCNLCSK 124
+C K FS++ LT H H G + Y CD+C K F S+ H++ H G + Y C++C K
Sbjct: 94 VCEKSFSQSGNLTAHRHTHTGEKPYACDVCDKSFPTSSNFTTHRRTHTGEKPYACDVCEK 153
Query: 125 EFSRNCYLTEHMEQHQGIR-YKCDLCSKDFSYKSSLIEHKKLHQGIR-YKCNLCSKEYFF 182
FS LT+H H G + YKCD+C K FS S+L H++ H G + Y C++C K +
Sbjct: 154 SFSEIGSLTKHKRTHTGEKPYKCDVCEKSFSTSSNLTTHRRTHTGEKPYACDVCEKSFSA 213
Query: 183 KRNLTEHKKLHQGIR-YNCDLCSKEFSRKDNLTDHKKMHQG-----------------NL 224
+LT H+++H G + + CD+C K FS+ NL H++ H G +L
Sbjct: 214 STDLTIHRRMHTGEKPFPCDVCEKSFSQSGNLIAHRRTHTGEKPYACDVCEKSFSESSHL 273
Query: 225 TKHMKLHQGIR-YKCDLCLKEFSRKDNLTEHKEIHQGIR-YKCDLCSKKFSRKLNLTKHM 282
T+H + H G + Y CD+C K FS +LT H+ +H G + + CD+C K FS+ NL H
Sbjct: 274 TRHKRTHTGEKPYACDVCEKSFSTSTDLTIHRRMHTGEKPFPCDVCDKSFSKSGNLIAHR 333
Query: 283 KIHQGIR-YKCDLCSKEFSRKGNLTKHMKLHQGIR-YK---CDLCLKEFSRKDNLTEHKE 337
++H G + Y CD+C K F+ G+LTKH + H G + YK CD+C K FS NLT H+
Sbjct: 334 RMHTGEKPYACDVCEKSFTESGSLTKHRRTHTGEKPYKLNQCDVCDKSFSESTNLTIHRR 393
Query: 338 IHQGIR-YKCDLCSKKFSRKLNLTKHMKIHQGIR-YKCDLCSKEFSRKGNLTKHMKLHQG 395
+H G + + CD+C K FS+ NLT H + H G + + CD+C K FS+ NLT H + H G
Sbjct: 394 MHTGEKPFPCDVCEKSFSQSGNLTAHRRTHTGEKPFLCDVCDKSFSKSTNLTTHRRTHTG 453
Query: 396 IR-YKCDLCLKEFSRKDNLTEHKEIHQGIR-YKCDLCSKKFSRKLNLTKHMKIHQGIR-Y 452
+ Y CD+C K FS NLT+HK+ H G + Y CD+C K FS +LTKH + H G + Y
Sbjct: 454 EKPYACDVCEKSFSESGNLTKHKQTHTGEKPYACDVCEKSFSESSHLTKHKRTHTGEKPY 513
Query: 453 KCDLCSKEFSRKGNLTKHMKLHQGIR-YKCDLCLKEFSRKDNLT-DRKIHQGIR-YKCDL 509
CD+C K FS+ GNLTKH + H G + Y CD+C K F +LT R++H G + Y CD+
Sbjct: 514 ACDVCEKSFSQSGNLTKHKRTHTGEKPYACDVCEKSFPTSTDLTIHRRMHTGEKPYACDV 573
Query: 510 CSKEFSSKGNLTEHMKQHQGIR-YKCDLCSKEFSRKDNLTEHKEIHQGIR-YKCDLCSKE 567
C K FS +LT+H + H G + Y CD+C K FS NLT H+ +H G + + CD+C K
Sbjct: 574 CEKSFSQSSHLTKHKRTHTGEKPYACDVCEKSFSESSNLTIHRRMHTGEKPFPCDVCEKS 633
Query: 568 FSRKDNLTEHKEIHQGIR-YKCDLCSKKFSRKLNLTKHMKIHQGIR-YKCDLCSKEFSRK 625
FS+ NLT H+ +H G + Y CD+C K FS +LTKH + H G + Y CD+C K FS
Sbjct: 634 FSKSGNLTVHQRMHTGEKPYACDVCEKSFSESGSLTKHKRTHTGEKPYACDVCEKSFSES 693
Query: 626 ------------DIPYEVTVKEESYEGD---SINVEENNGNDAVTRD-CLEFFKTEQNTT 669
+ PY V E+ + +I+ + G D C + F N T
Sbjct: 694 SHLTRHKRTHIGEKPYACDVCEKLFSASTDLTIHRRMHTGEKPFPCDVCEKSFSKSSNLT 753
Query: 670 LGKLNKILHQDIRYKCDLCSKDFSRKDNLTEHKEIHQG 707
+ ++ + + CD+C K FS+ NLT H+ H G
Sbjct: 754 AHR--RMHTGEKPFPCDVCEKSFSQSGNLTAHRRTHTG 789
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|358417009|ref|XP_002702020.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 91, partial [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|296477336|tpg|DAA19451.1| TPA: zinc finger protein 107 [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|358417007|ref|XP_002702019.2| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 91 [Bos taurus] | Back alignment and taxonomy information |
|---|
| >gi|328705603|ref|XP_003242853.1| PREDICTED: zinc finger protein 62 homolog [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|426244178|ref|XP_004015904.1| PREDICTED: zinc finger protein 845-like [Ovis aries] | Back alignment and taxonomy information |
|---|
| >gi|328711363|ref|XP_001946669.2| PREDICTED: zinc finger protein 845-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328711727|ref|XP_001946236.2| PREDICTED: zinc finger protein 91-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|334347751|ref|XP_001372793.2| PREDICTED: zinc finger protein 91-like [Monodelphis domestica] | Back alignment and taxonomy information |
|---|
| >gi|328726602|ref|XP_003248963.1| PREDICTED: zinc finger protein Xfin-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 1042 | ||||||
| UNIPROTKB|F1MX34 | 1053 | F1MX34 "Uncharacterized protei | 0.650 | 0.643 | 0.404 | 3.8e-149 | |
| UNIPROTKB|Q96IR2 | 970 | ZNF845 "Zinc finger protein 84 | 0.646 | 0.694 | 0.409 | 4.2e-143 | |
| UNIPROTKB|G3N2G8 | 759 | ZNF397 "Zinc finger protein 39 | 0.656 | 0.901 | 0.383 | 1.5e-138 | |
| UNIPROTKB|F1MP77 | 833 | F1MP77 "Uncharacterized protei | 0.652 | 0.816 | 0.404 | 2.5e-136 | |
| UNIPROTKB|F1MJE7 | 1173 | F1MJE7 "Uncharacterized protei | 0.653 | 0.580 | 0.388 | 6.7e-136 | |
| UNIPROTKB|F1MQS9 | 842 | LOC100847180 "Uncharacterized | 0.591 | 0.731 | 0.412 | 6e-135 | |
| UNIPROTKB|O43345 | 1167 | ZNF208 "Zinc finger protein 20 | 0.645 | 0.576 | 0.413 | 7.7e-135 | |
| UNIPROTKB|F1MV65 | 908 | Bt.90142 "Uncharacterized prot | 0.651 | 0.747 | 0.396 | 2.3e-133 | |
| UNIPROTKB|Q05481 | 1191 | ZNF91 "Zinc finger protein 91" | 0.652 | 0.570 | 0.399 | 9.1e-132 | |
| UNIPROTKB|G3N3R0 | 787 | G3N3R0 "Uncharacterized protei | 0.580 | 0.768 | 0.423 | 1.5e-131 |
| UNIPROTKB|F1MX34 F1MX34 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Score = 1456 (517.6 bits), Expect = 3.8e-149, P = 3.8e-149
Identities = 296/732 (40%), Positives = 424/732 (57%)
Query: 2 KLHQGIG-YKCDLCSKEFSRKYNLTDHKKIHQGIR-YKCNLCSKEFSRKYNLTDHKKIHQ 59
++H G +KCD+C K F++ NL H++IH G + YKCN+C K F+ NLT H+++H
Sbjct: 338 RIHTGEKPHKCDVCGKVFNQTANLAVHQRIHTGEKPYKCNVCGKAFNHSANLTVHRRLHT 397
Query: 60 GIR-YKCNLCSKEFSRNCYLTEHMEQHQGIR-YKCDLCSKDFSYKSSLIEHKKLHQGIR- 116
G + YKC++C K F++ L H + H G + YKCD+C K FS ++L H+++H G +
Sbjct: 398 GEKPYKCDVCGKAFNQTAKLRLHQKIHTGEKPYKCDVCGKAFSQTANLAVHQRVHTGEKP 457
Query: 117 YKCNLCSKEFSRNCYLTEHMEQHQGIR-YKCDLCSKDFSYKSSLIEHKKLHQGIR-YKCN 174
YKCN+C K FS LT H H G + YKCD+C +SL H+++H G + YKC+
Sbjct: 458 YKCNVCDKAFSDTSSLTVHRRVHTGEKPYKCDICV----VTASLAVHRRIHTGEKPYKCD 513
Query: 175 LCSKEYFFKRNLTEHKKLHQGIR-YNCDLCSKEFSRKDNLTDHKKMHQGNLTKHMKLHQG 233
+C K + L H+++H G + Y C++C + FS H +L+ H +LH G
Sbjct: 514 VCGKAFNHTTRLQLHQRIHTGEKPYKCNVCERAFS-----------HTSSLSVHRRLHTG 562
Query: 234 IR-YKCDLCLKEFSRKDNLTEHKEIHQGIR-YKCDLCSKKFSRKLNLTKHMKIHQGIR-Y 290
++ YKCD+C + FS+ +L H+ IH G + YKCD+C K F++ L H +IH G + Y
Sbjct: 563 VKPYKCDICGRAFSQTASLALHRSIHTGEKPYKCDVCGKAFNQTAKLRLHRRIHTGEKPY 622
Query: 291 KCDLCSKEFSRKGNLTKHMKLHQGIR-YKCDLCLKEFSRKDNLTEHKEIHQGIR-YKCDL 348
KC +C K FS L H ++H G + YKC++C K FS NLT H+ +H G + YKCD+
Sbjct: 623 KCCVCGKAFSHTTGLELHQRIHTGEKPYKCNVCDKAFSHSSNLTVHRRLHAGEKPYKCDI 682
Query: 349 CSKKFSRKLNLTKHMKIHQGIR-YKCDLCSKEFSRKGNLTKHMKLHQGIR-YKCDLCLKE 406
C K FS +L H ++H G + YKCD C K F++ L H K+H G + YKCD+C K
Sbjct: 683 CGKGFSVSSSLAVHQRVHTGEKPYKCDTCGKAFNQTAKLGLHQKIHTGEKSYKCDVCGKA 742
Query: 407 FSRKDNLTEHKEIHQGIR-YKCDLCSKKFSRKLNLTKHMKIHQGIR-YKCDLCSKEFSRK 464
FSR NLT H+ +H G + YKCD+C K F NL H ++H G + YKCD+C K FS+
Sbjct: 743 FSRTGNLTVHRRVHTGEKPYKCDMCGKAFRVSSNLAVHQRVHTGEKPYKCDVCGKAFSQA 802
Query: 465 GNLTKHMKLHQGIR-YKCDLCLKEFSRKDNLT-DRKIHQGIR-YKCDLCSKEFSSKGNLT 521
L H ++H G + YKCD+C K F+ L ++IH G + YKC++C K F S NL+
Sbjct: 803 TGLAVHQRIHTGEKPYKCDVCGKAFNHTTRLQLHQRIHTGEKPYKCNVCDKAFISAANLS 862
Query: 522 EHMKQHQGIR-YKCDLCSKEFSRKDNLTEHKEIHQGIR-YKCDLCSKEFSRKDNLTEHKE 579
H K H G + YKCD+C K F NL H+ +H G + YKCD+C K FS NL H+
Sbjct: 863 VHRKLHTGEKPYKCDICGKGFRVSSNLGIHRSVHTGEKPYKCDVCGKAFSHTGNLAVHRR 922
Query: 580 IHQGIR-YKCDLCSKKFSRKLNLTKHMKIHQGIR-YKCDLCSKEFSRKDIPYEVTVKEES 637
+H G + YKCD+C K FS NL H ++H G + YKCD+C K FSR + V
Sbjct: 923 VHTGEKPYKCDVCGKAFSCTGNLAVHRRLHTGEKPYKCDVCGKAFSRTG---NLAVHRRL 979
Query: 638 YEGDSINVEENNGNDAVTRD-CLEFFKTEQNTTLGKLNKILHQDIR-YKCDLCSKDFSRK 695
+ D+ G D C + F +TT +L++ +H + YKCD+C K F+
Sbjct: 980 HTVDT-------GEKPYKCDMCGKAFN---HTTRLELHQRIHTGEKPYKCDICGKAFNHT 1029
Query: 696 DNLTEHKEIHQG 707
L H+ IH G
Sbjct: 1030 TRLELHQRIHTG 1041
|
|
| UNIPROTKB|Q96IR2 ZNF845 "Zinc finger protein 845" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N2G8 ZNF397 "Zinc finger protein 397" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MP77 F1MP77 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MJE7 F1MJE7 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MQS9 LOC100847180 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O43345 ZNF208 "Zinc finger protein 208" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MV65 Bt.90142 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05481 ZNF91 "Zinc finger protein 91" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3N3R0 G3N3R0 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1042 | |||
| pfam05577 | 433 | pfam05577, Peptidase_S28, Serine carboxypeptidase | 1e-110 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 6e-09 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 7e-09 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 2e-08 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 1e-06 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 5e-06 | |
| pfam00561 | 226 | pfam00561, Abhydrolase_1, alpha/beta hydrolase fol | 4e-04 | |
| COG5048 | 467 | COG5048, COG5048, FOG: Zn-finger [General function | 0.001 | |
| pfam12697 | 187 | pfam12697, Abhydrolase_6, Alpha/beta hydrolase fam | 0.001 | |
| COG0596 | 282 | COG0596, MhpC, Predicted hydrolases or acyltransfe | 0.003 |
| >gnl|CDD|218645 pfam05577, Peptidase_S28, Serine carboxypeptidase S28 | Back alignment and domain information |
|---|
Score = 348 bits (895), Expect = e-110
Identities = 127/300 (42%), Positives = 181/300 (60%), Gaps = 5/300 (1%)
Query: 737 QKLDHFNIEEPRTWKQRYFVNSTWYKHGGPIFLMIGGEGEASAKWMVEGTWLDYAHNHNA 796
QKLDHF+ RT++QRYF N Y++GGPIFLMIGGEG SA W+ G WLD A A
Sbjct: 1 QKLDHFDPSNNRTFQQRYFYNDQHYRNGGPIFLMIGGEGPESASWVRNGHWLDLAKEFGA 60
Query: 797 LAVQVEHRFYGKSHPLSDLSVESLQYLSAEQALADLAYFITSMNTLYSLPAHTKWIAFGG 856
L +EHRFYG+S P+ DLS +L+YLS+ QALAD+A FI +MN ++ + +KWI FGG
Sbjct: 61 LVFSLEHRFYGQSKPIGDLSTANLRYLSSLQALADVASFIKAMNQKFNGLSSSKWITFGG 120
Query: 857 SYPGALAAWLRYKYPHLVHGAMSASGPLRAVVDFPEYFGVVADALATVSTECVKAVQTAT 916
SY G+LAAW R KYPHLV GA+++S PL A VDF EY VV +LA EC AV+
Sbjct: 121 SYSGSLAAWARKKYPHLVVGAVASSAPLLAKVDFKEYNMVVETSLAQTGGECYDAVENGF 180
Query: 917 HTISKMLKSPSDAKYLTEQFKLCTPLDINNAKDVSSFVESLADNIAGVVQYNKDNRESSN 976
+ ++L + + L++ +LC PL++ D+ +F ++ GVVQY D + +S
Sbjct: 181 AEVEELLLTKEGRQALSKLLQLCPPLNVTTDLDILNFFSNIYSPFQGVVQYTYDGQGNST 240
Query: 977 H--ITIDDLCALLMD-KKQDPVARYAAVNDL--ILSKEKKKNPCVDYKYEKMIEDMKNTS 1031
+I DLC ++++ D + R + L L+++ N +D Y+ ++S
Sbjct: 241 LNGYSIPDLCKIMLNATTTDLILRVEVLIQLFNYLNQKSGNNSTMDISYQLANASYGDSS 300
|
These serine proteases include several eukaryotic enzymes such as lysosomal Pro-X carboxypeptidase, dipeptidyl-peptidase II, and thymus-specific serine peptidase. Length = 433 |
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|201306 pfam00561, Abhydrolase_1, alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221720 pfam12697, Abhydrolase_6, Alpha/beta hydrolase family | Back alignment and domain information |
|---|
| >gnl|CDD|223669 COG0596, MhpC, Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1042 | |||
| KOG2182|consensus | 514 | 100.0 | ||
| KOG2183|consensus | 492 | 100.0 | ||
| PF05577 | 434 | Peptidase_S28: Serine carboxypeptidase S28; InterP | 100.0 | |
| PF05576 | 448 | Peptidase_S37: PS-10 peptidase S37; InterPro: IPR0 | 99.94 | |
| KOG1074|consensus | 958 | 99.94 | ||
| KOG2462|consensus | 279 | 99.91 | ||
| KOG1074|consensus | 958 | 99.91 | ||
| KOG2462|consensus | 279 | 99.9 | ||
| KOG3608|consensus | 467 | 99.9 | ||
| KOG3608|consensus | 467 | 99.88 | ||
| KOG3623|consensus | 1007 | 99.79 | ||
| KOG3623|consensus | 1007 | 99.73 | ||
| KOG3576|consensus | 267 | 99.49 | ||
| KOG3576|consensus | 267 | 99.47 | ||
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 99.13 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 99.11 | |
| KOG1455|consensus | 313 | 99.1 | ||
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 99.08 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 99.04 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 99.02 | |
| KOG4178|consensus | 322 | 99.02 | ||
| PHA02857 | 276 | monoglyceride lipase; Provisional | 99.02 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 99.02 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 99.01 | |
| PLN03086 | 567 | PRLI-interacting factor K; Provisional | 98.97 | |
| KOG2564|consensus | 343 | 98.97 | ||
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 98.92 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 98.89 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 98.89 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 98.87 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.86 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 98.84 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 98.84 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 98.83 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 98.83 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 98.83 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 98.82 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 98.82 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 98.81 | |
| PLN02965 | 255 | Probable pheophorbidase | 98.8 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 98.8 | |
| PHA00733 | 128 | hypothetical protein | 98.79 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 98.77 | |
| KOG4409|consensus | 365 | 98.77 | ||
| PLN02511 | 388 | hydrolase | 98.76 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 98.74 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 98.71 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 98.71 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 98.7 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 98.7 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 98.69 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 98.69 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 98.69 | |
| PHA02768 | 55 | hypothetical protein; Provisional | 98.67 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 98.65 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 98.64 | |
| KOG3993|consensus | 500 | 98.64 | ||
| PRK10985 | 324 | putative hydrolase; Provisional | 98.63 | |
| PHA00733 | 128 | hypothetical protein | 98.63 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 98.62 | |
| KOG3993|consensus | 500 | 98.6 | ||
| PLN02578 | 354 | hydrolase | 98.59 | |
| PRK10566 | 249 | esterase; Provisional | 98.59 | |
| PRK07581 | 339 | hypothetical protein; Validated | 98.57 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 98.53 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 98.48 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 98.45 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 98.45 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 98.45 | |
| KOG4391|consensus | 300 | 98.44 | ||
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 98.43 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 98.43 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 98.39 | |
| PF10503 | 220 | Esterase_phd: Esterase PHB depolymerase | 98.38 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 98.38 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 98.35 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 98.34 | |
| COG1506 | 620 | DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept | 98.3 | |
| TIGR00976 | 550 | /NonD putative hydrolase, CocE/NonD family. This m | 98.3 | |
| KOG2382|consensus | 315 | 98.3 | ||
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 98.29 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 98.26 | |
| KOG1454|consensus | 326 | 98.26 | ||
| PHA00616 | 44 | hypothetical protein | 98.26 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 98.25 | |
| PTZ00472 | 462 | serine carboxypeptidase (CBP1); Provisional | 98.24 | |
| KOG1552|consensus | 258 | 98.19 | ||
| PRK05855 | 582 | short chain dehydrogenase; Validated | 98.17 | |
| PLN02872 | 395 | triacylglycerol lipase | 98.11 | |
| KOG1146|consensus | 1406 | 98.11 | ||
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 98.1 | |
| PF13465 | 26 | zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A | 98.09 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 98.09 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 98.08 | |
| PF12146 | 79 | Hydrolase_4: Putative lysophospholipase; InterPro: | 98.06 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 98.03 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 98.01 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 98.01 | |
| PLN00021 | 313 | chlorophyllase | 98.0 | |
| PHA00732 | 79 | hypothetical protein | 97.97 | |
| PHA00616 | 44 | hypothetical protein | 97.95 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 97.93 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 97.93 | |
| KOG2281|consensus | 867 | 97.91 | ||
| PHA00732 | 79 | hypothetical protein | 97.9 | |
| PRK10162 | 318 | acetyl esterase; Provisional | 97.86 | |
| KOG2984|consensus | 277 | 97.86 | ||
| PF05677 | 365 | DUF818: Chlamydia CHLPS protein (DUF818); InterPro | 97.83 | |
| COG0429 | 345 | Predicted hydrolase of the alpha/beta-hydrolase fo | 97.8 | |
| PRK10115 | 686 | protease 2; Provisional | 97.79 | |
| KOG1146|consensus | 1406 | 97.78 | ||
| PF11144 | 403 | DUF2920: Protein of unknown function (DUF2920); In | 97.71 | |
| KOG1838|consensus | 409 | 97.66 | ||
| COG3509 | 312 | LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda | 97.58 | |
| PF02129 | 272 | Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam | 97.58 | |
| PF00450 | 415 | Peptidase_S10: Serine carboxypeptidase; InterPro: | 97.56 | |
| PF07859 | 211 | Abhydrolase_3: alpha/beta hydrolase fold A web pag | 97.56 | |
| PF09752 | 348 | DUF2048: Uncharacterized conserved protein (DUF204 | 97.5 | |
| PLN02209 | 437 | serine carboxypeptidase | 97.4 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.39 | |
| PF00756 | 251 | Esterase: Putative esterase; InterPro: IPR000801 T | 97.38 | |
| PF08538 | 303 | DUF1749: Protein of unknown function (DUF1749); In | 97.37 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 97.36 | |
| PLN03016 | 433 | sinapoylglucose-malate O-sinapoyltransferase | 97.36 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 97.35 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 97.35 | |
| PF00096 | 23 | zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 | 97.29 | |
| PF05448 | 320 | AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 | 97.28 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 97.27 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 97.24 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 97.23 | |
| PF05605 | 54 | zf-Di19: Drought induced 19 protein (Di19), zinc-b | 97.22 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 97.18 | |
| PF06500 | 411 | DUF1100: Alpha/beta hydrolase of unknown function | 97.18 | |
| COG2021 | 368 | MET2 Homoserine acetyltransferase [Amino acid tran | 97.17 | |
| PF10230 | 266 | DUF2305: Uncharacterised conserved protein (DUF230 | 97.17 | |
| COG0657 | 312 | Aes Esterase/lipase [Lipid metabolism] | 97.16 | |
| cd00312 | 493 | Esterase_lipase Esterases and lipases (includes fu | 97.15 | |
| KOG2100|consensus | 755 | 97.1 | ||
| PF03403 | 379 | PAF-AH_p_II: Platelet-activating factor acetylhydr | 97.09 | |
| PF12756 | 100 | zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: | 97.08 | |
| COG0412 | 236 | Dienelactone hydrolase and related enzymes [Second | 97.08 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 97.01 | |
| KOG4667|consensus | 269 | 97.0 | ||
| PF12740 | 259 | Chlorophyllase2: Chlorophyllase enzyme; InterPro: | 96.99 | |
| PF06057 | 192 | VirJ: Bacterial virulence protein (VirJ); InterPro | 96.97 | |
| COG2945 | 210 | Predicted hydrolase of the alpha/beta superfamily | 96.83 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.82 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 96.81 | |
| PF13894 | 24 | zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP | 96.81 | |
| PRK10439 | 411 | enterobactin/ferric enterobactin esterase; Provisi | 96.74 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 96.72 | |
| KOG4627|consensus | 270 | 96.72 | ||
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 96.71 | |
| PF01738 | 218 | DLH: Dienelactone hydrolase family; InterPro: IPR0 | 96.7 | |
| KOG1282|consensus | 454 | 96.67 | ||
| PF13912 | 27 | zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 | 96.63 | |
| PF03096 | 283 | Ndr: Ndr family; InterPro: IPR004142 This family c | 96.5 | |
| PF06342 | 297 | DUF1057: Alpha/beta hydrolase of unknown function | 96.49 | |
| COG1770 | 682 | PtrB Protease II [Amino acid transport and metabol | 96.39 | |
| COG4099 | 387 | Predicted peptidase [General function prediction o | 96.38 | |
| KOG1553|consensus | 517 | 96.35 | ||
| PRK05371 | 767 | x-prolyl-dipeptidyl aminopeptidase; Provisional | 96.33 | |
| PF05728 | 187 | UPF0227: Uncharacterised protein family (UPF0227); | 96.32 | |
| COG2819 | 264 | Predicted hydrolase of the alpha/beta superfamily | 96.31 | |
| PF12715 | 390 | Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 | 96.22 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 96.18 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 96.16 | |
| KOG1515|consensus | 336 | 96.15 | ||
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 96.15 | |
| KOG2931|consensus | 326 | 95.93 | ||
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 95.91 | |
| COG3571 | 213 | Predicted hydrolase of the alpha/beta-hydrolase fo | 95.91 | |
| COG5189 | 423 | SFP1 Putative transcriptional repressor regulating | 95.87 | |
| COG4757 | 281 | Predicted alpha/beta hydrolase [General function p | 95.83 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 95.81 | |
| COG3458 | 321 | Acetyl esterase (deacetylase) [Secondary metabolit | 95.59 | |
| smart00355 | 26 | ZnF_C2H2 zinc finger. | 95.38 | |
| COG3208 | 244 | GrsT Predicted thioesterase involved in non-riboso | 95.38 | |
| COG2939 | 498 | Carboxypeptidase C (cathepsin A) [Amino acid trans | 95.34 | |
| KOG1283|consensus | 414 | 95.33 | ||
| COG2272 | 491 | PnbA Carboxylesterase type B [Lipid metabolism] | 95.2 | |
| PF10340 | 374 | DUF2424: Protein of unknown function (DUF2424); In | 95.18 | |
| PRK04940 | 180 | hypothetical protein; Provisional | 95.11 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 95.04 | |
| COG3319 | 257 | Thioesterase domains of type I polyketide synthase | 95.02 | |
| PRK10252 | 1296 | entF enterobactin synthase subunit F; Provisional | 95.02 | |
| PF00135 | 535 | COesterase: Carboxylesterase family The prints ent | 94.92 | |
| KOG3847|consensus | 399 | 94.89 | ||
| KOG2231|consensus | 669 | 94.82 | ||
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 94.71 | |
| PF09237 | 54 | GAGA: GAGA factor; InterPro: IPR015318 Zinc finger | 94.71 | |
| PF07224 | 307 | Chlorophyllase: Chlorophyllase; InterPro: IPR01082 | 94.69 | |
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 94.65 | |
| COG4188 | 365 | Predicted dienelactone hydrolase [General function | 94.59 | |
| COG0627 | 316 | Predicted esterase [General function prediction on | 94.58 | |
| PLN02213 | 319 | sinapoylglucose-malate O-sinapoyltransferase/ carb | 94.58 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 94.51 | |
| KOG2231|consensus | 669 | 94.45 | ||
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 94.44 | |
| KOG4840|consensus | 299 | 94.41 | ||
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 94.34 | |
| KOG2237|consensus | 712 | 94.26 | ||
| PRK04860 | 160 | hypothetical protein; Provisional | 94.21 | |
| PF12874 | 25 | zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG | 94.18 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 94.17 | |
| PRK04860 | 160 | hypothetical protein; Provisional | 94.12 | |
| PLN00413 | 479 | triacylglycerol lipase | 94.08 | |
| PLN03037 | 525 | lipase class 3 family protein; Provisional | 94.07 | |
| PLN02310 | 405 | triacylglycerol lipase | 93.92 | |
| KOG3724|consensus | 973 | 93.88 | ||
| PF13909 | 24 | zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W | 93.7 | |
| PF07082 | 250 | DUF1350: Protein of unknown function (DUF1350); In | 93.64 | |
| COG4947 | 227 | Uncharacterized protein conserved in bacteria [Fun | 93.51 | |
| KOG2785|consensus | 390 | 93.36 | ||
| KOG2785|consensus | 390 | 93.3 | ||
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 93.24 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 93.24 | |
| PF08840 | 213 | BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term | 93.12 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 93.12 | |
| smart00824 | 212 | PKS_TE Thioesterase. Peptide synthetases are invol | 93.1 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 93.0 | |
| PF12171 | 27 | zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi | 92.98 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 92.85 | |
| PLN02571 | 413 | triacylglycerol lipase | 92.67 | |
| COG1505 | 648 | Serine proteases of the peptidase family S9A [Amin | 92.67 | |
| PLN02162 | 475 | triacylglycerol lipase | 92.56 | |
| PLN02454 | 414 | triacylglycerol lipase | 92.37 | |
| KOG3101|consensus | 283 | 92.16 | ||
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 92.13 | |
| COG2382 | 299 | Fes Enterochelin esterase and related enzymes [Ino | 92.03 | |
| PF03583 | 290 | LIP: Secretory lipase ; InterPro: IPR005152 This e | 91.87 | |
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 91.83 | |
| PLN02719 | 518 | triacylglycerol lipase | 91.55 | |
| KOG2565|consensus | 469 | 91.49 | ||
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 91.41 | |
| COG5236 | 493 | Uncharacterized conserved protein, contains RING Z | 91.34 | |
| PLN02753 | 531 | triacylglycerol lipase | 91.28 | |
| PLN02408 | 365 | phospholipase A1 | 90.49 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 90.4 | |
| PLN02324 | 415 | triacylglycerol lipase | 90.32 | |
| COG3946 | 456 | VirJ Type IV secretory pathway, VirJ component [In | 90.17 | |
| COG5048 | 467 | FOG: Zn-finger [General function prediction only] | 89.94 | |
| KOG2624|consensus | 403 | 89.79 | ||
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 89.72 | |
| COG2936 | 563 | Predicted acyl esterases [General function predict | 89.59 | |
| COG4782 | 377 | Uncharacterized protein conserved in bacteria [Fun | 89.24 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 89.21 | |
| PLN02934 | 515 | triacylglycerol lipase | 89.17 | |
| PLN02761 | 527 | lipase class 3 family protein | 89.17 | |
| COG3150 | 191 | Predicted esterase [General function prediction on | 88.97 | |
| KOG3967|consensus | 297 | 88.82 | ||
| KOG2369|consensus | 473 | 88.72 | ||
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 88.53 | |
| PLN02802 | 509 | triacylglycerol lipase | 88.35 | |
| TIGR00622 | 112 | ssl1 transcription factor ssl1. This family is bas | 87.74 | |
| KOG2482|consensus | 423 | 87.28 | ||
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 87.18 | |
| KOG2482|consensus | 423 | 85.9 | ||
| COG5153 | 425 | CVT17 Putative lipase essential for disintegration | 85.58 | |
| KOG4540|consensus | 425 | 85.58 | ||
| TIGR03712 | 511 | acc_sec_asp2 accessory Sec system protein Asp2. Th | 84.83 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 84.81 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 84.66 | |
| PF11339 | 581 | DUF3141: Protein of unknown function (DUF3141); In | 84.23 | |
| smart00451 | 35 | ZnF_U1 U1-like zinc finger. Family of C2H2-type zi | 83.55 | |
| PF07519 | 474 | Tannase: Tannase and feruloyl esterase; InterPro: | 83.53 | |
| KOG1551|consensus | 371 | 83.07 | ||
| PLN02517 | 642 | phosphatidylcholine-sterol O-acyltransferase | 82.48 | |
| COG3545 | 181 | Predicted esterase of the alpha/beta hydrolase fol | 82.3 | |
| KOG4388|consensus | 880 | 82.03 | ||
| PLN02847 | 633 | triacylglycerol lipase | 81.66 | |
| KOG2112|consensus | 206 | 81.39 | ||
| KOG2893|consensus | 341 | 81.27 | ||
| KOG1516|consensus | 545 | 80.11 |
| >KOG2182|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.7e-66 Score=554.87 Aligned_cols=313 Identities=40% Similarity=0.706 Sum_probs=278.0
Q ss_pred cCCCCcchhhhhcccCCCCCcccceEEEEEecccccCCCcEEEEECCCCCCccccc--ccccHHHHHHHcCCeEEEEeee
Q psy3685 727 EKLPSDQWFEQKLDHFNIEEPRTWKQRYFVNSTWYKHGGPIFLMIGGEGEASAKWM--VEGTWLDYAHNHNALAVQVEHR 804 (1042)
Q Consensus 727 ~~~~~~~~f~q~~dhf~~~~~~tf~qry~~~~~~~~~~~pi~~~~gg~g~~~~~~~--~~~~~~~la~~~~a~~~~~ehR 804 (1042)
..+++++||+|++|||+..+..+|+|||+.|+.|++++|||||||||||+.++.|+ ..+.+..||+++||.|+.||||
T Consensus 48 ~~~~~~~~~~Q~lDhF~~~~~~~~Qq~~y~n~~~~~~~gPiFLmIGGEgp~~~~wv~~~~~~~~~~AkkfgA~v~~lEHR 127 (514)
T KOG2182|consen 48 PANVEQSTFTQKLDHFDSSNGKFFQQRFYNNNQWAKPGGPIFLMIGGEGPESDKWVGNENLTWLQWAKKFGATVFQLEHR 127 (514)
T ss_pred cccccccchhhhhhhhhcchhhhhhhheeeccccccCCCceEEEEcCCCCCCCCccccCcchHHHHHHHhCCeeEEeeee
Confidence 35788999999999996444445555555555566999999999999999998885 3447889999999999999999
Q ss_pred ecccccCCCCCCcccccCCCHHHHHhHHHHHHHHHhhhcCCCCCCcEEEEccchhHHHHHHHHHhCCCeEEEEEeecccc
Q psy3685 805 FYGKSHPLSDLSVESLQYLSAEQALADLAYFITSMNTLYSLPAHTKWIAFGGSYPGALAAWLRYKYPHLVHGAMSASGPL 884 (1042)
Q Consensus 805 ~~G~S~p~~~~~~~~~~~lt~~q~l~D~~~~~~~~~~~~~~~~~~~~i~~G~Sygg~la~~~~~~yP~~~~g~i~ssa~~ 884 (1042)
|||+|.|..++++.||+|||++|||+|+|+||+.++.+++..++.|||+|||||+|+||||+|++|||++.|||||||||
T Consensus 128 FYG~S~P~~~~st~nlk~LSs~QALaDla~fI~~~n~k~n~~~~~~WitFGgSYsGsLsAW~R~~yPel~~GsvASSapv 207 (514)
T KOG2182|consen 128 FYGQSSPIGDLSTSNLKYLSSLQALADLAEFIKAMNAKFNFSDDSKWITFGGSYSGSLSAWFREKYPELTVGSVASSAPV 207 (514)
T ss_pred ccccCCCCCCCcccchhhhhHHHHHHHHHHHHHHHHhhcCCCCCCCeEEECCCchhHHHHHHHHhCchhheeecccccce
Confidence 99999999999999999999999999999999999999987666799999999999999999999999999999999999
Q ss_pred ccccCChhhHHHHHHHhhccChhhHHHHHHHHHHHHHHhcCCchHHHHHHHhcCCCCCCC-CChhcHHHHHHHHHHHhhh
Q psy3685 885 RAVVDFPEYFGVVADALATVSTECVKAVQTATHTISKMLKSPSDAKYLTEQFKLCTPLDI-NNAKDVSSFVESLADNIAG 963 (1042)
Q Consensus 885 ~~~~~~~~~~~~v~~~~~~~~~~c~~~i~~~~~~~~~~~~~~~~~~~l~~~f~~~~~~~~-~~~~~~~~~~~~~~~~~~~ 963 (1042)
+|++||+||+++|++.++.++++|.++|+.+|..|+.++.+.+++++|++.|++|++++. .+..|+..|+.+|+.+|++
T Consensus 208 ~A~~DF~EY~~VVe~s~~~~~~~C~~ai~~~f~~~~~l~~t~~gr~~Lk~~Fnl~~~f~~~~s~~d~~~ff~nv~~~Fqg 287 (514)
T KOG2182|consen 208 LAKVDFYEYLMVVEESLRRYSPECADAIKEGFKSMEELLLTKGGRQALKSLFNLCPPFDNNVSDTDQHNFFSNVYSNFQG 287 (514)
T ss_pred eEEecHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHhcccHHHHHHHHhccCCccccchhHHHHHHHHHHHHHhhhh
Confidence 999999999999999999999999999999999999999999999999999999999952 2445788999999999999
Q ss_pred hhccCCCCCCC-CCCCCHHHHHHHhhcC-CCCHHHHHHHHHHHHHhcCCCCCccccccHHHHHHHhhcCCCCCCCCCCCC
Q psy3685 964 VVQYNKDNRES-SNHITIDDLCALLMDK-KQDPVARYAAVNDLILSKEKKKNPCVDYKYEKMIEDMKNTSWDSEMANGGK 1041 (1042)
Q Consensus 964 ~~~y~~~~~~~-~~~~~~~~~C~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~~~~~~~~~~~~~~~~~ 1041 (1042)
++||.++..++ ...+.|+++|++|++. ..+++.++..++.+++.. .+..|+|.+|+.||..|+++.+..+.+.++|
T Consensus 288 vvQY~gd~~~~~~~~~~i~~~C~~l~n~t~~d~v~~~~~~~~~~~~~--~~~~c~~~~Y~~~i~~~~n~~~~~~~~~a~r 365 (514)
T KOG2182|consen 288 VVQYSGDNSNATASGLGIPAMCDILNNKTPGDDVVAVNKYMNWFNNG--FGYGCLDNTYNGMISYLKNSTEPGEDAAADR 365 (514)
T ss_pred heeecCCCCcccccccChhHHHHHhhcCCCCchHHHHHHHHHHHHhc--cCCCcCCccHHHHHHHhhcccCcCcccccch
Confidence 99999998544 4568999999999985 478899999988888763 3467999999999999998777666666666
|
|
| >KOG2183|consensus | Back alignment and domain information |
|---|
| >PF05577 Peptidase_S28: Serine carboxypeptidase S28; InterPro: IPR008758 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05576 Peptidase_S37: PS-10 peptidase S37; InterPro: IPR008761 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >KOG1074|consensus | Back alignment and domain information |
|---|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >KOG1074|consensus | Back alignment and domain information |
|---|
| >KOG2462|consensus | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >KOG3608|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >KOG3623|consensus | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >KOG3576|consensus | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG1455|consensus | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >KOG4178|consensus | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PLN03086 PRLI-interacting factor K; Provisional | Back alignment and domain information |
|---|
| >KOG2564|consensus | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >KOG4409|consensus | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PHA02768 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >PHA00733 hypothetical protein | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >KOG3993|consensus | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG4391|consensus | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PF10503 Esterase_phd: Esterase PHB depolymerase | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00976 /NonD putative hydrolase, CocE/NonD family | Back alignment and domain information |
|---|
| >KOG2382|consensus | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG1454|consensus | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
| >PTZ00472 serine carboxypeptidase (CBP1); Provisional | Back alignment and domain information |
|---|
| >KOG1552|consensus | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PHA00616 hypothetical protein | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >KOG2281|consensus | Back alignment and domain information |
|---|
| >PHA00732 hypothetical protein | Back alignment and domain information |
|---|
| >PRK10162 acetyl esterase; Provisional | Back alignment and domain information |
|---|
| >KOG2984|consensus | Back alignment and domain information |
|---|
| >PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins | Back alignment and domain information |
|---|
| >COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PRK10115 protease 2; Provisional | Back alignment and domain information |
|---|
| >KOG1146|consensus | Back alignment and domain information |
|---|
| >PF11144 DUF2920: Protein of unknown function (DUF2920); InterPro: IPR022605 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG1838|consensus | Back alignment and domain information |
|---|
| >COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] | Back alignment and domain information |
|---|
| >PF00450 Peptidase_S10: Serine carboxypeptidase; InterPro: IPR001563 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PLN02209 serine carboxypeptidase | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae | Back alignment and domain information |
|---|
| >PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03016 sinapoylglucose-malate O-sinapoyltransferase | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] | Back alignment and domain information |
|---|
| >COG2021 MET2 Homoserine acetyltransferase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function | Back alignment and domain information |
|---|
| >COG0657 Aes Esterase/lipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc | Back alignment and domain information |
|---|
| >KOG2100|consensus | Back alignment and domain information |
|---|
| >PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A | Back alignment and domain information |
|---|
| >PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A | Back alignment and domain information |
|---|
| >COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >KOG4667|consensus | Back alignment and domain information |
|---|
| >PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins | Back alignment and domain information |
|---|
| >COG2945 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A | Back alignment and domain information |
|---|
| >PRK10439 enterobactin/ferric enterobactin esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >KOG4627|consensus | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway | Back alignment and domain information |
|---|
| >KOG1282|consensus | Back alignment and domain information |
|---|
| >PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B | Back alignment and domain information |
|---|
| >PF03096 Ndr: Ndr family; InterPro: IPR004142 This family consists of proteins from different gene families: Ndr1/RTP/Drg1, Ndr2, and Ndr3 | Back alignment and domain information |
|---|
| >PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold | Back alignment and domain information |
|---|
| >COG1770 PtrB Protease II [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4099 Predicted peptidase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1553|consensus | Back alignment and domain information |
|---|
| >PRK05371 x-prolyl-dipeptidyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO | Back alignment and domain information |
|---|
| >COG2819 Predicted hydrolase of the alpha/beta superfamily [General function prediction only] | Back alignment and domain information |
|---|
| >PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >KOG1515|consensus | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG2931|consensus | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >COG4757 Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >COG3458 Acetyl esterase (deacetylase) [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >smart00355 ZnF_C2H2 zinc finger | Back alignment and domain information |
|---|
| >COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG2939 Carboxypeptidase C (cathepsin A) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1283|consensus | Back alignment and domain information |
|---|
| >COG2272 PnbA Carboxylesterase type B [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters | Back alignment and domain information |
|---|
| >PRK04940 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PRK10252 entF enterobactin synthase subunit F; Provisional | Back alignment and domain information |
|---|
| >PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases | Back alignment and domain information |
|---|
| >KOG3847|consensus | Back alignment and domain information |
|---|
| >KOG2231|consensus | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >COG4188 Predicted dienelactone hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >COG0627 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02213 sinapoylglucose-malate O-sinapoyltransferase/ carboxypeptidase | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >KOG2231|consensus | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4840|consensus | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >KOG2237|consensus | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >PRK04860 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN03037 lipase class 3 family protein; Provisional | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG3724|consensus | Back alignment and domain information |
|---|
| >PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A | Back alignment and domain information |
|---|
| >PF07082 DUF1350: Protein of unknown function (DUF1350); InterPro: IPR010765 This family consists of several hypothetical proteins from both cyanobacteria and plants | Back alignment and domain information |
|---|
| >COG4947 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >KOG2785|consensus | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >smart00824 PKS_TE Thioesterase | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >PLN02571 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG1505 Serine proteases of the peptidase family S9A [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN02162 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02454 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG3101|consensus | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >COG2382 Fes Enterochelin esterase and related enzymes [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02719 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG2565|consensus | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02753 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PLN02324 triacylglycerol lipase | Back alignment and domain information |
|---|
| >COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG5048 FOG: Zn-finger [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2624|consensus | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >COG2936 Predicted acyl esterases [General function prediction only] | Back alignment and domain information |
|---|
| >COG4782 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >PLN02934 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PLN02761 lipase class 3 family protein | Back alignment and domain information |
|---|
| >COG3150 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3967|consensus | Back alignment and domain information |
|---|
| >KOG2369|consensus | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >PLN02802 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR00622 ssl1 transcription factor ssl1 | Back alignment and domain information |
|---|
| >KOG2482|consensus | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
| >KOG2482|consensus | Back alignment and domain information |
|---|
| >COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG4540|consensus | Back alignment and domain information |
|---|
| >TIGR03712 acc_sec_asp2 accessory Sec system protein Asp2 | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PF11339 DUF3141: Protein of unknown function (DUF3141); InterPro: IPR024501 This family of proteins appears to be predominantly expressed in Proteobacteria | Back alignment and domain information |
|---|
| >smart00451 ZnF_U1 U1-like zinc finger | Back alignment and domain information |
|---|
| >PF07519 Tannase: Tannase and feruloyl esterase; InterPro: IPR011118 This family includes fungal tannase [] and feruloyl esterase [, ] | Back alignment and domain information |
|---|
| >KOG1551|consensus | Back alignment and domain information |
|---|
| >PLN02517 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >COG3545 Predicted esterase of the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4388|consensus | Back alignment and domain information |
|---|
| >PLN02847 triacylglycerol lipase | Back alignment and domain information |
|---|
| >KOG2112|consensus | Back alignment and domain information |
|---|
| >KOG2893|consensus | Back alignment and domain information |
|---|
| >KOG1516|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 1042 | ||||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 1e-29 | ||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 1e-29 | ||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 2e-28 | ||
| 2i13_A | 190 | Aart, A Six Finger Zinc Finger Designed To Recogniz | 5e-21 | ||
| 3n2z_B | 446 | The Structure Of Human Prolylcarboxypeptidase At 2. | 4e-29 | ||
| 3jyh_A | 469 | Human Dipeptidyl Peptidase Dpp7 Length = 469 | 1e-25 | ||
| 4ebb_A | 472 | Structure Of Dpp2 Length = 472 | 1e-25 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 5e-13 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 5e-13 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 6e-12 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 6e-10 | ||
| 1mey_C | 87 | Crystal Structure Of A Designed Zinc Finger Protein | 8e-06 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 1e-11 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 1e-11 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 3e-10 | ||
| 1a1h_A | 90 | Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 2e-07 | ||
| 1a1i_A | 90 | Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 1e-11 | ||
| 1a1i_A | 90 | Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 1e-11 | ||
| 1a1i_A | 90 | Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac | 4e-10 | ||
| 1jk1_A | 90 | Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | 2e-11 | ||
| 1jk1_A | 90 | Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | 2e-11 | ||
| 1jk1_A | 90 | Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | 7e-10 | ||
| 1p47_A | 87 | Crystal Structure Of Tandem Zif268 Molecules Comple | 3e-11 | ||
| 1p47_A | 87 | Crystal Structure Of Tandem Zif268 Molecules Comple | 3e-11 | ||
| 1p47_A | 87 | Crystal Structure Of Tandem Zif268 Molecules Comple | 1e-10 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 4e-11 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 4e-11 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 6e-10 | ||
| 1a1f_A | 90 | Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc | 8e-08 | ||
| 1zaa_C | 87 | Zinc Finger-Dna Recognition: Crystal Structure Of A | 4e-11 | ||
| 1zaa_C | 87 | Zinc Finger-Dna Recognition: Crystal Structure Of A | 4e-11 | ||
| 1zaa_C | 87 | Zinc Finger-Dna Recognition: Crystal Structure Of A | 1e-10 | ||
| 1aay_A | 90 | Zif268 Zinc Finger-Dna Complex Length = 90 | 4e-11 | ||
| 1aay_A | 90 | Zif268 Zinc Finger-Dna Complex Length = 90 | 4e-11 | ||
| 1aay_A | 90 | Zif268 Zinc Finger-Dna Complex Length = 90 | 1e-10 | ||
| 2jp9_A | 119 | Structure Of The Wilms Tumor Suppressor Protein Zin | 2e-09 | ||
| 2csh_A | 110 | Solution Structure Of Tandem Repeat Of The Zf-C2h2 | 2e-09 | ||
| 2dlq_A | 124 | Solution Structure Of The Tandem Four Zf-C2h2 Domai | 4e-09 | ||
| 2dlq_A | 124 | Solution Structure Of The Tandem Four Zf-C2h2 Domai | 4e-09 | ||
| 2dlq_A | 124 | Solution Structure Of The Tandem Four Zf-C2h2 Domai | 2e-08 | ||
| 1g2f_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 5e-09 | ||
| 1g2f_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 5e-09 | ||
| 1g2f_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 4e-08 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 5e-09 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 5e-09 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 5e-09 | ||
| 2kmk_A | 82 | Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = | 1e-08 | ||
| 2dmd_A | 96 | Solution Structure Of The N-Terminal C2h2 Type Zinc | 4e-08 | ||
| 2dmd_A | 96 | Solution Structure Of The N-Terminal C2h2 Type Zinc | 2e-07 | ||
| 2dmd_A | 96 | Solution Structure Of The N-Terminal C2h2 Type Zinc | 3e-07 | ||
| 1g2d_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 4e-08 | ||
| 1g2d_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 4e-08 | ||
| 1g2d_C | 90 | Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX | 3e-07 | ||
| 2lce_A | 74 | Chemical Shift Assignment Of Hr4436b From Homo Sapi | 1e-07 | ||
| 2lce_A | 74 | Chemical Shift Assignment Of Hr4436b From Homo Sapi | 1e-07 | ||
| 1ubd_C | 124 | Co-Crystal Structure Of Human Yy1 Zinc Finger Domai | 5e-07 | ||
| 2yt9_A | 95 | Solution Structure Of C2h2 Type Zinc Finger Domain | 8e-07 | ||
| 2yt9_A | 95 | Solution Structure Of C2h2 Type Zinc Finger Domain | 1e-06 | ||
| 2yt9_A | 95 | Solution Structure Of C2h2 Type Zinc Finger Domain | 1e-04 | ||
| 2ee8_A | 106 | Solution Structure Of Three Zf-C2h2 Domains From Mo | 9e-07 | ||
| 2cot_A | 77 | Solution Structure Of The First And Second Zf-C2h2 | 1e-06 | ||
| 2cot_A | 77 | Solution Structure Of The First And Second Zf-C2h2 | 1e-06 | ||
| 2cot_A | 77 | Solution Structure Of The First And Second Zf-C2h2 | 1e-06 | ||
| 2cot_A | 77 | Solution Structure Of The First And Second Zf-C2h2 | 2e-06 | ||
| 2ebt_A | 100 | Solution Structure Of Three Tandem Repeats Of Zf-C2 | 3e-06 | ||
| 2wbu_A | 90 | Crystal Structure Of The Zinc Finger Domain Of Klf4 | 1e-05 | ||
| 2wbs_A | 89 | Crystal Structure Of The Zinc Finger Domain Of Klf4 | 2e-05 | ||
| 1tf6_A | 190 | Co-crystal Structure Of Xenopus Tfiiia Zinc Finger | 5e-05 | ||
| 1tf6_A | 190 | Co-crystal Structure Of Xenopus Tfiiia Zinc Finger | 5e-05 | ||
| 1tf6_A | 190 | Co-crystal Structure Of Xenopus Tfiiia Zinc Finger | 2e-04 | ||
| 1tf6_A | 190 | Co-crystal Structure Of Xenopus Tfiiia Zinc Finger | 4e-04 | ||
| 1f2i_G | 73 | Cocrystal Structure Of Selected Zinc Finger Dimer B | 5e-05 | ||
| 1f2i_G | 73 | Cocrystal Structure Of Selected Zinc Finger Dimer B | 5e-05 | ||
| 1f2i_G | 73 | Cocrystal Structure Of Selected Zinc Finger Dimer B | 1e-04 | ||
| 1x6e_A | 72 | Solution Structures Of The C2h2 Type Zinc Finger Do | 9e-05 | ||
| 1x6e_A | 72 | Solution Structures Of The C2h2 Type Zinc Finger Do | 1e-04 | ||
| 1llm_C | 88 | Crystal Structure Of A Zif23-Gcn4 Chimera Bound To | 1e-04 | ||
| 2rpc_A | 155 | Solution Structure Of The Tandem Zf-C2h2 Domains Fr | 6e-04 | ||
| 2rpc_A | 155 | Solution Structure Of The Tandem Zf-C2h2 Domains Fr | 6e-04 |
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
|
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
| >pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 | Back alignment and structure |
| >pdb|3N2Z|B Chain B, The Structure Of Human Prolylcarboxypeptidase At 2.80 Angstroms Resolution Length = 446 | Back alignment and structure |
| >pdb|3JYH|A Chain A, Human Dipeptidyl Peptidase Dpp7 Length = 469 | Back alignment and structure |
| >pdb|4EBB|A Chain A, Structure Of Dpp2 Length = 472 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 | Back alignment and structure |
| >pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | Back alignment and structure |
| >pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | Back alignment and structure |
| >pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 | Back alignment and structure |
| >pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 | Back alignment and structure |
| >pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 | Back alignment and structure |
| >pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 | Back alignment and structure |
| >pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 | Back alignment and structure |
| >pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 | Back alignment and structure |
| >pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 | Back alignment and structure |
| >pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 | Back alignment and structure |
| >pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 | Back alignment and structure |
| >pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 | Back alignment and structure |
| >pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 | Back alignment and structure |
| >pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 | Back alignment and structure |
| >pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 | Back alignment and structure |
| >pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 | Back alignment and structure |
| >pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 | Back alignment and structure |
| >pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 | Back alignment and structure |
| >pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 | Back alignment and structure |
| >pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 | Back alignment and structure |
| >pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 | Back alignment and structure |
| >pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 | Back alignment and structure |
| >pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 | Back alignment and structure |
| >pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 | Back alignment and structure |
| >pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 | Back alignment and structure |
| >pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 | Back alignment and structure |
| >pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 | Back alignment and structure |
| >pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 | Back alignment and structure |
| >pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 | Back alignment and structure |
| >pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 | Back alignment and structure |
| >pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 | Back alignment and structure |
| >pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 | Back alignment and structure |
| >pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 | Back alignment and structure |
| >pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 | Back alignment and structure |
| >pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 | Back alignment and structure |
| >pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 | Back alignment and structure |
| >pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 | Back alignment and structure |
| >pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 | Back alignment and structure |
| >pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 | Back alignment and structure |
| >pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 | Back alignment and structure |
| >pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 | Back alignment and structure |
| >pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 | Back alignment and structure |
| >pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 | Back alignment and structure |
| >pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 | Back alignment and structure |
| >pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 | Back alignment and structure |
| >pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 | Back alignment and structure |
| >pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 | Back alignment and structure |
| >pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 | Back alignment and structure |
| >pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 | Back alignment and structure |
| >pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 | Back alignment and structure |
| >pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 | Back alignment and structure |
| >pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 1042 | |||
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 5e-79 | |
| 3jyh_A | 469 | Dipeptidyl-peptidase 2; structural genomics, struc | 9e-71 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 2e-45 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 8e-44 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 1e-41 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 2e-41 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 3e-41 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 5e-38 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 3e-37 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 2e-31 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 5e-36 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 7e-34 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 1e-33 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 1e-32 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 2e-32 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 2e-31 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 6e-30 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 2e-22 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 9e-20 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 5e-29 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 2e-28 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 6e-26 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 7e-25 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 2e-22 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 9e-22 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 1e-11 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 3e-28 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 3e-28 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 2e-27 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 2e-25 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 2e-24 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 4e-24 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 9e-24 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 1e-23 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 3e-23 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 4e-21 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 1e-20 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 3e-16 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 8e-09 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 1e-26 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 1e-25 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 2e-23 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 3e-23 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 6e-22 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 6e-22 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 7e-22 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 5e-20 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 4e-19 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 5e-15 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 2e-06 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 2e-25 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 1e-24 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 2e-24 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 3e-24 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 5e-24 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 8e-23 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 9e-22 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 3e-18 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 2e-14 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 1e-24 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 3e-23 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 3e-23 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 4e-23 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 1e-22 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 6e-21 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 7e-21 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 2e-20 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 8e-20 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 1e-19 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 2e-19 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 2e-18 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 5e-18 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 2e-12 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 7e-24 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 2e-23 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 2e-23 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 2e-22 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 1e-20 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 3e-17 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 7e-17 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 5e-13 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 9e-24 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 1e-22 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 5e-22 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 5e-22 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 5e-22 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 3e-21 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 6e-21 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 9e-21 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 2e-17 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 8e-16 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 1e-15 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 2e-14 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 1e-06 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 7e-23 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 4e-22 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 4e-22 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 5e-22 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 8e-22 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 4e-21 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 3e-19 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 2e-18 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 1e-17 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 2e-17 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 5e-17 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 1e-10 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 2e-22 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 3e-22 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 3e-22 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 8e-22 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 5e-20 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 1e-18 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 3e-18 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 3e-18 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 1e-17 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 5e-17 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 2e-14 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 5e-11 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-21 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-21 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-21 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 6e-21 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 6e-21 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-19 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-19 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-19 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 2e-17 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 8e-17 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 7e-16 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 1e-15 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 9e-15 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-14 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 1e-13 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-13 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 3e-05 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 5e-21 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 4e-20 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 5e-20 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 5e-20 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 9e-20 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 1e-18 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 3e-17 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 1e-16 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 5e-16 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 6e-16 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 1e-15 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 5e-10 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 9e-21 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 9e-21 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 9e-21 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 1e-20 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 3e-20 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 8e-19 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 2e-18 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 4e-17 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 1e-16 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 2e-16 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 1e-14 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 2e-10 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 1e-19 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 2e-19 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 4e-19 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 4e-19 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 5e-19 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 5e-19 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 5e-19 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 2e-18 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 3e-18 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 6e-18 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 7e-17 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 1e-15 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 2e-14 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 4e-14 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 3e-08 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 7e-19 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 7e-19 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-18 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-17 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-17 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-17 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-16 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-15 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 1e-14 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-14 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 7e-14 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 9e-14 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 2e-13 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 3e-13 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 9e-12 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 6e-16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 6e-16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 6e-16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 9e-16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 9e-16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 9e-16 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 1e-15 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 2e-15 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 2e-14 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 4e-13 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 9e-13 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 3e-12 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 9e-12 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 5e-10 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 5e-09 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 8e-09 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 8e-16 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 8e-16 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 8e-16 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 3e-15 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 3e-15 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 5e-15 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 5e-15 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 5e-15 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 6e-15 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 3e-14 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 3e-14 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 5e-13 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 3e-12 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 1e-11 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 1e-11 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 2e-11 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 8e-11 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 8e-11 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 2e-10 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 2e-08 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 1e-04 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 9e-16 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 9e-16 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 9e-16 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 9e-16 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 3e-15 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 1e-14 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 1e-14 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 1e-14 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 1e-14 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 6e-14 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 2e-13 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 1e-12 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 6e-12 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 4e-11 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 4e-11 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 7e-11 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 4e-10 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 9e-05 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 7e-15 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 7e-15 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 7e-15 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 9e-14 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 4e-13 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 5e-13 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 5e-13 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 5e-13 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 3e-12 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 1e-11 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 1e-11 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 2e-09 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 4e-09 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 2e-08 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 6e-08 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 8e-15 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 3e-14 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 4e-14 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 4e-14 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 4e-14 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 5e-14 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 1e-13 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 1e-13 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 1e-13 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 1e-13 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 3e-13 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 5e-13 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 6e-11 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 3e-10 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 4e-10 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 6e-10 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 5e-09 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 2e-04 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-14 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-14 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-14 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 3e-13 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 3e-13 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 4e-13 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 4e-13 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 2e-12 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 4e-11 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 4e-10 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 4e-10 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 6e-10 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-09 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 1e-08 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 5e-04 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 1e-14 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 7e-14 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-13 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 3e-13 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 7e-13 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 7e-13 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 7e-13 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 6e-12 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-11 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 8e-11 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 2e-10 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 4e-10 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 4e-09 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 5e-09 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 4e-08 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 8e-05 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 3e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 5e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 5e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 5e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 7e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 7e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 7e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 9e-14 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 1e-12 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-11 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-10 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-10 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 4e-10 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 6e-10 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-09 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 2e-04 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 3e-14 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 3e-14 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 3e-14 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 8e-14 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 6e-13 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 8e-13 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 8e-13 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 9e-13 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 9e-12 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 9e-12 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 9e-11 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 2e-09 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 5e-08 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 5e-06 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 4e-14 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 4e-14 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 4e-14 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 6e-14 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 6e-14 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 6e-14 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 3e-13 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 1e-12 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-12 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-12 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 8e-11 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-10 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-10 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 1e-09 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 2e-09 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 1e-08 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 1e-07 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 1e-07 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 6e-07 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 3e-13 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 2e-12 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 3e-12 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 3e-12 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 2e-11 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 6e-11 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 6e-11 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 2e-10 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 7e-10 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 7e-09 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 2e-08 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 1e-07 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 3e-07 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 5e-07 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 7e-07 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 3e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 5e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 9e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 9e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 9e-12 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 6e-11 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 4e-10 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 2e-09 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 8e-09 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 8e-05 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 2e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 2e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 3e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 6e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 6e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 6e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 7e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 7e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 7e-11 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 6e-10 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 1e-09 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 1e-09 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 6e-09 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 6e-08 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 3e-07 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 1e-06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 9e-10 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 5e-09 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 5e-09 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 2e-08 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 4e-08 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 7e-08 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 1e-07 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 3e-07 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 4e-07 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 4e-07 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 7e-07 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 1e-06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 1e-06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 1e-06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 2e-06 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 2e-06 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 2e-09 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 2e-09 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 7e-09 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 1e-07 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 1e-07 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 3e-07 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 7e-07 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 5e-06 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 5e-06 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 7e-06 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 1e-05 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 1e-04 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len | 2e-04 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-08 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-08 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-08 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 3e-07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 3e-07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 3e-07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 6e-07 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 1e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 2e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 4e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 4e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 7e-06 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 3e-05 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 5e-05 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 2e-04 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 4e-04 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 6e-08 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 6e-08 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 7e-08 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 8e-08 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 5e-07 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 5e-07 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 5e-07 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 1e-06 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 1e-06 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 3e-06 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 7e-06 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 4e-05 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 1e-04 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 1e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 3e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 3e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 3e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 3e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 3e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 4e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 8e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 8e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 8e-07 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 3e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 5e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 5e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 6e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 7e-06 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 2e-04 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 4e-04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-07 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 2e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 2e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 4e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 4e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 4e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 5e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 6e-07 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 2e-06 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 2e-06 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 2e-06 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 3e-06 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 9e-06 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 2e-05 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 4e-05 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 5e-05 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 5e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-07 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-06 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-06 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-05 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-04 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-07 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-05 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-07 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 8e-06 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 8e-06 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 8e-06 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 8e-06 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-05 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 2e-04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-04 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 3e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-07 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-07 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 8e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 8e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 8e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-04 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-07 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 7e-05 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 8e-05 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-07 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 8e-05 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-04 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 8e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 4e-07 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 2e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 2e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 2e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 2e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 3e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 6e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 9e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 9e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 9e-05 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 1e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 1e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 2e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 4e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 4e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 4e-04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 9e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-07 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-07 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-05 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-05 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-04 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-07 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-05 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-05 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-07 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-06 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-06 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-06 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-06 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-05 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-05 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-05 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-05 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-05 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-04 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-07 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 7e-06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-06 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-07 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-05 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-05 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-07 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 7e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 8e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 9e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 9e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 9e-05 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 6e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-07 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-05 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 7e-07 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 6e-05 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 6e-05 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 6e-05 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 6e-05 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 7e-05 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 1e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 1e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 1e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 1e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 3e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 3e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 4e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 5e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 5e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 5e-04 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 8e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-07 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-07 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-05 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-05 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-05 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-05 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 8e-07 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 9e-07 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-05 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-04 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-07 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-05 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-06 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-06 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 8e-05 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-06 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-06 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-05 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-05 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-05 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-05 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-05 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-04 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-06 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-04 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-06 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 6e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 6e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 6e-04 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 8e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-06 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 1e-06 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 8e-05 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 8e-05 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 8e-05 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 1e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 1e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 1e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 1e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 1e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 2e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 8e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 9e-04 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 9e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-06 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-06 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 5e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-05 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-04 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 9e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-06 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-05 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 4e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-04 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-04 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-06 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 2e-06 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 9e-05 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 9e-05 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 9e-05 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 9e-05 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 1e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 3e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 4e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 8e-04 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 8e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-06 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 9e-05 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 6e-04 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-04 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 9e-05 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 1e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 7e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-06 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-05 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-05 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-05 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-05 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-05 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-05 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-05 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-04 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-06 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 5e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-06 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-04 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-06 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-04 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-06 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-06 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 2e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 3e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 4e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 6e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 3e-06 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 6e-05 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 7e-05 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 7e-05 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 7e-05 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 7e-05 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 2e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 2e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 2e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 5e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 5e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 5e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 6e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 6e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 6e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 6e-04 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 8e-04 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-06 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 9e-05 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-04 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 7e-04 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 7e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-06 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-04 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-06 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 1e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-06 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-04 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-06 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-05 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 5e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-06 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 4e-06 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 3e-05 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 1e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 2e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 5e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 7e-04 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 8e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 5e-06 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 3e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 3e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 3e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 4e-04 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 6e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-06 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 3e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-04 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-06 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 4e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 6e-04 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-06 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-05 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-05 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-05 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-05 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 9e-05 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 1e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 5e-04 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 6e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 6e-06 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 3e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 6e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 6e-04 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 6e-04 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-06 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-05 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-05 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-05 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 7e-05 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 5e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 7e-06 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 5e-05 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 5e-05 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 5e-05 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 6e-04 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 6e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 8e-06 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 8e-06 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 8e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 8e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 8e-04 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 8e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 9e-06 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 1e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 2e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 4e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 6e-04 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 8e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 1e-05 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 2e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-05 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 1e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 4e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 5e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 7e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 7e-04 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 7e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-05 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-05 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 4e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 6e-04 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 7e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 2e-05 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 3e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-04 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 6e-04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 2e-05 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 9e-05 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 9e-05 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 9e-05 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 1e-04 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 2e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 4e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 6e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 6e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 6e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 7e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 7e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 7e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 7e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 7e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 7e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 7e-05 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 1e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-05 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 2e-04 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 3e-04 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 6e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 6e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 6e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 6e-05 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 2e-04 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 4e-04 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 5e-04 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 3e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 3e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 3e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 4e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 4e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 4e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 4e-05 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 3e-04 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 8e-04 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 8e-04 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 3e-05 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 1e-04 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 2e-04 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 4e-04 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 8e-04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-05 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 8e-04 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 9e-04 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-05 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 4e-05 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-05 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-04 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-04 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 1e-04 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 6e-05 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 2e-04 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 2e-04 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 7e-04 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 6e-05 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 6e-05 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 6e-05 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 1e-04 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 1e-04 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 1e-04 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 1e-04 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 6e-04 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 7e-05 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 8e-04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 8e-05 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 4e-04 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 5e-04 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 1e-04 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 7e-04 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 7e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 2e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 3e-04 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 3e-04 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 3e-04 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 4e-04 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 4e-04 | |
| 1ej6_B | 1275 | Lambda1; icosahedral, non-equivalence, dsRNA virus | 5e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 |
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Length = 446 | Back alignment and structure |
|---|
Score = 264 bits (676), Expect = 5e-79
Identities = 87/315 (27%), Positives = 134/315 (42%), Gaps = 18/315 (5%)
Query: 733 QWFEQKLDHFNIEEPRTWKQRYFVNSTWYKH-GGPIFLMIGGEGEASAKWMVEGTWLDYA 791
+F+QK+DHF +T+ QRY V ++K GG I G EG+ G D A
Sbjct: 6 LYFQQKVDHFGFNTVKTFNQRYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVA 65
Query: 792 HNHNALAVQVEHRFYGKSHPLSDLSVESL---QYLSAEQALADLAYFITSMNTLYSLPAH 848
A+ V EHR+YG+S P D S + +L++EQALAD A I + +
Sbjct: 66 EELKAMLVFAEHRYYGESLPFGDNSFKDSRHLNFLTSEQALADFAELIKHLKRTIPGAEN 125
Query: 849 TKWIAFGGSYPGALAAWLRYKYPHLVHGAMSASGPLRAVVDFPE---YFGVVADALATVS 905
IA GGSY G LAAW R KYPH+V GA++AS P+ D + +V
Sbjct: 126 QPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFEDLVPCGVFMKIVTTDFRKSG 185
Query: 906 TECVKAVQTATHTISKMLKSPSDAKYLTEQFKLCTPLDINNAKDVSSFVESLADNIAGVV 965
C +++ + I+++ + S ++LT LC+PL + + + ++ N+A V
Sbjct: 186 PHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWISETWVNLAMVD 245
Query: 966 QYNKDNRES-SNHITIDDLCALLMDKKQDPVARYAAVNDLILSKEKKKNPCVDYKYEKMI 1024
N I +C L + + + V Y Y +
Sbjct: 246 YPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQAL---------NVYYNYSGQV 296
Query: 1025 EDMKNTSWDSEMANG 1039
N S + + G
Sbjct: 297 -KCLNISETATSSLG 310
|
| >3jyh_A Dipeptidyl-peptidase 2; structural genomics, structural genomics consortium, SGC, aminopeptidase, cleavage on PAIR of basic residues; HET: NAG BMA; 2.19A {Homo sapiens} PDB: 3n0t_A* Length = 469 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 | Back alignment and structure |
|---|
| >1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1042 | |||
| 4ebb_A | 472 | Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2 | 100.0 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 100.0 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.98 | |
| 2i13_A | 190 | AART; DNA binding, zinc finger, DNA binding protei | 99.97 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.94 | |
| 1tf6_A | 190 | Protein (transcription factor IIIA); complex (tran | 99.94 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.9 | |
| 2gli_A | 155 | Protein (five-finger GLI); protein/DNA complex, tr | 99.89 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.81 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.81 | |
| 2rpc_A | 155 | Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr | 99.8 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.8 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.8 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.8 | |
| 2lt7_A | 133 | Transcriptional regulator kaiso; zinc finger, doub | 99.79 | |
| 1ubd_C | 124 | Protein (YY1 zinc finger domain); transcription in | 99.79 | |
| 2dlq_A | 124 | GLI-kruppel family member HKR3; ZF-C2H2 domain, st | 99.79 | |
| 2jp9_A | 119 | Wilms tumor 1; DNA binding, nucleic acid recogniti | 99.74 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.67 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.63 | |
| 2dmi_A | 115 | Teashirt homolog 3; zinc finger protein 537, struc | 99.63 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.63 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.61 | |
| 1wjp_A | 107 | Zinc finger protein 295; ZF-C2H2 domain, zinc bind | 99.61 | |
| 2ee8_A | 106 | Protein ODD-skipped-related 2; zinc binding, ZF-C2 | 99.6 | |
| 2kmk_A | 82 | Zinc finger protein GFI-1; tandem repeat zinc fing | 99.6 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.6 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.57 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.56 | |
| 2dmd_A | 96 | Zinc finger protein 64, isoforms 1 and 2; ZNF338, | 99.56 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.56 | |
| 1a1h_A | 90 | QGSR zinc finger peptide; complex (zinc finger/DNA | 99.55 | |
| 2yt9_A | 95 | Zinc finger-containing protein 1; C2H2, structural | 99.55 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.52 | |
| 4gzn_C | 60 | ZFP-57, zinc finger protein 57; transcription-DNA | 99.52 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.5 | |
| 2csh_A | 110 | Zinc finger protein 297B; ZF-C2H2 domain, zinc fin | 99.48 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.47 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.47 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.47 | |
| 2ebt_A | 100 | Krueppel-like factor 5; C2H2-type zinc-finger, met | 99.46 | |
| 1llm_C | 88 | Chimera of ZIF23-GCN4; dimerization, DNA recogniti | 99.46 | |
| 2wbs_A | 89 | Krueppel-like factor 4; transcription-DNA complex, | 99.45 | |
| 2j7j_A | 85 | Transcription factor IIIA; zinc finger module, alt | 99.42 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.4 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.37 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.37 | |
| 1x6h_A | 86 | Transcriptional repressor CTCF; zinc finger protei | 99.35 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.35 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.34 | |
| 2gqj_A | 98 | Zinc finger protein KIAA1196; ZF-C2H2 like domain, | 99.33 | |
| 2dlk_A | 79 | Novel protein; ZF-C2H2 domain, zinc finger protein | 99.3 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.3 | |
| 2ctd_A | 96 | Zinc finger protein 512; zinc binding, two ZF-C2H2 | 99.29 | |
| 2cot_A | 77 | Zinc finger protein 435; ADK_LID domain, zinc fing | 99.28 | |
| 2wbt_A | 129 | B-129; zinc finger; 2.70A {Sulfolobus virus 1} | 99.27 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.26 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.25 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.24 | |
| 2ghf_A | 102 | ZHX1, zinc fingers and homeoboxes protein 1; C2H2 | 99.23 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.22 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.21 | |
| 2ctu_A | 73 | Zinc finger protein 483; zinc finger domain, struc | 99.2 | |
| 2lce_A | 74 | B-cell lymphoma 6 protein; structural genomics, no | 99.19 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.18 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.18 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.17 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.17 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.17 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.17 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 99.16 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.16 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.16 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.16 | |
| 2lv2_A | 85 | Insulinoma-associated protein 1; structural genomi | 99.16 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.16 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 99.16 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.15 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 99.15 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.15 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.15 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.15 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.15 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.15 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.15 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 99.15 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.15 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 99.15 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.15 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.15 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.14 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.14 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.14 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.14 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.14 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.14 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.14 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.14 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.14 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.14 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.14 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.14 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.14 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.14 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 99.14 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.13 | |
| 1x5w_A | 70 | Zinc finger protein 64, isoforms 1; ZNF338, nuclea | 99.13 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.13 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.13 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 99.13 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.13 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.13 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 99.12 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.12 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.12 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.12 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 99.12 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.11 | |
| 1x6e_A | 72 | Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca | 99.11 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.11 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.1 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 99.1 | |
| 2ct1_A | 77 | Transcriptional repressor CTCF; CCCTC-BINDING fact | 99.1 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.09 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 99.09 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 99.09 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 99.09 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.08 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 99.08 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.08 | |
| 1bbo_A | 57 | Human enhancer-binding protein MBP-1; DNA-binding | 99.08 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.08 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.08 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 99.07 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.07 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.07 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.07 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 99.07 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 99.07 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.07 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.07 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.06 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.06 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 99.06 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.06 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 99.06 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.06 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 99.06 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 99.06 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.06 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 99.05 | |
| 3uk3_C | 57 | Zinc finger protein 217; transcription factor, DNA | 99.05 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.05 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.05 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 99.05 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 99.05 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 99.05 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 99.05 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.05 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.05 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.05 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.04 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 99.04 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.04 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 99.04 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 99.04 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 99.04 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 99.04 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 99.04 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 99.04 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 99.04 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 99.04 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 99.03 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 99.03 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 99.03 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.03 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 99.03 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.03 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.03 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.03 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 99.02 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 99.02 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 99.02 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 99.02 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 99.02 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 99.02 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.02 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 99.02 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 99.01 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 99.01 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 99.01 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 99.01 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 99.01 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 99.01 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 99.01 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 99.01 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 99.0 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 99.0 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 99.0 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.99 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.99 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 98.99 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.99 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.99 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 98.99 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 98.99 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 98.99 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.99 | |
| 2ej4_A | 95 | Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi | 98.98 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 98.98 | |
| 2adr_A | 60 | ADR1; transcription regulation, zinc finger,; NMR | 98.98 | |
| 2drp_A | 66 | Protein (tramtrack DNA-binding domain); protein-DN | 98.98 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.98 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 98.98 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 98.98 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 98.98 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 98.98 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 98.98 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 98.98 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 98.97 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.97 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 98.97 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 98.97 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 98.96 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 98.96 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.96 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 98.96 | |
| 2d9h_A | 78 | Zinc finger protein 692; ZF-C2H2 domain, structura | 98.96 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 98.95 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 98.95 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 98.95 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 98.95 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.95 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 98.95 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 98.95 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 98.95 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 98.95 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 98.95 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 98.94 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 98.94 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.94 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 98.93 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 98.93 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.92 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 98.92 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.92 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 98.92 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 98.91 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.9 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.9 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 98.89 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 98.89 | |
| 1f2i_G | 73 | Fusion of N-terminal 17-MER peptide extension to Z | 98.89 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.89 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 98.88 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.88 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 98.88 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 98.86 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 98.86 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 98.85 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 98.85 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 98.84 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.84 | |
| 2em0_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.83 | |
| 2ytn_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.83 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 98.83 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 98.83 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 98.83 | |
| 2eml_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.83 | |
| 2el4_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.82 | |
| 2eq4_A | 46 | Zinc finger protein 224; C2H2, zinc finger domain, | 98.82 | |
| 2emk_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.82 | |
| 2ep2_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.82 | |
| 2eoe_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.82 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 98.81 | |
| 2eoq_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.81 | |
| 2ytj_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.81 | |
| 2eoo_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 2eov_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.81 | |
| 2ely_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.81 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 98.81 | |
| 2emm_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 2ema_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.81 | |
| 2eop_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.81 | |
| 2em5_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 98.81 | |
| 2emf_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.81 | |
| 2ene_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.81 | |
| 2eme_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.81 | |
| 2ytg_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.81 | |
| 2en1_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.81 | |
| 2emy_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.8 | |
| 2ytr_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.8 | |
| 2epw_A | 46 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.8 | |
| 2elz_A | 46 | Zinc finger protein 224; DNA-binding, metal-bindin | 98.8 | |
| 2eq0_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.8 | |
| 2emp_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.8 | |
| 2ytk_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.8 | |
| 2yu8_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.8 | |
| 2emx_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.8 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 98.8 | |
| 2en8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.8 | |
| 2epz_A | 46 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.79 | |
| 2emh_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.79 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 98.79 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 98.79 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 98.79 | |
| 2em9_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.79 | |
| 2em7_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.79 | |
| 2ytq_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.79 | |
| 2ytd_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.78 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.78 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 98.78 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 98.78 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.78 | |
| 2ep3_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.77 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 98.76 | |
| 2en6_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.76 | |
| 2el6_A | 46 | Zinc finger protein 268; alternative splicing, DNA | 98.76 | |
| 1vd4_A | 62 | Transcription initiation factor IIE, alpha subunit | 98.76 | |
| 2enc_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.75 | |
| 2ysp_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.75 | |
| 2ytm_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.75 | |
| 2yso_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.75 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 98.75 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 98.74 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 98.74 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 98.74 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 98.74 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 98.74 | |
| 1x3c_A | 73 | Zinc finger protein 292; DNA binding, nuclear prot | 98.73 | |
| 2em8_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.72 | |
| 1yui_A | 54 | GAGA-factor; complex (DNA-binding protein/DNA), ch | 98.72 | |
| 1njq_A | 39 | Superman protein; zinc-finger, peptide-zinc comple | 98.72 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 98.72 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 98.72 | |
| 2eps_A | 54 | POZ-, at HOOK-, and zinc finger-containing protein | 98.71 | |
| 2epx_A | 47 | Zinc finger protein 28 homolog; C2H2, zinc finger | 98.71 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.71 | |
| 2eod_A | 66 | TNF receptor-associated factor 4; zinc binding, NF | 98.7 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 98.7 | |
| 2elo_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.69 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 98.69 | |
| 2em2_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.69 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 98.68 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 98.67 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 98.67 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 98.11 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 98.66 | |
| 2eq2_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.66 | |
| 1p7a_A | 37 | BF3, BKLF, kruppel-like factor 3; classical zinc f | 98.66 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 98.66 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 98.65 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 98.65 | |
| 2yth_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.65 | |
| 2enf_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.65 | |
| 2emj_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.64 | |
| 2ep1_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.64 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 98.64 | |
| 2el5_A | 42 | Zinc finger protein 268; alternative splicing, DNA | 98.64 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 98.63 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 98.63 | |
| 2ytp_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.63 | |
| 2yti_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.63 | |
| 2yts_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.63 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 98.63 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 98.63 | |
| 2eow_A | 46 | Zinc finger protein 347; ZF-C2H2, structural genom | 98.63 | |
| 2em3_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.63 | |
| 2em6_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.63 | |
| 2eq1_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.62 | |
| 2emg_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.62 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 98.62 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 98.62 | |
| 2ytf_A | 46 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.62 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 98.62 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 98.62 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 98.62 | |
| 2en7_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.61 | |
| 2yrj_A | 46 | Zinc finger protein 473; C2H2-type zinc finger, st | 98.61 | |
| 2epa_A | 72 | Krueppel-like factor 10; transforming growth facto | 98.61 | |
| 2em4_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.61 | |
| 2elx_A | 35 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.61 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 98.61 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 98.61 | |
| 2emi_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.61 | |
| 2eof_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.61 | |
| 2eoz_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.6 | |
| 1srk_A | 35 | Zinc finger protein ZFPM1; classical zinc finger, | 98.6 | |
| 2ep0_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.6 | |
| 2en9_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.6 | |
| 2eon_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.6 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 98.6 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 98.6 | |
| 2yte_A | 42 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.6 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 98.59 | |
| 2yto_A | 46 | Zinc finger protein 484; ZF-C2H2, structural genom | 98.59 | |
| 2emb_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.59 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 98.59 | |
| 2eoj_A | 44 | Zinc finger protein 268; ZF-C2H2, structural genom | 98.59 | |
| 2ytb_A | 42 | Zinc finger protein 32; zinc-finger domain, C2H2, | 98.59 | |
| 2yu5_A | 44 | Zinc finger protein 473; ZF-C2H2 domain, structura | 98.59 | |
| 2eor_A | 46 | Zinc finger protein 224; ZF-C2H2, structural genom | 98.59 | |
| 2epr_A | 48 | POZ-, at HOOK-, and zinc finger-containing protein | 98.58 | |
| 2eln_A | 38 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.58 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 98.58 | |
| 2enh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.58 | |
| 2eoh_A | 46 | Zinc finger protein 28 homolog; ZF-C2H2, structura | 98.58 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 98.58 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 98.58 | |
| 2eoy_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.58 | |
| 2eq3_A | 46 | Zinc finger protein 347; C2H2, zinc finger domain, | 98.57 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 98.57 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 98.57 | |
| 2ytt_A | 46 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.56 | |
| 2eos_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.56 | |
| 2epq_A | 45 | POZ-, at HOOK-, and zinc finger-containing protein | 98.55 | |
| 1rim_A | 33 | E6APC2 peptide; E6-binding domain, zinc finger, hu | 98.55 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 98.54 | |
| 2emz_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.54 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 98.53 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 98.53 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 98.52 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 98.52 | |
| 2en3_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.52 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 98.52 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 98.52 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 98.52 | |
| 2en2_A | 42 | B-cell lymphoma 6 protein; ZF-C2H2, structural gen | 98.52 | |
| 2eox_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.52 | |
| 2epc_A | 42 | Zinc finger protein 32; zinc finger domain, C2H2, | 98.51 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 98.51 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 98.51 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 98.51 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 98.51 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 98.51 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 98.5 | |
| 2eou_A | 44 | Zinc finger protein 473; ZF-C2H2, structural genom | 98.5 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 98.5 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 98.48 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 98.48 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.48 | |
| 2elp_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.47 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 98.47 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 98.47 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 98.47 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 98.46 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 98.46 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 98.46 | |
| 2elm_A | 37 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.46 | |
| 1bhi_A | 38 | CRE-BP1, ATF-2; CRE binding protein, transcription | 98.46 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 98.46 | |
| 2epv_A | 44 | Zinc finger protein 268; C2H2, zinc finger domain, | 98.46 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 98.45 | |
| 2elv_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.45 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 98.45 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 98.45 | |
| 2ent_A | 48 | Krueppel-like factor 15; zinc binding, transcripti | 98.44 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.44 | |
| 2d9k_A | 75 | FLN29 gene product; zinc finger, ZF-TRAF, structur | 98.43 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 98.43 | |
| 1ncs_A | 47 | Peptide M30F, transcriptional factor SWI5; DNA bin | 98.43 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 98.42 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 98.42 | |
| 2elt_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.42 | |
| 2eom_A | 46 | ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s | 98.42 | |
| 2epu_A | 45 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.42 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 98.42 | |
| 2elq_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.42 | |
| 2elr_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.41 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 98.41 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 98.41 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 98.41 | |
| 2yrm_A | 43 | B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, | 98.4 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 98.39 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 98.38 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 98.38 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 98.37 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 98.37 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 98.37 | |
| 2kfq_A | 32 | FP1; protein, de novo protein; NMR {Synthetic} | 98.37 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 98.36 | |
| 1x6f_A | 88 | Zinc finger protein 462; zinc finger domain, KIAA1 | 98.36 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 98.35 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 98.35 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 98.34 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 98.34 | |
| 2ept_A | 41 | Zinc finger protein 32; C2H2, zinc finger domain, | 98.34 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 98.34 | |
| 2els_A | 36 | Zinc finger protein 406; ZFAT zinc finger 1, struc | 98.33 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 98.33 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 98.32 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 98.32 | |
| 3iuf_A | 48 | Zinc finger protein UBI-D4; structural genomics co | 98.32 | |
| 4ao6_A | 259 | Esterase; hydrolase, thermo label; 1.60A {Unidenti | 98.32 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 98.31 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 98.31 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 98.31 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 98.3 | |
| 1fv5_A | 36 | First zinc finger of U-shaped; CCHC, protein inter | 98.3 |
| >4ebb_A Dipeptidyl peptidase 2; hydrolase; HET: MSE NAG; 2.00A {Homo sapiens} PDB: 3jyh_A* 3n0t_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-58 Score=535.23 Aligned_cols=283 Identities=31% Similarity=0.529 Sum_probs=239.0
Q ss_pred CCcchhhhhcccCCCC--CcccceEEEEEecccccCC-CcEEEEECCCCCCcccccccccHHHHHHHcCCeEEEEeeeec
Q psy3685 730 PSDQWFEQKLDHFNIE--EPRTWKQRYFVNSTWYKHG-GPIFLMIGGEGEASAKWMVEGTWLDYAHNHNALAVQVEHRFY 806 (1042)
Q Consensus 730 ~~~~~f~q~~dhf~~~--~~~tf~qry~~~~~~~~~~-~pi~~~~gg~g~~~~~~~~~~~~~~la~~~~a~~~~~ehR~~ 806 (1042)
+++.||+|+|||||++ +++||+||||+|++||+++ ||||||+||||++...+.+.|++.+||+++||++|+||||||
T Consensus 5 ~~~~~f~Q~lDHFn~~~~~~~TF~QRY~~n~~~~~~~~gPIfl~~gGEg~~~~~~~~~g~~~~lA~~~~a~~v~lEHRyY 84 (472)
T 4ebb_A 5 FQERFFQQRLDHFNFERFGNKTFPQRFLVSDRFWVRGEGPIFFYTGNEGDVWAFANNSAFVAELAAERGALLVFAEHRYY 84 (472)
T ss_dssp CEEEEEEEESCSSCSSTTTTCEEEEEEEEECTTCCTTTCCEEEEECCSSCHHHHHHHCHHHHHHHHHHTCEEEEECCTTS
T ss_pred CceeeEEeecCCCCCCCCCCCEEEEEEEEecceeCCCCCcEEEEECCCccccccccCccHHHHHHHHhCCeEEEEecccc
Confidence 5689999999999964 5789999999999999765 999999999999988888889999999999999999999999
Q ss_pred ccccCCCCCCcc--cccCCCHHHHHhHHHHHHHHHhhhcCCCCCCcEEEEccchhHHHHHHHHHhCCCeEEEEEeecccc
Q psy3685 807 GKSHPLSDLSVE--SLQYLSAEQALADLAYFITSMNTLYSLPAHTKWIAFGGSYPGALAAWLRYKYPHLVHGAMSASGPL 884 (1042)
Q Consensus 807 G~S~p~~~~~~~--~~~~lt~~q~l~D~~~~~~~~~~~~~~~~~~~~i~~G~Sygg~la~~~~~~yP~~~~g~i~ssa~~ 884 (1042)
|+|.|+++++++ ||+|||++|||+|+|+||++++.++.. .++|||+|||||||+||||+|+|||++|+|||||||||
T Consensus 85 G~S~P~~~~st~~~nL~yLt~eQALaD~a~fi~~~k~~~~~-~~~pwI~~GGSY~G~LaAW~R~kYP~lv~ga~ASSApv 163 (472)
T 4ebb_A 85 GKSLPFGAQSTQRGHTELLTVEQALADFAELLRALRRDLGA-QDAPAIAFGGSYGGMLSAYLRMKYPHLVAGALAASAPV 163 (472)
T ss_dssp TTCCTTGGGGGSTTSCTTCSHHHHHHHHHHHHHHHHHHTTC-TTCCEEEEEETHHHHHHHHHHHHCTTTCSEEEEETCCT
T ss_pred cCCcCCCCCCccccccccCCHHHHHHHHHHHHHHHHhhcCC-CCCCEEEEccCccchhhHHHHhhCCCeEEEEEecccce
Confidence 999999999987 899999999999999999999999864 56899999999999999999999999999999999999
Q ss_pred ccccCC---hhhHHHHHHHhhccChhhHHHHHHHHHHHHHHhcCCchHHHHHHHhcCCCCCCCCChhcHHHHHHHHHHHh
Q psy3685 885 RAVVDF---PEYFGVVADALATVSTECVKAVQTATHTISKMLKSPSDAKYLTEQFKLCTPLDINNAKDVSSFVESLADNI 961 (1042)
Q Consensus 885 ~~~~~~---~~~~~~v~~~~~~~~~~c~~~i~~~~~~~~~~~~~~~~~~~l~~~f~~~~~~~~~~~~~~~~~~~~~~~~~ 961 (1042)
+++.|| ++|++.|...+...+++|+++|+++++.|++++.++ +.+.+.+.|++|.+++ +..|+..++..+.+.+
T Consensus 164 ~a~~df~~y~~~~~~v~~~~~~~~~~C~~~i~~a~~~i~~~~~~~-~~~~~~~~f~~c~~~~--~~~d~~~~~~~~~~~~ 240 (472)
T 4ebb_A 164 LAVAGLGDSNQFFRDVTADFEGQSPKCTQGVREAFRQIKDLFLQG-AYDTVRWEFGTCQPLS--DEKDLTQLFMFARNAF 240 (472)
T ss_dssp TGGGTCSCTTHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHHHT-CHHHHHHHHTBSSCCC--SHHHHHHHHHHHHHHH
T ss_pred EEeccccccHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhcc-hHHHHHHHhcCCCCCC--ChHHHHHHHHHHHHHH
Confidence 999855 677888888888889999999999999999998765 4567899999999986 4456666665555554
Q ss_pred hhh--hccC--CCCCCCCCCCCHHHHHHHhhcCCCCHHHHHHHHHHHHHhcCCCCCccccc
Q psy3685 962 AGV--VQYN--KDNRESSNHITIDDLCALLMDKKQDPVARYAAVNDLILSKEKKKNPCVDY 1018 (1042)
Q Consensus 962 ~~~--~~y~--~~~~~~~~~~~~~~~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~ 1018 (1042)
+.+ ++|+ .+..++.+..++..+|+.|++. .+.+..++.+..++++ .++...|+|.
T Consensus 241 ~~~~~~~y~~~~~~~~~~~~~~~~~~c~~~~~~-~~~~~~~~~~~~~~~~-~~~~~~c~~~ 299 (472)
T 4ebb_A 241 TVLAMMDYPYPTDFLGPLPANPVKVGCDRLLSE-AQRITGLRALAGLVYN-ASGSEHCYDI 299 (472)
T ss_dssp HHHHHTCCSSCEESSSEECSSHHHHHHHHHHTC-SSHHHHHHHHHHHHHC-TTSCCSSBCH
T ss_pred HHHhhhccccchhhcccCccchHHHHHHHhccc-chHHHHHHHHHHHHhh-ccCCcchhhh
Confidence 443 3333 3334445677899999999865 3566677766666543 3456678876
|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* | Back alignment and structure |
|---|
| >1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* | Back alignment and structure |
|---|
| >2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C | Back alignment and structure |
|---|
| >2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A | Back alignment and structure |
|---|
| >2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A | Back alignment and structure |
|---|
| >2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A | Back alignment and structure |
|---|
| >2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A | Back alignment and structure |
|---|
| >2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A | Back alignment and structure |
|---|
| >2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A | Back alignment and structure |
|---|
| >2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 | Back alignment and structure |
|---|
| >2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* | Back alignment and structure |
|---|
| >1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A | Back alignment and structure |
|---|
| >2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >2kfq_A FP1; protein, de novo protein; NMR {Synthetic} | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 1042 | ||||
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 4e-07 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 4e-07 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 4e-07 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 6e-07 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 3e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 3e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 7e-06 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-05 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-05 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 3e-05 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 9e-05 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 2e-04 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 3e-04 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 6e-04 | |
| d2csha1 | 53 | g.37.1.1 (A:8-60) Zinc finger protein 297b {Human | 0.002 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 1e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 1e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 1e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 1e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 3e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 3e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 3e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 5e-05 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 1e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 2e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 4e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 8e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 8e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 8e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 8e-04 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 0.002 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 0.003 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 0.003 | |
| d1x6ea1 | 33 | g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H | 0.003 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 7e-05 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 7e-05 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 7e-05 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 3e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 5e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 5e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 5e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 5e-04 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 0.002 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 0.002 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 0.002 | |
| d2cota2 | 38 | g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont | 0.003 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 8e-05 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 8e-05 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 8e-05 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 8e-05 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 2e-04 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 2e-04 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 2e-04 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 6e-04 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 6e-04 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 6e-04 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 7e-04 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.001 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.002 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.002 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.002 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.002 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.002 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.003 | |
| d2epsa1 | 39 | g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ | 0.003 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 9e-05 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 9e-05 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 9e-05 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 1e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 2e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 8e-04 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.001 | |
| d1x6ha2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.002 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 1e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 1e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 1e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 2e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 2e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 2e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 2e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 5e-04 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 0.003 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 0.003 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 0.003 | |
| d1p7aa_ | 37 | g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( | 0.003 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 1e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 1e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 1e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 1e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 2e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 2e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 2e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 3e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 6e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 8e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 8e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 8e-04 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.002 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.002 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.003 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.003 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.003 | |
| d1a1ia2 | 28 | g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) | 0.003 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 2e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 2e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 2e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 2e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 5e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 5e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 5e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 8e-04 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 0.001 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 0.002 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 0.002 | |
| d2adra1 | 29 | g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac | 0.002 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 6e-04 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 6e-04 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 6e-04 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 6e-04 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.001 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.001 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.001 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.003 | |
| d1sp1a_ | 29 | g.37.1.1 (A:) Transcription factor sp1 {Human (Hom | 0.004 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 7e-04 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 7e-04 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 7e-04 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 7e-04 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 0.002 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 0.002 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 0.002 | |
| d2dlka2 | 36 | g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 | 0.003 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.001 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.001 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.001 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d2ct1a2 | 36 | g.37.1.1 (A:8-43) Transcriptional repressor CTCF { | 0.003 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 0.002 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 0.002 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 0.002 | |
| d1srka_ | 35 | g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M | 0.002 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.002 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.003 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.003 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.004 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.004 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.004 | |
| d1x6ea2 | 26 | g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( | 0.004 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Score = 45.4 bits (107), Expect = 4e-07
Identities = 21/51 (41%), Positives = 28/51 (54%), Gaps = 2/51 (3%)
Query: 263 YKCDLCSKKFSRKLNLTKHMKIHQG-IRYKCDLCSKEFSRKGNLTKHMKLH 312
Y C C K F+ K +HM +H G Y C +C K+F K +L HMK+H
Sbjct: 4 YPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 1042 | |||
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.39 | |
| d2csha1 | 53 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 99.33 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 99.29 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 99.24 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.13 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 99.1 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 99.09 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 99.09 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 99.08 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 99.08 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 99.07 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 99.07 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 99.07 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 99.06 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 99.03 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 99.03 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 99.02 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 99.02 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 99.01 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 99.01 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 98.98 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 98.98 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 98.96 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 98.95 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 98.94 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.94 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 98.94 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 98.93 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 98.92 | |
| d2cota2 | 38 | Zinc finger and SCAN domain-containing protein 16, | 98.92 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 98.88 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 98.87 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 98.87 | |
| d2epsa1 | 39 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.83 | |
| d1x6ea1 | 33 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.81 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.8 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 98.79 | |
| d1x6ha2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.79 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.78 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 98.76 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 98.76 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 98.73 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 98.73 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.73 | |
| d1p7aa_ | 37 | Kruppel-like factor 3, Bklf {Mouse (Mus musculus) | 98.72 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 98.71 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.71 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 98.67 | |
| d2dsta1 | 122 | Hypothetical protein TTHA1544 {Thermus thermophilu | 98.65 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 98.64 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 98.6 | |
| d1srka_ | 35 | Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc | 98.59 | |
| d1a1ia2 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.58 | |
| d2adra1 | 29 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 98.57 | |
| d1sp1a_ | 29 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.56 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 98.56 | |
| d2ct1a2 | 36 | Transcriptional repressor CTCF {Human (Homo sapien | 98.55 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 98.51 | |
| d1ncsa_ | 47 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.47 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.47 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 98.45 | |
| d2hu7a2 | 260 | Acylamino-acid-releasing enzyme, C-terminal donain | 98.45 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 98.44 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.42 | |
| d1x6ea2 | 26 | Zinc finger protein 24 {Human (Homo sapiens) [TaxI | 98.42 | |
| d2dlka2 | 36 | Zinc finger protein 692, ZNF692 {Human (Homo sapie | 98.39 | |
| d1qo7a_ | 394 | Bacterial epoxide hydrolase {Aspergillus niger [Ta | 98.36 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 98.36 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 98.36 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.35 | |
| d2glia3 | 30 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 98.33 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 98.3 | |
| d1ubdc3 | 30 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 98.29 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 98.28 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 98.27 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 98.23 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 98.23 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 98.21 | |
| d2pbla1 | 261 | Uncharacterized protein TM1040_2492 {Silicibacter | 98.19 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 98.17 | |
| d1r88a_ | 267 | Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta | 98.11 | |
| d1sp2a_ | 31 | Transcription factor sp1 {Human (Homo sapiens) [Ta | 98.1 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 98.09 | |
| d2dmda2 | 26 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 98.08 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.08 | |
| d1a1ia1 | 29 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 98.05 | |
| d2bgra2 | 258 | Dipeptidyl peptidase IV/CD26, C-terminal domain {P | 98.04 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 98.04 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 98.03 | |
| d1mpxa2 | 381 | Alpha-amino acid ester hydrolase {Xanthomonas citr | 98.03 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 98.01 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 98.01 | |
| d1vlqa_ | 322 | Acetyl xylan esterase TM0077 {Thermotoga maritima | 97.98 | |
| d1pv1a_ | 299 | Hypothetical esterase YJL068C {Baker's yeast (Sacc | 97.95 | |
| d1ubdc4 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.94 | |
| d1ju3a2 | 347 | Bacterial cocaine esterase N-terminal domain {Rhod | 97.93 | |
| d1vkha_ | 263 | Putative serine hydrolase Ydr428c {Baker's yeast ( | 97.92 | |
| d1zfda_ | 32 | SWI5 zinc-finger domains {Baker's yeast (Saccharom | 97.9 | |
| d1l7aa_ | 318 | Cephalosporin C deacetylase {Bacillus subtilis [Ta | 97.82 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.77 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 97.74 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 97.74 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.73 | |
| d2i3da1 | 218 | Hypothetical protein Atu1826 {Agrobacterium tumefa | 97.71 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 97.67 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.67 | |
| d2b9va2 | 385 | Alpha-amino acid ester hydrolase {Acetobacter past | 97.67 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 97.66 | |
| d1jjia_ | 311 | Carboxylesterase {Archaeon Archaeoglobus fulgidus | 97.63 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 97.62 | |
| g1wht.1 | 409 | Serine carboxypeptidase II {Wheat (Triticum vulgar | 97.59 | |
| d1jfra_ | 260 | Lipase {Streptomyces exfoliatus [TaxId: 1905]} | 97.53 | |
| d1a1ia3 | 28 | ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | 97.52 | |
| d1jkma_ | 358 | Carboxylesterase {Bacillus subtilis, brefeldin A e | 97.51 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.43 | |
| d1ubdc2 | 28 | Ying-yang 1 (yy1, zinc finger domain) {Human (Homo | 97.39 | |
| d1ivya_ | 452 | Human 'protective protein', HPP {Human (Homo sapie | 97.38 | |
| d1lzla_ | 317 | Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | 97.26 | |
| d1wpxa1 | 421 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 97.26 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 97.24 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.23 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.21 | |
| d2glia5 | 29 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.18 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.17 | |
| d2epqa1 | 32 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 97.17 | |
| d1bboa1 | 28 | Enhancer binding protein {Human (Homo sapiens) [Ta | 97.15 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 97.14 | |
| d1lnsa3 | 405 | X-Prolyl dipeptidyl aminopeptidase PepX, middle do | 97.13 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 97.1 | |
| d1u4na_ | 308 | Carboxylesterase {Alicyclobacillus acidocaldarius | 97.09 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 97.07 | |
| d1dina_ | 233 | Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI | 97.03 | |
| d2dmda3 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 97.03 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 97.01 | |
| g1gxs.1 | 425 | Hydroxynitrile lyase {Sorghum (Sorghum bicolor) [T | 97.0 | |
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 97.0 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 96.93 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 96.91 | |
| d2epra1 | 35 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 96.89 | |
| d1znfa_ | 26 | XFIN, third domain {Xenopus laevis [TaxId: 8355]} | 96.88 | |
| d2dlqa4 | 27 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 96.81 | |
| d2dlqa3 | 30 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 96.65 | |
| d2gzsa1 | 265 | Enterobactin and salmochelin hydrolase IroE {Esche | 96.62 | |
| d1ac5a_ | 483 | Serine carboxypeptidase II {Baker's yeast (Sacchar | 96.62 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.61 | |
| d2dmda1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 96.61 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 96.57 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 96.47 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 96.37 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 96.32 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.27 | |
| d1bboa2 | 29 | Enhancer binding protein {Human (Homo sapiens) [Ta | 96.27 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 96.24 | |
| d1qlwa_ | 318 | A novel bacterial esterase {Alcaligenes sp. [TaxId | 96.2 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 96.19 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 95.98 | |
| d1thga_ | 544 | Type-B carboxylesterase/lipase {Fungus (Geotrichum | 95.89 | |
| d1qe3a_ | 483 | Thermophilic para-nitrobenzyl esterase (PNB estera | 95.88 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 95.8 | |
| d1ukca_ | 517 | Esterase EstA {Aspergillus niger [TaxId: 5061]} | 95.73 | |
| d1llfa_ | 534 | Type-B carboxylesterase/lipase {Candida cylindrace | 95.73 | |
| d1qfma2 | 280 | Prolyl oligopeptidase, C-terminal domain {Pig (Sus | 95.41 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 95.38 | |
| d2j7ja2 | 29 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 95.3 | |
| d2ha2a1 | 542 | Acetylcholinesterase {Mouse (Mus musculus) [TaxId: | 95.26 | |
| d1p0ia_ | 526 | Butyryl cholinesterase {Human (Homo sapiens) [TaxI | 95.2 | |
| d1njqa_ | 37 | SUPERMAN zinc finger domain {Thale cress (Arabidop | 95.09 | |
| d1klra_ | 30 | ZFY {Human (Homo sapiens) [TaxId: 9606]} | 94.98 | |
| d2csha2 | 44 | Zinc finger protein 297b {Human (Homo sapiens) [Ta | 94.98 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 94.95 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 94.83 | |
| d2glia4 | 31 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 94.7 | |
| d1x5wa2 | 29 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 94.49 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 94.47 | |
| d1ea5a_ | 532 | Acetylcholinesterase {Pacific electric ray (Torped | 94.44 | |
| d1tf3a2 | 30 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 94.38 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 94.36 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 93.97 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 93.96 | |
| d2adra2 | 31 | ADR1 {Synthetic, based on Saccharomyces cerevisiae | 93.94 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 93.89 | |
| d1dx4a_ | 571 | Acetylcholinesterase {Fruit fly (Drosophila melano | 93.86 | |
| d2dlqa1 | 26 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 93.82 | |
| d1x5wa1 | 28 | Zinc finger protein 64, ZFP68 {Human (Homo sapiens | 93.71 | |
| d2dlqa2 | 28 | GLI-Krueppel family member HKR3 {Mouse (Mus muscul | 93.65 | |
| d2h7ca1 | 532 | Mammalian carboxylesterase (liver carboxylesterase | 93.63 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 93.31 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 92.89 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 92.59 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 92.41 | |
| d2bcea_ | 579 | Bile-salt activated lipase (cholesterol esterase) | 92.37 | |
| d2eppa1 | 53 | PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | 91.57 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 91.46 | |
| d1bhia_ | 38 | Transactivation domain of cre-bp1/atf-2 {Human (Ho | 91.26 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 91.19 | |
| d1x6ha1 | 37 | Transcriptional repressor CTCF {Human (Homo sapien | 91.13 | |
| d2glia2 | 33 | Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 | 90.39 | |
| d2drpa2 | 26 | Tramtrack protein (two zinc-finger peptide) {Droso | 90.01 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 89.19 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 88.54 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 86.7 | |
| d2d81a1 | 318 | Polyhydroxybutyrate depolymerase {Penicillium funi | 86.44 | |
| d2ct1a1 | 28 | Transcriptional repressor CTCF {Human (Homo sapien | 86.08 | |
| d1y0jb1 | 36 | U-shaped transcription factor, different fingers { | 85.33 | |
| d1ku0a_ | 388 | Lipase L1 {Bacillus stearothermophilus [TaxId: 142 | 85.06 | |
| d2j7ja1 | 28 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 84.57 | |
| d1vd4a_ | 62 | Transcription initiation factor TFIIE-alpha {Human | 82.3 | |
| d1tf3a1 | 31 | Transcription factor IIIA, TFIIIA {Xenopus laevis | 81.59 |
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: beta-beta-alpha zinc fingers superfamily: beta-beta-alpha zinc fingers family: Classic zinc finger, C2H2 domain: Zinc finger protein 297b species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.39 E-value=6.9e-14 Score=105.82 Aligned_cols=51 Identities=43% Similarity=0.883 Sum_probs=36.6
Q ss_pred cccccCcCCcccCCchhhhhHhhhhcCC-cccCCccccccCCchhHHHHhhhc
Q psy3685 557 IRYKCDLCSKEFSRKDNLTEHKEIHQGI-RYKCDLCSKKFSRKLNLTKHMKIH 608 (1042)
Q Consensus 557 ~~~~C~~C~k~F~~~~~L~~H~~~H~~~-~~~C~~C~k~F~~~~~L~~H~~~H 608 (1042)
+||+|+ ||++|..+..|..|+++|+|+ ||.|++||++|.+.+.|..||++|
T Consensus 2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H 53 (53)
T d2csha1 2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53 (53)
T ss_dssp CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence 367774 777777777777777777776 677777777777777777777765
|
| >d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} | Back information, alignment and structure |
|---|
| >d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} | Back information, alignment and structure |
|---|
| >d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ivya_ c.69.1.5 (A:) Human 'protective protein', HPP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1wpxa1 c.69.1.5 (A:1-421) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1lnsa3 c.69.1.21 (A:146-550) X-Prolyl dipeptidyl aminopeptidase PepX, middle domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ac5a_ c.69.1.5 (A:) Serine carboxypeptidase II {Baker's yeast (Saccharomyces cerevisiae), kex1(delta)p [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} | Back information, alignment and structure |
|---|
| >d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} | Back information, alignment and structure |
|---|
| >d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} | Back information, alignment and structure |
|---|
| >d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d2d81a1 c.69.1.37 (A:21-338) Polyhydroxybutyrate depolymerase {Penicillium funiculosum [TaxId: 28572]} | Back information, alignment and structure |
|---|
| >d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|
| >d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} | Back information, alignment and structure |
|---|