Psyllid ID: psy368

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MALPAFTQPPHSVPSLADELGDLSPWSQETDSTIDSDTERYYPSIDSGLSLVSHHNLHDSTISSRSASPVTLPPSKLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSRLPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIEEDF
ccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcEEEEEccccccHHHHHHHHHHHHHccccccEEEEEEEcccEEEEEcccccccccccEEEEEEccccEEEEEEccccccEEEEEEccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccccEEEcccc
cccccccccccccHHHHHHHHHccccccccccccccHHHcccccccccccEEEEcccccccccccccccccccccccHHHccccHEEEEEcccccccEEEEccccEEEEEcccccHHEcHHccccccccccccccccccccccEccccccccccccEEEEEcccccccHHHcccccEEEEEEEEccEEcccccccHHHHHHHHHHHHHcccccEEEEEEEEccEEEEEEcccccccccccEEEEEEcEEEEEEcccccccEEEEEEEEccccccEEEEEEEccHcHHHHHHHHHHHHHHHHHHHHHHccccccEEEHccc
malpaftqpphsvpsladelgdlspwsqetdstidsdteryypsidsglslvshhnlhdstissrsaspvtlppsklELLEATHRSLHKfiprhfdeveleigdpiyvsneaedlwcegkakestyvpvvkassrlptpwmLRVNLrtgrqgifpsayavdveyedlqtttpkpkreRFLLGYLgsvetsahkgNAVICQAVHKirqtqhrphscilevsdeglrmveksrpgqhrkvrgldyfyslknvmfcgfhprepcylgfiskhpnmqrFACHVflasestrPVAEAVGRAFQRFYEKFIEtafpiediyieedf
malpaftqpphsvpSLADELGDLSPWSQETDSTIDSDTERYYPSIDSGLSLVSHHNLHDstissrsaspvtLPPSKLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEgkakestyvpvvkassrlptpwMLRVNLRTGRQGIFPSAYAVDVEYEDLqtttpkpkreRFLLGYLGSVETSAHKGNAVICQAVHkirqtqhrphsCILEVSDEGLRMveksrpgqhrkvrGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIEEDF
MALPAFTQPPHSVPSLADELGDLSPWSQETDSTIDSDTERYYPSIDSGLSLVSHHNLHDSTISSRSASPVTLPPSKLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSRLPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIEEDF
*******************************************************************************LEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSRLPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTT***KRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVS****************KVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYI****
*************************************************************************************************VELEIGD**************************************************PSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHK**********CILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIEED*
***********SVPSLADELGDLSPWSQETDSTIDSDTERYYPSIDSGLSLVSHHNLHD***********TLPPSKLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSRLPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIEEDF
*****************DELGDLS***************RYYPSIDSGLSLV*H***************V***PSKL**LEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAK***************TPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIEED*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALPAFTQPPHSVPSLADELGDLSPWSQETDSTIDSDTERYYPSIDSGLSLVSHHNLHDSTISSRSASPVTLPPSKLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSRLPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIEEDF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query320 2.2.26 [Sep-21-2011]
Q9W0K0490 JNK-interacting protein 1 yes N/A 0.831 0.542 0.561 1e-87
Q9R237708 C-Jun-amino-terminal kina yes N/A 0.665 0.300 0.406 2e-50
Q9UQF2711 C-Jun-amino-terminal kina yes N/A 0.675 0.303 0.405 2e-50
Q9WVI9707 C-Jun-amino-terminal kina yes N/A 0.665 0.301 0.402 2e-49
Q13387824 C-Jun-amino-terminal kina no N/A 0.656 0.254 0.422 6e-48
Q9ERE9830 C-Jun-amino-terminal kina no N/A 0.656 0.253 0.418 3e-47
Q9XTY6 593 Numb-related protein 1 OS no N/A 0.371 0.200 0.309 2e-08
P16554 556 Protein numb OS=Drosophil no N/A 0.368 0.212 0.309 5e-08
Q9UBP9 304 PTB domain-containing eng no N/A 0.368 0.388 0.261 3e-05
O08919 604 Numb-like protein OS=Mus no N/A 0.368 0.195 0.293 3e-05
>sp|Q9W0K0|JIP1_DROME JNK-interacting protein 1 OS=Drosophila melanogaster GN=Aplip1 PE=1 SV=2 Back     alignment and function desciption
 Score =  323 bits (827), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 173/308 (56%), Positives = 213/308 (69%), Gaps = 42/308 (13%)

Query: 26  WSQETDSTIDSDTERYYPSIDSGLSLVSHHNLHD-STISSRSASPVT----------LPP 74
           +  + DS+ DS+  +    +DSG S    H+ +D  ++S +  SPV+          +P 
Sbjct: 209 YLMDEDSSPDSERMQSLGDVDSGHSTA--HSPNDFKSMSPQITSPVSQSPFPPPFGGVPF 266

Query: 75  SKLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASS 134
            +LE+LEATHR LHKF+PRH DE+ELEIGD IYV  EAEDLWCEG               
Sbjct: 267 GQLEMLEATHRGLHKFVPRHHDEIELEIGDAIYVQKEAEDLWCEG--------------- 311

Query: 135 RLPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKG 194
                    VNLRTGRQGIFPSAYAVD++Y +   T    K+ER+LLGYLGSVET AHKG
Sbjct: 312 ---------VNLRTGRQGIFPSAYAVDLDYNEFDPTVQLVKKERYLLGYLGSVETLAHKG 362

Query: 195 NAVICQAVHKI-RQTQHRP--HSCILEVSDEGLRMVEKSRPGQHRKVRG--LDYFYSLKN 249
             V+CQAV KI  +  + P   +CILEVSD+GLRMV++S P Q++K +   +DYFYSLKN
Sbjct: 363 TGVVCQAVRKIVGEYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCIDYFYSLKN 422

Query: 250 VMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAF 309
           V FC FHPR+  ++GFI+KHP +QRFACHVF  SESTRPVAEAVGRAFQRFY+KFIETA+
Sbjct: 423 VSFCAFHPRDHRFIGFITKHPTVQRFACHVFKGSESTRPVAEAVGRAFQRFYQKFIETAY 482

Query: 310 PIEDIYIE 317
           PIEDIYIE
Sbjct: 483 PIEDIYIE 490
The JNK-interacting protein (JIP) group of scaffold proteins selectively mediates JNK signaling by aggregating specific components of the MAPK cascade to form a functional JNK signaling module. May function as a regulator of vesicle transport, through interations with the JNK-signaling components and motor proteins.
Drosophila melanogaster (taxid: 7227)
>sp|Q9R237|JIP1_RAT C-Jun-amino-terminal kinase-interacting protein 1 OS=Rattus norvegicus GN=Mapk8ip1 PE=1 SV=2 Back     alignment and function description
>sp|Q9UQF2|JIP1_HUMAN C-Jun-amino-terminal kinase-interacting protein 1 OS=Homo sapiens GN=MAPK8IP1 PE=1 SV=1 Back     alignment and function description
>sp|Q9WVI9|JIP1_MOUSE C-Jun-amino-terminal kinase-interacting protein 1 OS=Mus musculus GN=Mapk8ip1 PE=1 SV=2 Back     alignment and function description
>sp|Q13387|JIP2_HUMAN C-Jun-amino-terminal kinase-interacting protein 2 OS=Homo sapiens GN=MAPK8IP2 PE=1 SV=2 Back     alignment and function description
>sp|Q9ERE9|JIP2_MOUSE C-Jun-amino-terminal kinase-interacting protein 2 OS=Mus musculus GN=Mapk8ip2 PE=1 SV=1 Back     alignment and function description
>sp|Q9XTY6|NUMB1_CAEEL Numb-related protein 1 OS=Caenorhabditis elegans GN=num-1 PE=1 SV=1 Back     alignment and function description
>sp|P16554|NUMB_DROME Protein numb OS=Drosophila melanogaster GN=numb PE=1 SV=2 Back     alignment and function description
>sp|Q9UBP9|GULP1_HUMAN PTB domain-containing engulfment adapter protein 1 OS=Homo sapiens GN=GULP1 PE=1 SV=1 Back     alignment and function description
>sp|O08919|NUMBL_MOUSE Numb-like protein OS=Mus musculus GN=Numbl PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
157167335 496 jnk interacting protein (jip) [Aedes aeg 0.818 0.528 0.577 7e-89
307180842 512 JNK-interacting protein 1 [Camponotus fl 0.737 0.460 0.630 5e-88
328788981 511 PREDICTED: JNK-interacting protein 1 [Ap 0.725 0.454 0.636 7e-88
380018127 511 PREDICTED: JNK-interacting protein 1-lik 0.725 0.454 0.636 8e-88
340716367 511 PREDICTED: JNK-interacting protein 1-lik 0.725 0.454 0.636 9e-88
383853032 511 PREDICTED: JNK-interacting protein 1-lik 0.725 0.454 0.632 1e-87
357607542 430 jnk interacting protein [Danaus plexippu 0.862 0.641 0.527 1e-87
350406271 511 PREDICTED: JNK-interacting protein 1-lik 0.725 0.454 0.636 1e-87
322797075 496 hypothetical protein SINV_12139 [Solenop 0.737 0.475 0.627 2e-87
158295176 555 AGAP006021-PA [Anopheles gambiae str. PE 0.684 0.394 0.637 4e-87
>gi|157167335|ref|XP_001660261.1| jnk interacting protein (jip) [Aedes aegypti] gi|108882906|gb|EAT47131.1| AAEL001744-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  333 bits (853), Expect = 7e-89,   Method: Compositional matrix adjust.
 Identities = 176/305 (57%), Positives = 213/305 (69%), Gaps = 43/305 (14%)

Query: 29  ETDSTIDSDTERYYPSIDSGLSLVSHHNLHD----STISSRSASPVT---------LPPS 75
           + DS+ DS+  +    +DSG S  + H+ +D    S  + ++ASPVT         +P S
Sbjct: 219 DEDSSPDSERLQSLGDVDSGHS--TAHSPNDFKSMSPQAPQAASPVTSPFPPPYGGVPFS 276

Query: 76  KLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSR 135
           +LE+LEATHR LHKFIPRH DE+E+EIGDPIYV  EAEDLWCEG                
Sbjct: 277 QLEMLEATHRGLHKFIPRHHDEIEIEIGDPIYVQKEAEDLWCEG---------------- 320

Query: 136 LPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGN 195
                   VNLRTGRQGIFPSAYAVD++Y D   +T + KRER+LLGYLGSVET AHKG 
Sbjct: 321 --------VNLRTGRQGIFPSAYAVDLDYNDFDPSTVEMKRERYLLGYLGSVETLAHKGT 372

Query: 196 AVICQAVHKI---RQTQHRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMF 252
            V+CQAV KI        +  +CILE+SD+GLRMV++SR  +  K   +DYFYSLKNV F
Sbjct: 373 GVVCQAVRKIVGDGSESPKAQACILEISDQGLRMVDRSR-NKRDKRPCIDYFYSLKNVSF 431

Query: 253 CGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIE 312
           C FHPR+  Y+GFI+KHP +QRFACHVF  +ESTRPVAEAVGRAFQRFY+KFIETA+PIE
Sbjct: 432 CAFHPRDHRYIGFITKHPTVQRFACHVFQGTESTRPVAEAVGRAFQRFYQKFIETAYPIE 491

Query: 313 DIYIE 317
           DIYIE
Sbjct: 492 DIYIE 496

Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307180842|gb|EFN68681.1| JNK-interacting protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328788981|ref|XP_392444.3| PREDICTED: JNK-interacting protein 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380018127|ref|XP_003692987.1| PREDICTED: JNK-interacting protein 1-like [Apis florea] Back     alignment and taxonomy information
>gi|340716367|ref|XP_003396670.1| PREDICTED: JNK-interacting protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383853032|ref|XP_003702028.1| PREDICTED: JNK-interacting protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|357607542|gb|EHJ65580.1| jnk interacting protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|350406271|ref|XP_003487715.1| PREDICTED: JNK-interacting protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|322797075|gb|EFZ19364.1| hypothetical protein SINV_12139 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|158295176|ref|XP_316058.4| AGAP006021-PA [Anopheles gambiae str. PEST] gi|157015909|gb|EAA11484.4| AGAP006021-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
FB|FBgn0040281490 Aplip1 "APP-like protein inter 0.853 0.557 0.501 2.6e-63
UNIPROTKB|F1SHK0701 MAPK8IP1 "Uncharacterized prot 0.665 0.303 0.439 1.6e-49
UNIPROTKB|E2RQE0824 MAPK8IP2 "Uncharacterized prot 0.543 0.211 0.449 5.2e-49
UNIPROTKB|Q9UQF2711 MAPK8IP1 "C-Jun-amino-terminal 0.665 0.299 0.422 1.7e-48
UNIPROTKB|G3X783821 MAPK8IP2 "Uncharacterized prot 0.543 0.211 0.449 1.8e-48
RGD|70937708 Mapk8ip1 "mitogen-activated pr 0.665 0.300 0.422 1.9e-48
UNIPROTKB|A8MTJ1558 MAPK8IP2 "C-Jun-amino-terminal 0.546 0.313 0.454 2.3e-48
UNIPROTKB|J3KNN6823 MAPK8IP2 "C-Jun-amino-terminal 0.546 0.212 0.454 2.4e-48
UNIPROTKB|Q13387824 MAPK8IP2 "C-Jun-amino-terminal 0.546 0.212 0.454 2.4e-48
UNIPROTKB|F1P3Q5704 MAPK8IP1 "Uncharacterized prot 0.665 0.302 0.437 3.7e-48
FB|FBgn0040281 Aplip1 "APP-like protein interacting protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 646 (232.5 bits), Expect = 2.6e-63, P = 2.6e-63
 Identities = 148/295 (50%), Positives = 190/295 (64%)

Query:    29 ETDSTIDSDTERYYPSIDSGLSLVSHHNLHD-STISSRSASPVTLPPSKLELLEATHRSL 87
             + DS+ DS+  +    +DSG S    H+ +D  ++S +  SPV+  P            L
Sbjct:   212 DEDSSPDSERMQSLGDVDSGHSTA--HSPNDFKSMSPQITSPVSQSPFPPPFGGVPFGQL 269

Query:    88 HKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSRLPTPWMLRVNLR 147
                   H        G   +V    +++  E +  ++ YV   K +  L   W   VNLR
Sbjct:   270 EMLEATHR-------GLHKFVPRHHDEI--ELEIGDAIYVQ--KEAEDL---WCEGVNLR 315

Query:   148 TGRQGIFPSAYAVDVEYEDLQTTTPKPKRERFLLGYLGSVETSAHKGNAVICQAVHKI-R 206
             TGRQGIFPSAYAVD++Y +   T    K+ER+LLGYLGSVET AHKG  V+CQAV KI  
Sbjct:   316 TGRQGIFPSAYAVDLDYNEFDPTVQLVKKERYLLGYLGSVETLAHKGTGVVCQAVRKIVG 375

Query:   207 QTQHRP--HSCILEVSDEGLRMVEKSRPGQHRKVRG--LDYFYSLKNVMFCGFHPREPCY 262
             +  + P   +CILEVSD+GLRMV++S P Q++K +   +DYFYSLKNV FC FHPR+  +
Sbjct:   376 EYGNSPTGQTCILEVSDQGLRMVDRSGPNQNKKDKKPCIDYFYSLKNVSFCAFHPRDHRF 435

Query:   263 LGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETAFPIEDIYIE 317
             +GFI+KHP +QRFACHVF  SESTRPVAEAVGRAFQRFY+KFIETA+PIEDIYIE
Sbjct:   436 IGFITKHPTVQRFACHVFKGSESTRPVAEAVGRAFQRFYQKFIETAYPIEDIYIE 490
GO:0005515 "protein binding" evidence=IPI
GO:0019894 "kinesin binding" evidence=NAS;IPI
GO:0008432 "JUN kinase binding" evidence=ISA;IPI
GO:0007254 "JNK cascade" evidence=ISA
GO:0046328 "regulation of JNK cascade" evidence=NAS;IPI
GO:0019901 "protein kinase binding" evidence=NAS;IPI
GO:0005737 "cytoplasm" evidence=NAS
GO:0048491 "retrograde synaptic vesicle transport" evidence=IMP
GO:0048490 "anterograde synaptic vesicle transport" evidence=IMP
GO:0019896 "axon transport of mitochondrion" evidence=IMP
GO:0048812 "neuron projection morphogenesis" evidence=IMP
UNIPROTKB|F1SHK0 MAPK8IP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RQE0 MAPK8IP2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UQF2 MAPK8IP1 "C-Jun-amino-terminal kinase-interacting protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3X783 MAPK8IP2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|70937 Mapk8ip1 "mitogen-activated protein kinase 8 interacting protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A8MTJ1 MAPK8IP2 "C-Jun-amino-terminal kinase-interacting protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KNN6 MAPK8IP2 "C-Jun-amino-terminal kinase-interacting protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13387 MAPK8IP2 "C-Jun-amino-terminal kinase-interacting protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P3Q5 MAPK8IP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9W0K0JIP1_DROMENo assigned EC number0.56160.83120.5428yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
cd01212149 cd01212, PTB_JIP, JNK-interacting protein-like (JI 9e-82
cd1180155 cd11801, SH3_JIP1_like, Src homology 3 domain of J 6e-26
smart00462134 smart00462, PTB, Phosphotyrosine-binding domain, p 3e-24
cd13161120 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM- 1e-17
pfam00640133 pfam00640, PID, Phosphotyrosine interaction domain 3e-17
cd00934119 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-lik 2e-14
cd01268135 cd01268, PTB_Numb, Numb Phosphotyrosine-binding (P 2e-13
cd1194255 cd11942, SH3_JIP2, Src homology 3 domain of JNK-in 2e-12
cd1194355 cd11943, SH3_JIP1, Src homology 3 domain of JNK-in 3e-12
cd01273144 cd01273, PTB_CED-6, Cell death protein 6 homolog ( 9e-12
cd1179159 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiq 2e-05
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 4e-05
smart0032656 smart00326, SH3, Src homology 3 domains 5e-05
cd1179355 cd11793, SH3_ephexin1_like, Src homology 3 domain 2e-04
cd1178055 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho 4e-04
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 5e-04
cd1178455 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain 7e-04
cd1205553 cd12055, SH3_CIN85_2, Second Src Homology 3 domain 0.001
pfam0001847 pfam00018, SH3_1, SH3 domain 0.002
cd1205455 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain 0.004
cd1177672 cd11776, SH3_PI3K_p85, Src Homology 3 domain of th 0.004
>gnl|CDD|241248 cd01212, PTB_JIP, JNK-interacting protein-like (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information 
 Score =  244 bits (624), Expect = 9e-82
 Identities = 88/149 (59%), Positives = 109/149 (73%), Gaps = 6/149 (4%)

Query: 175 KRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHR------PHSCILEVSDEGLRMVE 228
            RERFLL +LGSVE   HKGN V+CQA+ KI   +        P SCILE+SD GL+MV+
Sbjct: 1   WRERFLLKFLGSVEVPYHKGNDVLCQAMQKIATARRLTVHLRPPASCILEISDRGLKMVD 60

Query: 229 KSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRP 288
           +S+P +        +F SLKN+ FCGFHPR   Y GFI+KHP +QRFACHVF++ ESTRP
Sbjct: 61  QSKPNKKEGKPCSHFFQSLKNISFCGFHPRNSRYFGFITKHPLLQRFACHVFVSQESTRP 120

Query: 289 VAEAVGRAFQRFYEKFIETAFPIEDIYIE 317
           VAE+VGRAFQRFY++F+E A P EDIY+E
Sbjct: 121 VAESVGRAFQRFYQEFLEYACPTEDIYLE 149

JIP is a mitogen-activated protein kinase scaffold protein. JIP consists of a C-terminal SH3 domain, followed by a PTB domain. PTB domains have a common PH-like fold and are found in various eukaryotic signaling molecules. This domain was initially shown to binds peptides with a NPXY motif with differing requirements for phosphorylation of the tyrosine, although more recent studies have found that some types of PTB domains can bind to peptides lack tyrosine residues altogether. In contrast to SH2 domains, which recognize phosphotyrosine and adjacent carboxy-terminal residues, PTB-domain binding specificity is conferred by residues amino-terminal to the phosphotyrosine. PTB domains are classified into three groups: phosphotyrosine-dependent Shc-like, phosphotyrosine-dependent IRS-like, and phosphotyrosine-independent Dab-like PTB domains. This cd is part of the Dab-like subgroup. Length = 149
>gnl|CDD|212735 cd11801, SH3_JIP1_like, Src homology 3 domain of JNK-interacting proteins 1 and 2, and similar domains Back     alignment and domain information
>gnl|CDD|214675 smart00462, PTB, Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>gnl|CDD|241315 cd13161, PTB_TK_HMTK, Tyrosine-specific kinase/HM-motif TK (TM/HMTK) Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|144292 pfam00640, PID, Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>gnl|CDD|241236 cd00934, PTB, Phosphotyrosine-binding (PTB) PH-like fold Back     alignment and domain information
>gnl|CDD|241298 cd01268, PTB_Numb, Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|212875 cd11942, SH3_JIP2, Src homology 3 domain of JNK-interacting protein 2 Back     alignment and domain information
>gnl|CDD|212876 cd11943, SH3_JIP1, Src homology 3 domain of JNK-interacting protein 1 Back     alignment and domain information
>gnl|CDD|241303 cd01273, PTB_CED-6, Cell death protein 6 homolog (CED-6/GULP1) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>gnl|CDD|212725 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing proteins, also called TULA (T cell Ubiquitin LigAnd) family of proteins Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212710 cd11776, SH3_PI3K_p85, Src Homology 3 domain of the p85 regulatory subunit of Class IA Phosphatidylinositol 3-kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 320
KOG3775|consensus482 100.0
cd01212148 JIP JNK-interacting protein (JIP) Phosphotyrosine- 100.0
cd01273142 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain. 100.0
cd01268138 Numb Numb Phosphotyrosine-binding (PTB) domain. Nu 100.0
cd01267132 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, 100.0
cd01274127 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) doma 100.0
cd01216123 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, ph 100.0
cd01270140 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phos 99.98
cd01271124 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PT 99.97
smart00462134 PTB Phosphotyrosine-binding domain, phosphotyrosin 99.97
PF00640140 PID: Phosphotyrosine interaction domain (PTB/PID) 99.97
cd01215139 Dab Disabled (Dab) Phosphotyrosine-binding domain. 99.97
cd00934123 PTB Phosphotyrosine-binding (PTB) domain. Phosphot 99.96
cd01208156 X11 X11 Phosphotyrosine-binding (PTB) domain. X11 99.95
cd01214133 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain 99.94
cd01209160 SHC SHC phosphotyrosine-binding (PTB) domain. SHC 99.94
KOG3537|consensus 543 99.94
cd01213138 tensin Tensin Phosphotyrosine-binding (PTB) domain 99.89
PF14719182 PID_2: Phosphotyrosine interaction domain (PTB/PID 99.89
KOG3536|consensus 321 99.87
cd01269129 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) dom 99.76
cd01211125 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) doma 99.74
KOG3605|consensus 829 99.72
KOG1930|consensus483 99.64
KOG3535|consensus 557 99.63
cd01272138 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain. 99.61
PF08416131 PTB: Phosphotyrosine-binding domain; InterPro: IPR 99.6
KOG3697|consensus 345 99.34
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.32
KOG4225|consensus489 99.25
KOG4225|consensus489 99.15
KOG1118|consensus366 99.13
KOG4348|consensus 627 99.08
cd01217158 CG12581 CG12581 Phosphotyrosine-binding (PTB) doma 99.04
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.02
KOG4226|consensus379 98.98
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 98.93
KOG2070|consensus 661 98.93
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.88
PF10480200 ICAP-1_inte_bdg: Beta-1 integrin binding protein; 98.84
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.8
KOG4448|consensus 374 98.75
KOG2199|consensus462 98.67
KOG0162|consensus1106 98.65
KOG1029|consensus1118 98.64
KOG2856|consensus472 98.62
KOG4348|consensus 627 98.49
KOG3523|consensus695 98.47
KOG2996|consensus865 98.34
KOG1702|consensus264 98.34
KOG1029|consensus 1118 98.28
KOG2546|consensus483 97.97
cd01210127 EPS8 Epidermal growth factor receptor kinase subst 97.84
KOG3601|consensus222 97.69
KOG1264|consensus 1267 97.68
KOG3875|consensus362 97.41
KOG4792|consensus293 97.31
KOG3655|consensus484 97.24
KOG4278|consensus 1157 97.18
KOG1843|consensus473 97.08
KOG0507|consensus 854 96.99
KOG4792|consensus293 96.91
KOG4226|consensus379 96.89
KOG4429|consensus421 96.82
KOG4575|consensus 874 96.03
KOG2528|consensus 490 96.02
KOG0197|consensus 468 95.98
KOG3632|consensus 1335 95.81
KOG0515|consensus752 95.67
cd0090099 PH-like Pleckstrin homology-like domain. Pleckstri 95.63
KOG3705|consensus580 95.6
KOG1451|consensus812 95.56
KOG3632|consensus1335 95.35
KOG4773|consensus386 95.34
KOG3557|consensus 721 95.13
KOG2222|consensus848 93.99
KOG2996|consensus865 93.81
KOG3771|consensus460 93.78
KOG4458|consensus78 93.52
KOG0199|consensus 1039 92.9
KOG3725|consensus375 92.37
KOG3557|consensus721 91.83
KOG0507|consensus854 90.96
KOG3565|consensus640 90.7
KOG0609|consensus542 90.01
KOG3601|consensus222 86.08
PF02174100 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 83.26
>KOG3775|consensus Back     alignment and domain information 
Probab=100.00  E-value=5.3e-62  Score=469.16  Aligned_cols=281  Identities=44%  Similarity=0.687  Sum_probs=247.2

Q ss_pred             CCCCCCCCchhHHhcccC-------------------CCCccCCCCCCCCcccc--cCCCCCCcccccccCCCC------
Q psy368            7 TQPPHSVPSLADELGDLS-------------------PWSQETDSTIDSDTERY--YPSIDSGLSLVSHHNLHD------   59 (320)
Q Consensus         7 ~~~~~~~~~~~~~~~~~~-------------------~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~~~~~~------   59 (320)
                      .--+.+|..++||..++.                   ++++ ||++  +++++.  +-++|+++.+.  |++.+      
T Consensus       161 ~yd~vkytlvvDEh~qlelvslrpc~g~g~d~s~d~cg~~s-E~e~--~~~~~~~~~~s~ds~~~~~--~s~~~kk~l~~  235 (482)
T KOG3775|consen  161 VYDAVKYTLVVDEHTQLELVSLRPCAGLGHDSSEDSCGEAS-EEEA--GAALLGGGQVSGDSSPDSP--DSTFSKKFLNV  235 (482)
T ss_pred             cccccceeeeeehhhcccccccccccccCcccccccccccc-cccc--cccccCCcccccccCCCCc--cchhhhhhccc
Confidence            334567889999988876                   2334 6666  889988  47888888888  66555      


Q ss_pred             ---CCCccCCCCC--CCCCCccccccccceEEeccCCCCCCCcccccCCCeEEEeeccCCceeccccccccccccccccc
Q psy368           60 ---STISSRSASP--VTLPPSKLELLEATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASS  134 (320)
Q Consensus        60 ---~~~~~~~~~~--~~~p~~~~~~~~~~~r~~~~f~p~~~~el~l~~gd~i~v~~~~~~~w~~G~~~~~~~~~~~~~~s  134 (320)
                         |++++.++.+  +.++...+|..++|||++|+|+|||+|||+|+|||.|+|..+.+|.|++|               
T Consensus       236 ~~~s~~~~s~a~~~~g~s~~~~~e~qe~THR~~~rFvPRHpDELeLEIgDav~Ve~eadD~W~~G---------------  300 (482)
T KOG3775|consen  236 FVNSTSRSSSAESFGGFSCLVNGEEQEQTHRAVFRFVPRHPDELELEIGDAVLVEAEADDFWFEG---------------  300 (482)
T ss_pred             ceecccccccCCCCCccccccchhhhchhhhhhhhccCCCcceeeeecCCeeEeeecccchhhcc---------------
Confidence               4555444333  44899999999999999999999999999999999999999999999999               


Q ss_pred             CCCCcccceecccCCcccccccCCcccccccccccCCCC---CCceeEEEEecCceEecCCCchHHHHHHHHHHHhcC--
Q psy368          135 RLPTPWMLRVNLRTGRQGIFPSAYAVDVEYEDLQTTTPK---PKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQTQ--  209 (320)
Q Consensus       135 r~~~~~~~~~nlrtg~~GifP~~yv~~~~~~~~~~~~~~---~~~~~F~VKYLGSVeV~~~kG~~Vv~eAV~kI~~~~--  209 (320)
                               +|||||++||||+.|+.+|+.++++...++   ....+|.++|||||||..+||++|+++||+||..+.  
T Consensus       301 ---------~NlRTG~~GIFPA~ya~evd~~eed~lg~l~~~~~~erf~l~~LgSVEv~~HKGngVlcqAm~KI~t~ykn  371 (482)
T KOG3775|consen  301 ---------FNLRTGERGIFPAFYAHEVDGPEEDLLGSLRSPCWVERFDLQFLGSVEVPCHKGNGVLCQAMQKIATAYKN  371 (482)
T ss_pred             ---------ccccccccccccceeEEecCCchhhhhhccCCccchhheeeeeeeeeEeecccCccHHHHHHHHHHHHhcC
Confidence                     999999999999999999999888776543   567999999999999999999999999999999984  


Q ss_pred             ----CCCcEEEEEEeCCceEEEeCCCCCccceeeeeccccccceeEEEEecCCCCceeEEEeeCCCCceeeEEEEecCCC
Q psy368          210 ----HRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASES  285 (320)
Q Consensus       210 ----~kp~~V~L~VS~~GIrVvD~~tk~~~~~~~~~~~f~pL~~ISFca~Dp~d~r~FaFIak~~~~~rf~CHVF~c~~s  285 (320)
                          ..|+.|.|+||.+||++.+...+. +.+..+..|||.++|||||++||+|.++|+||+|++...+|+||||++.++
T Consensus       372 s~~~~~p~s~~lEislRgV~~s~k~~~~-~~k~~~c~~f~~lknisfc~~hpr~n~~~gfitkhp~~~rfachVfks~es  450 (482)
T KOG3775|consen  372 SVHLRPPASCVLEISLRGVKLSLKGGGP-EFKFQRCSHFFQLKNISFCGCHPRNNCYFGFITKHPLLSRFACHVFKSQES  450 (482)
T ss_pred             CccccCcchhhhhhhcceeEeecCCCCc-cccccccceeeEecccceeccccccceEEEeeccchhhhheeeeeeecccC
Confidence                357999999999999999887663 233455579999999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHHhhcCCCcccccc
Q psy368          286 TRPVAEAVGRAFQRFYEKFIETAFPIEDIYIE  317 (320)
Q Consensus       286 A~~Ia~AIG~AFqvayq~~l~~a~p~edi~~e  317 (320)
                      .++||++||+||+.+||+||+++||+||||||
T Consensus       451 ~rpvA~sVgRaF~~~yq~fl~~a~p~edIyLe  482 (482)
T KOG3775|consen  451 TRPVAESVGRAFQEFYQEFLEYACPTEDIYLE  482 (482)
T ss_pred             ChHHHHHHHHHHHHHHHHHHHhcCCccceeeC
Confidence            99999999999999999999999999999997

>cd01212 JIP JNK-interacting protein (JIP) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01273 CED-6 CED-6 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01268 Numb Numb Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01267 CED6_AIDA1b Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01274 AIDA-1b AIDA-1b Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01216 Fe65 Fe65 Phosphotyrosine-binding (PTB) domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>cd01270 DYC-1 DYC-1 (DYB-1 binding and Capon related) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01271 Fe65_C Fe65 C-terminal Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>smart00462 PTB Phosphotyrosine-binding domain, phosphotyrosine-interaction (PI) domain Back     alignment and domain information
>PF00640 PID: Phosphotyrosine interaction domain (PTB/PID) A page on PI domains Back     alignment and domain information
>cd01215 Dab Disabled (Dab) Phosphotyrosine-binding domain Back     alignment and domain information
>cd00934 PTB Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01208 X11 X11 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01214 CG8312 CG8312 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01209 SHC SHC phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3537|consensus Back     alignment and domain information
>cd01213 tensin Tensin Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF14719 PID_2: Phosphotyrosine interaction domain (PTB/PID) Back     alignment and domain information
>KOG3536|consensus Back     alignment and domain information
>cd01269 PLX Pollux (PLX) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>cd01211 GAPCenA GAPCenA Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG1930|consensus Back     alignment and domain information
>KOG3535|consensus Back     alignment and domain information
>cd01272 FE65_N Fe65 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF08416 PTB: Phosphotyrosine-binding domain; InterPro: IPR013625 The phosphotyrosine-binding domain (PTB, also phosphotyrosine-interaction or PI domain) of tensin tends to be found at the C terminus of a protein Back     alignment and domain information
>KOG3697|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>cd01217 CG12581 CG12581 Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>PF10480 ICAP-1_inte_bdg: Beta-1 integrin binding protein; InterPro: IPR019517 ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG4448|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>cd01210 EPS8 Epidermal growth factor receptor kinase substrate (EPS8) Phosphotyrosine-binding (PTB) domain Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>cd00900 PH-like Pleckstrin homology-like domain Back     alignment and domain information
>KOG3705|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG4458|consensus Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>PF02174 IRS: PTB domain (IRS-1 type); InterPro: IPR002404 Insulin receptor substrate-1 proteins contain both a pleckstrin homology domain IPR001849 from INTERPRO and a phosphotyrosine binding (PTB) domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
2fpf_A71 Crystal Structure Of The Ib1 Sh3 Dimer At Low Resol 2e-10
2fpd_A62 Sad Structure Determination: Crystal Structure Of T 5e-10
2nmb_A160 Dnumb Ptb Domain Complexed With A Phosphotyrosine P 1e-08
1ddm_A135 Solution Structure Of The Numb Ptb Domain Complexed 3e-08
1wj1_A156 Solution Structure Of Phosphotyrosine Interaction D 2e-06
3f0w_A168 Human Numb-Like Protein, Phosphotyrosine Interactio 2e-06
>pdb|2FPF|A Chain A, Crystal Structure Of The Ib1 Sh3 Dimer At Low Resolution Length = 71 Back     alignment and structure 
Iteration: 1

 Score = 63.2 bits (152), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 31/82 (37%), Positives = 45/82 (54%), Gaps = 24/82 (29%)
Query: 81  EATHRSLHKFIPRHFDEVELEIGDPIYVSNEAEDLWCEGKAKESTYVPVVKASSRLPTPW 140
           E THR++ +F+PRH DE+ELE+ DP+ V  +AED W E                      
Sbjct: 6   EQTHRAIFRFVPRHEDELELEVDDPLLVELQAEDYWYEA--------------------- 44
Query: 141 MLRVNLRTGRQGIFPSAYAVDV 162
               N+RTG +G+FP+ YA++V
Sbjct: 45  ---YNMRTGARGVFPAYYAIEV 63
>pdb|2FPD|A Chain A, Sad Structure Determination: Crystal Structure Of The Intrinsic Dimerization Sh3 Domain Of The Ib1 Scaffold Protein Length = 62 Back     alignment and structure
>pdb|2NMB|A Chain A, Dnumb Ptb Domain Complexed With A Phosphotyrosine Peptide, Nmr, Ensemble Of Structures Length = 160 Back     alignment and structure
>pdb|1DDM|A Chain A, Solution Structure Of The Numb Ptb Domain Complexed To A Nak Peptide Length = 135 Back     alignment and structure
>pdb|1WJ1|A Chain A, Solution Structure Of Phosphotyrosine Interaction Domain Of Mouse Numb Protein Length = 156 Back     alignment and structure
>pdb|3F0W|A Chain A, Human Numb-Like Protein, Phosphotyrosine Interaction Domain Length = 168 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
3f0w_A168 NUMB-R, NUMB-like protein; PH domain-like, PID dom 7e-31
2dyq_A144 Amyloid beta A4 precursor protein-binding family 3 8e-31
3so6_A137 LDL receptor adaptor protein; PTB, endocytic adapt 1e-29
3dxe_A140 Amyloid beta A4 protein-binding family B member 1; 2e-28
2ej8_A160 DCC-interacting protein 13 alpha; structural genom 1e-27
1p3r_A160 Disabled homolog 2; PTB, signaling protein; 2.10A 3e-27
2ela_A175 Adapter protein containing PH domain, PTB domain a 3e-26
1ntv_A152 Disabled homolog 1; beta-sandwich, signaling prote 2e-25
1wgu_A136 APBB2, amyloid beta (A4) precursor protein-bindin, 7e-24
2yt0_A176 Amyloid beta A4 protein and amyloid beta A4 precur 3e-23
2ysz_A185 Amyloid beta A4 precursor protein-binding family B 5e-22
4dbb_A162 Amyloid beta A4 precursor protein-binding family 1 3e-20
1wvh_A134 Tensin, tensin1; beta sandwich, cell adhesion; 1.5 4e-20
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 9e-19
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 3e-18
3hqc_A157 Tensin-like C1 domain-containing phosphatase; TENC 3e-16
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 2e-11
1n3h_A207 SHC transforming protein; free protein, beta sandw 3e-11
1aqc_A172 X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1 3e-10
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 5e-09
2cuc_A70 SH3 domain containing ring finger 2; structural ge 1e-07
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 2e-07
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 2e-07
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 3e-07
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 2e-06
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 4e-06
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 6e-06
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 6e-06
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 7e-06
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 9e-06
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 1e-05
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 2e-05
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-05
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 2e-05
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 2e-05
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 3e-05
3u23_A65 CD2-associated protein; structural genomics, struc 3e-05
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 4e-05
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 4e-05
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 5e-05
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 5e-05
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 8e-05
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 8e-05
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 8e-05
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 8e-05
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 9e-05
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 1e-04
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 1e-04
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 2e-04
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 2e-04
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 2e-04
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 2e-04
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 2e-04
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-04
2dil_A69 Proline-serine-threonine phosphatase-interacting p 2e-04
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 2e-04
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 3e-04
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 3e-04
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 3e-04
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 3e-04
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 3e-04
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 4e-04
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 5e-04
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 5e-04
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 6e-04
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 6e-04
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 6e-04
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 7e-04
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 7e-04
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 8e-04
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 8e-04
>3f0w_A NUMB-R, NUMB-like protein; PH domain-like, PID domain, phosphoprotein, signaling protei structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} PDB: 1wj1_A 2nmb_A* 1ddm_A Length = 168 Back     alignment and structure
 Score =  113 bits (284), Expect = 7e-31
 Identities = 37/128 (28%), Positives = 58/128 (45%), Gaps = 8/128 (6%)

Query: 178 RFLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPGQHRK 237
            F + YLG VE    +G  V   AV K++    +    +L VS +GLR+V+        K
Sbjct: 43  SFPVRYLGHVEVEESRGMHVCEDAVKKLKAMGRKSVKSVLWVSADGLRVVD-------DK 95

Query: 238 VRGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLAS-ESTRPVAEAVGRA 296
            + L    +++ V FC           +I +    +R+ CH FLA  +S   ++ AVG A
Sbjct: 96  TKDLLVDQTIEKVSFCAPDRNLDKAFSYICRDGTTRRWICHCFLALKDSGERLSHAVGCA 155

Query: 297 FQRFYEKF 304
           F    E+ 
Sbjct: 156 FAACLERK 163
>2dyq_A Amyloid beta A4 precursor protein-binding family 3; phosphotyrosine-interaction domain (PTB/PID alzheimer'S disease, structural genomics, NPPSFA; 3.10A {Homo sapiens} Length = 144 Back     alignment and structure
>3so6_A LDL receptor adaptor protein; PTB, endocytic adaptor, autosomal reces hypercholesterolemia, ARH, cholesterol; 1.37A {Rattus norvegicus} Length = 137 Back     alignment and structure
>3dxe_A Amyloid beta A4 protein-binding family B member 1; alzheimer'S disease, APP, AICD, Fe65, PTB domain, alternative splicing, polymorphism, alzheimer disease, apoptosis; 2.00A {Homo sapiens} PDB: 3dxd_A 3dxc_A Length = 140 Back     alignment and structure
>2ej8_A DCC-interacting protein 13 alpha; structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.84A {Homo sapiens} Length = 160 Back     alignment and structure
>1p3r_A Disabled homolog 2; PTB, signaling protein; 2.10A {Mus musculus} SCOP: b.55.1.2 PDB: 1m7e_A Length = 160 Back     alignment and structure
>2ela_A Adapter protein containing PH domain, PTB domain and leucine zipper motif 1; APPL, cell cycle; 2.00A {Homo sapiens} Length = 175 Back     alignment and structure
>1ntv_A Disabled homolog 1; beta-sandwich, signaling protein; 1.50A {Mus musculus} SCOP: b.55.1.2 PDB: 1nu2_A* 1oqn_A* Length = 152 Back     alignment and structure
>1wgu_A APBB2, amyloid beta (A4) precursor protein-bindin, family B, member 2; phosphotyrosine-interaction domain, amyloid disease, structural genomics; NMR {Mus musculus} SCOP: b.55.1.2 PDB: 2roz_B Length = 136 Back     alignment and structure
>2yt0_A Amyloid beta A4 protein and amyloid beta A4 precursor protein-binding family B member...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} PDB: 2yt1_A Length = 176 Back     alignment and structure
>2ysz_A Amyloid beta A4 precursor protein-binding family B member 2 and amyloid beta A4 protein...; chimera, Fe65L, PID domain, amyloid precursor protein; NMR {Mus musculus} Length = 185 Back     alignment and structure
>4dbb_A Amyloid beta A4 precursor protein-binding family 1; X11S/mints, PTB domain, chimera protein, protein transport; HET: IPA GOL; 1.90A {Rattus norvegicus} Length = 162 Back     alignment and structure
>1wvh_A Tensin, tensin1; beta sandwich, cell adhesion; 1.50A {Gallus gallus} SCOP: b.55.1.2 PDB: 2gjy_A Length = 134 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>3hqc_A Tensin-like C1 domain-containing phosphatase; TENC1, phosphotyrosine binding domain, PTB, TNS2, KIAA1075, struct genomics, PSI-2; 1.80A {Homo sapiens} PDB: 2dkq_A Length = 157 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1n3h_A SHC transforming protein; free protein, beta sandwich, signaling protein; NMR {Homo sapiens} SCOP: b.55.1.2 PDB: 1oy2_A 2l1c_A* 1shc_A* Length = 207 Back     alignment and structure
>1aqc_A X11; PTB domain; 2.30A {Homo sapiens} SCOP: b.55.1.2 PDB: 1x11_A* Length = 172 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 320
d1ddma_135 b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanoga 1e-29
d1wj1a_156 b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 1 4e-28
d1p3ra_148 b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mu 3e-25
d1ntva_152 b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mu 2e-22
d1wgua_136 b.55.1.2 (A:) Amyloid beta A4 precursor protein-bi 8e-21
d2dkqa1147 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [T 1e-20
d2cy5a1129 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {M 3e-20
d1wvha1133 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gal 8e-20
d1oy2a_191 b.55.1.2 (A:) Shc adaptor protein {Human (Homo sap 4e-12
d1aqca_166 b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 96 6e-11
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 2e-07
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 3e-07
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 1e-06
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 2e-06
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 2e-06
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 3e-06
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 3e-06
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 7e-06
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 7e-06
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 7e-06
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 9e-06
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 1e-05
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 1e-05
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 2e-05
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 2e-05
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 2e-05
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-05
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 5e-05
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 9e-05
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 1e-04
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-04
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 6e-04
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 7e-04
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 8e-04
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 8e-04
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 0.001
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 0.001
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 0.002
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 0.002
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 0.003
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 0.003
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 0.004
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 0.004
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 0.004
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 135 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: Numb
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]

 Score =  108 bits (270), Expect = 1e-29
 Identities = 38/126 (30%), Positives = 60/126 (47%), Gaps = 8/126 (6%)

Query: 179 FLLGYLGSVETSAHKGNAVICQAVHKIRQTQHRPHSCILEVSDEGLRMVEKSRPGQHRKV 238
           F + YLG VE    +G  V  +A+  +RQ++ RP   +L VS +GLR+V+    G     
Sbjct: 17  FSVKYLGCVEVFESRGMQVCEEALKVLRQSRRRPVRGLLHVSGDGLRVVDDETKGLI--- 73

Query: 239 RGLDYFYSLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLAS-ESTRPVAEAVGRAF 297
                  +++ V FC           +I +    +R+ CH FLA  +S   ++ AVG AF
Sbjct: 74  ----VDQTIEKVSFCAPDRNHERGFSYICRDGTTRRWMCHGFLACKDSGERLSHAVGCAF 129

Query: 298 QRFYEK 303
               E+
Sbjct: 130 AVCLER 135
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Length = 156 Back     information, alignment and structure
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 148 Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 152 Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 129 Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 191 Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
d1p3ra_148 Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [T 99.98
d1wj1a_156 Numb {Mouse (Mus musculus) [TaxId: 10090]} 99.98
d1ddma_135 Numb {Fruit fly (Drosophila melanogaster) [TaxId: 99.97
d1aqca_166 X11 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ntva_152 Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [T 99.97
d1wgua_136 Amyloid beta A4 precursor protein-binding family B 99.96
d1oy2a_191 Shc adaptor protein {Human (Homo sapiens) [TaxId: 99.96
d2cy5a1129 EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) 99.95
d2dkqa1147 Tensin {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1wvha1133 Tensin {Chicken (Gallus gallus) [TaxId: 9031]} 99.93
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.47
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.45
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.44
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.42
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.41
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.4
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.4
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.39
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.38
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.38
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.37
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.37
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.36
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.35
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.34
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.33
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.32
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.31
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.31
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.31
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.3
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.3
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.29
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.29
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.28
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.28
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.27
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.27
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.26
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.25
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.25
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.24
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.23
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.23
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.23
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.22
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.21
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.2
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.18
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.17
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.1
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.08
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.08
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 98.99
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 98.79
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 98.45
d1mixa292 Talin {Chicken (Gallus gallus) [TaxId: 9031]} 93.67
d1j0wa_99 Downstream of tyrosine kinase 5, Dok-5 {Human (Hom 89.4
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 87.71
>d1p3ra_ b.55.1.2 (A:) Disabled homolog 2 (Dab2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: Phosphotyrosine-binding domain (PTB)
domain: Disabled homolog 2 (Dab2)
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.98  E-value=5e-32  Score=229.61  Aligned_cols=127  Identities=9%  Similarity=0.199  Sum_probs=115.5

Q ss_pred             CCCceeEEEEecCceEecCCCchHHHHHHHHHHHhc-------CCCCcEEEEEEeCCceEEEeCCCCCccceeeeecccc
Q psy368          173 KPKRERFLLGYLGSVETSAHKGNAVICQAVHKIRQT-------QHRPHSCILEVSDEGLRMVEKSRPGQHRKVRGLDYFY  245 (320)
Q Consensus       173 ~~~~~~F~VKYLGSVeV~~~kG~~Vv~eAV~kI~~~-------~~kp~~V~L~VS~~GIrVvD~~tk~~~~~~~~~~~f~  245 (320)
                      .++++.|.|+|||+++|..++|++++++||++|+..       ..++++|.|.||.+||+|+|.+++.     .+.  +|
T Consensus        13 ~~~gv~f~vkYLGs~~V~~~~G~~~~~~Ai~~l~~~~~~~k~~~~~~~~V~l~Vs~~gi~v~d~~t~~-----~i~--~~   85 (148)
T d1p3ra_          13 KGDGVKYKAKLIGIDDVPDARGDKMSQDSMMKLKGMAAAGRSQGQHKQRIWVNISLSGIKIIDEKTGV-----IEH--EH   85 (148)
T ss_dssp             STTCEEEEEEEEEEEEESSSCCHHHHHHHHHHHHHHHHHHHTTTCCCEEEEEEEETTEEEEEETTTCC-----EEE--EE
T ss_pred             cCCCeEEEEEEEEEEEecCCCChHHHHHHHHHHHHhhhhcccccCCCceEEEEEEcCEEEEEcCCCcc-----eEE--Ee
Confidence            478999999999999999999999999999999754       2568999999999999999999873     443  49


Q ss_pred             ccceeEEEEecCCCCceeEEEeeCCCCceeeEEEEecCCChHHHHHHHHHHHHHHHHHHHhhc
Q psy368          246 SLKNVMFCGFHPREPCYLGFISKHPNMQRFACHVFLASESTRPVAEAVGRAFQRFYEKFIETA  308 (320)
Q Consensus       246 pL~~ISFca~Dp~d~r~FaFIak~~~~~rf~CHVF~c~~sA~~Ia~AIG~AFqvayq~~l~~a  308 (320)
                      ||++||||+.|+.|+++||||+++++  .+.||||.|.+.|+.|+.+||+||++||+.+.+..
T Consensus        86 ~i~~ISf~~~d~~~~~~FafI~~~~~--~~~Chvf~~~~~A~~i~~~i~~AF~~a~~~~~~~~  146 (148)
T d1p3ra_          86 PVNKISFIARDVTDNRAFGYVCGGEG--QHQFFAIKTGQQAEPLVVDLKDLFQVIYNVKKKEE  146 (148)
T ss_dssp             CGGGEEEEEECTTCTTEEEEEESSTT--CEEEEEEEESSCSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ehhhEEEEEECCCCCcEEEEEEeCCC--cEEEEEEEchHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            99999999999999999999999974  68999999999999999999999999999998753
>d1wj1a_ b.55.1.2 (A:) Numb {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ddma_ b.55.1.2 (A:) Numb {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1aqca_ b.55.1.2 (A:) X11 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ntva_ b.55.1.2 (A:) Disabled homolog 1 (Dab1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgua_ b.55.1.2 (A:) Amyloid beta A4 precursor protein-binding family B member 2, Apbb2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy2a_ b.55.1.2 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cy5a1 b.55.1.2 (A:31-159) EPS8-like protein 1, EPS8L1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dkqa1 b.55.1.2 (A:8-154) Tensin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvha1 b.55.1.2 (A:1606-1738) Tensin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mixa2 b.55.1.5 (A:309-400) Talin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j0wa_ b.55.1.2 (A:) Downstream of tyrosine kinase 5, Dok-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure