Psyllid ID: psy3708

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MKSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLITYR
ccEEEEEEEEEccccEEEEccccccEEEccccccEEEEEEcccccccHHHHHHHHccccEEEEcccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccEEcccccccccccccccccc
ccEEEEEEEEEccccEEEccccccccEccccccccEEEEEcccccccEEEEEEEEHcccEEEccccccccccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEcccccccHHHcccHHEccHHcccHHHHHHHHHccEcccEEEccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEccccccccHHcccEEEEc
mkstftislghpkkltsisnmplersedistkpgwvldvfqksvpmsTYLVAFIISdftfrqsntsnpdlsrvqfrtwarrdvIDQVDFAAEAGPEFLNFFERYFniryplpkqdmvaipslsallfdDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFniryplpkqdmvaipdfsagamenwglityr
mkstftislghpkkltsisnmplersedistkpGWVLDVFQKSVPMSTYLVAFIISDFtfrqsntsnpdlsrvqfrTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLITYR
MKSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLITYR
********************************PGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLIT**
MKSTFTISLGHPKKLTSISNMPLE*******KPGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLITYR
********LGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLITYR
MKSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLITYR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPDFSAGAMENWGLITYR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query240 2.2.26 [Sep-21-2011]
Q9NZ08 941 Endoplasmic reticulum ami yes N/A 0.737 0.188 0.459 6e-40
P15684 965 Aminopeptidase N OS=Rattu yes N/A 0.712 0.177 0.442 7e-40
Q9JJ22 930 Endoplasmic reticulum ami no N/A 0.741 0.191 0.447 9e-40
Q9EQH2 930 Endoplasmic reticulum ami yes N/A 0.741 0.191 0.442 3e-39
O57579 967 Aminopeptidase N OS=Gallu yes N/A 0.708 0.175 0.435 4e-39
P15145 963 Aminopeptidase N OS=Sus s no N/A 0.712 0.177 0.435 4e-37
A6QPT7 954 Endoplasmic reticulum ami no N/A 0.725 0.182 0.430 7e-37
P15144 967 Aminopeptidase N OS=Homo no N/A 0.712 0.176 0.435 1e-36
P97449 966 Aminopeptidase N OS=Mus m no N/A 0.712 0.177 0.427 2e-36
P15541 966 Aminopeptidase N OS=Oryct no N/A 0.712 0.177 0.421 2e-36
>sp|Q9NZ08|ERAP1_HUMAN Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens GN=ERAP1 PE=1 SV=3 Back     alignment and function desciption
 Score =  164 bits (414), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 120/198 (60%), Gaps = 21/198 (10%)

Query: 2   KSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFR 61
           K++F+I +    +  +ISNMPL +S  ++   G + D F  +V MSTYLVAFIISDF   
Sbjct: 200 KASFSIKIRREPRHLAISNMPLVKS--VTVAEGLIEDHFDVTVKMSTYLVAFIISDF--- 254

Query: 62  QSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPS 121
             + S    S V+   +A  D I+Q D+A +A    L F+E YF+I YPLPKQD+ AIP 
Sbjct: 255 -ESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIPYPLPKQDLAAIPD 313

Query: 122 L---------------SALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLW 166
                           SALLFD  +SS  ++  I  T+AHELAHQWFGNLVTM+WW DLW
Sbjct: 314 FQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWFGNLVTMEWWNDLW 373

Query: 167 LNEGFATYMAAQALNDVH 184
           LNEGFA +M   +++  H
Sbjct: 374 LNEGFAKFMEFVSVSVTH 391
Aminopeptidase that plays a central role in peptide trimming, a step required for the generation of most HLA class I-binding peptides. Peptide trimming is essential to customize longer precursor peptides to fit them to the correct length required for presentation on MHC class I molecules. Strongly prefers substrates 9-16 residues long. Rapidly degrades 13-mer to a 9-mer and then stops. Preferentially hydrolyzes the residue Leu and peptides with a hydrophobic C-terminus, while it has weak activity toward peptides with charged C-terminus. May play a role in the inactivation of peptide hormones. May be involved in the regulation of blood pressure through the inactivation of angiotensin II and/or the generation of bradykinin in the kidney.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 4EC: .EC: 1EC: 1EC: .EC: -
>sp|P15684|AMPN_RAT Aminopeptidase N OS=Rattus norvegicus GN=Anpep PE=1 SV=2 Back     alignment and function description
>sp|Q9JJ22|ERAP1_RAT Endoplasmic reticulum aminopeptidase 1 OS=Rattus norvegicus GN=Erap1 PE=2 SV=2 Back     alignment and function description
>sp|Q9EQH2|ERAP1_MOUSE Endoplasmic reticulum aminopeptidase 1 OS=Mus musculus GN=Erap1 PE=2 SV=2 Back     alignment and function description
>sp|O57579|AMPN_CHICK Aminopeptidase N OS=Gallus gallus GN=ANPEP PE=1 SV=1 Back     alignment and function description
>sp|P15145|AMPN_PIG Aminopeptidase N OS=Sus scrofa GN=ANPEP PE=1 SV=4 Back     alignment and function description
>sp|A6QPT7|ERAP2_BOVIN Endoplasmic reticulum aminopeptidase 2 OS=Bos taurus GN=ERAP2 PE=2 SV=1 Back     alignment and function description
>sp|P15144|AMPN_HUMAN Aminopeptidase N OS=Homo sapiens GN=ANPEP PE=1 SV=4 Back     alignment and function description
>sp|P97449|AMPN_MOUSE Aminopeptidase N OS=Mus musculus GN=Anpep PE=1 SV=4 Back     alignment and function description
>sp|P15541|AMPN_RABIT Aminopeptidase N OS=Oryctolagus cuniculus GN=ANPEP PE=1 SV=4 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
189234124 1101 PREDICTED: similar to protease m1 zinc m 0.737 0.160 0.572 3e-55
270002889 919 aminopeptidase N-like protein [Tribolium 0.737 0.192 0.572 3e-55
157131764 947 protease m1 zinc metalloprotease [Aedes 0.758 0.192 0.517 5e-52
170060424 915 protease m1 zinc metalloprotease [Culex 0.837 0.219 0.481 2e-51
347964688 955 AGAP000885-PA [Anopheles gambiae str. PE 0.758 0.190 0.487 6e-51
328718946 955 PREDICTED: aminopeptidase N-like [Acyrth 0.829 0.208 0.472 2e-50
242016955 962 Aminopeptidase N precursor, putative [Pe 0.775 0.193 0.487 3e-50
195503314 935 GE10460 [Drosophila yakuba] gi|194184701 0.745 0.191 0.489 1e-49
357615851 965 aminopeptidase N-like protein [Danaus pl 0.8 0.198 0.466 2e-49
328718942 918 PREDICTED: aminopeptidase N-like [Acyrth 0.829 0.216 0.481 2e-49
>gi|189234124|ref|XP_968871.2| PREDICTED: similar to protease m1 zinc metalloprotease [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 136/194 (70%), Gaps = 17/194 (8%)

Query: 1   MKSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTF 60
           MK+TF I+LG    L SISNMPL  S+ I  K G+  D ++ SVPMSTYLVAF+ISDF  
Sbjct: 355 MKATFDITLGRRAHLNSISNMPLIESQPIKEKEGYFWDKYEPSVPMSTYLVAFMISDFGH 414

Query: 61  RQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIP 120
           + S  S  +   V F+ WA++D +DQVD+A E GP+ L ++E +F+I+YPLPKQDMVAIP
Sbjct: 415 KTSEPSQKN--NVTFKIWAKKDSLDQVDYAREVGPKVLEYYEDFFDIKYPLPKQDMVAIP 472

Query: 121 SLSA---------------LLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDL 165
             SA               LLFD   +S+ N+  IAN IAHELAHQWFGNLVTMKWWTDL
Sbjct: 473 DFSAGAMENWGLITYREALLLFDPKVTSLTNQQRIANVIAHELAHQWFGNLVTMKWWTDL 532

Query: 166 WLNEGFATYMAAQA 179
           WLNEGFATYMA++A
Sbjct: 533 WLNEGFATYMASRA 546

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270002889|gb|EEZ99336.1| aminopeptidase N-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157131764|ref|XP_001662326.1| protease m1 zinc metalloprotease [Aedes aegypti] gi|108871403|gb|EAT35628.1| AAEL012217-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170060424|ref|XP_001865797.1| protease m1 zinc metalloprotease [Culex quinquefasciatus] gi|167878911|gb|EDS42294.1| protease m1 zinc metalloprotease [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|347964688|ref|XP_316862.5| AGAP000885-PA [Anopheles gambiae str. PEST] gi|333469462|gb|EAA12046.5| AGAP000885-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328718946|ref|XP_001950011.2| PREDICTED: aminopeptidase N-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|242016955|ref|XP_002428960.1| Aminopeptidase N precursor, putative [Pediculus humanus corporis] gi|212513789|gb|EEB16222.1| Aminopeptidase N precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|195503314|ref|XP_002098600.1| GE10460 [Drosophila yakuba] gi|194184701|gb|EDW98312.1| GE10460 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|357615851|gb|EHJ69867.1| aminopeptidase N-like protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|328718942|ref|XP_001944764.2| PREDICTED: aminopeptidase N-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query240
FB|FBgn0051445 927 CG31445 [Drosophila melanogast 0.745 0.193 0.479 1.1e-45
FB|FBgn0039656 814 CG11951 [Drosophila melanogast 0.745 0.219 0.484 1.8e-45
FB|FBgn0263236 932 SP1029 "SP1029" [Drosophila me 0.745 0.192 0.469 1.1e-44
FB|FBgn0039640 999 CG14516 [Drosophila melanogast 0.691 0.166 0.436 3.2e-39
UNIPROTKB|Q9NZ08 941 ERAP1 "Endoplasmic reticulum a 0.737 0.188 0.459 1.7e-36
RGD|708542 930 Erap1 "endoplasmic reticulum a 0.741 0.191 0.447 4.5e-36
UNIPROTKB|K7GLU6 863 K7GLU6 "Uncharacterized protei 0.737 0.205 0.444 4.8e-36
WB|WBGene00011587 988 T07F10.1 [Caenorhabditis elega 0.729 0.177 0.422 6.6e-36
MGI|MGI:1933403 930 Erap1 "endoplasmic reticulum a 0.741 0.191 0.442 1.2e-35
UNIPROTKB|F1RNU1 947 F1RNU1 "Uncharacterized protei 0.258 0.065 0.580 1.3e-35
FB|FBgn0051445 CG31445 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 488 (176.8 bits), Expect = 1.1e-45, P = 1.1e-45
 Identities = 95/198 (47%), Positives = 131/198 (66%)

Query:     2 KSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFR 61
             K++F ++LG+ K+  ++SNMP+       +   ++   FQ+SVPMSTYLVA+ ++DF+F+
Sbjct:   182 KASFVVTLGYHKQFNALSNMPVREIRPHESLANYIWCEFQESVPMSTYLVAYSVNDFSFK 241

Query:    62 QSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPS 121
              S   N  L    FRTWAR + IDQ D+AAE GP+ L ++E +F IRYPLPK D +A+P 
Sbjct:   242 PSTLPNGAL----FRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIRYPLPKIDQMAVPD 297

Query:   122 LSA---------------LLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLW 166
              SA               LL+    SS+ ++  +AN IAHELAHQWFGNLVTMKWWTDLW
Sbjct:   298 FSAGAMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQWFGNLVTMKWWTDLW 357

Query:   167 LNEGFATYMAAQALNDVH 184
             LNEGFATY+A   + +++
Sbjct:   358 LNEGFATYVAGLGVQEIY 375
GO:0006508 "proteolysis" evidence=ISS
GO:0004177 "aminopeptidase activity" evidence=ISS
GO:0016021 "integral to membrane" evidence=ISS
GO:0008237 "metallopeptidase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
FB|FBgn0039656 CG11951 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263236 SP1029 "SP1029" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0039640 CG14516 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZ08 ERAP1 "Endoplasmic reticulum aminopeptidase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|708542 Erap1 "endoplasmic reticulum aminopeptidase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|K7GLU6 K7GLU6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00011587 T07F10.1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:1933403 Erap1 "endoplasmic reticulum aminopeptidase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RNU1 F1RNU1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.11LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
cd09601446 cd09601, M1_APN_2, Peptidase M1 Aminopeptidase N f 2e-90
pfam01433390 pfam01433, Peptidase_M1, Peptidase family M1 8e-71
COG0308 859 COG0308, PepN, Aminopeptidase N [Amino acid transp 2e-43
cd09602438 cd09602, M1_APN_3, Peptidase M1 family containing 2e-43
cd09603415 cd09603, M1_APN_4, Peptidase M1 family Aminopeptid 9e-37
TIGR02412 831 TIGR02412, pepN_strep_liv, aminopeptidase N, Strep 1e-30
cd09601 446 cd09601, M1_APN_2, Peptidase M1 Aminopeptidase N f 9e-28
cd09595407 cd09595, M1, Peptidase M1 family contains aminopep 6e-25
pfam01433 390 pfam01433, Peptidase_M1, Peptidase family M1 7e-21
cd09599442 cd09599, M1_LTA4H, Peptidase M1 family contains le 2e-15
COG0308 859 COG0308, PepN, Aminopeptidase N [Amino acid transp 2e-12
pfam13485128 pfam13485, Peptidase_MA_2, Peptidase MA superfamil 2e-11
TIGR02411 602 TIGR02411, leuko_A4_hydro, leukotriene A-4 hydrola 1e-10
cd09602 438 cd09602, M1_APN_3, Peptidase M1 family containing 3e-10
cd09839507 cd09839, M1_TAF2, TATA binding protein (TBP) assoc 4e-09
cd09604435 cd09604, M1_APN_5, Peptidase M1 family containing 4e-09
TIGR02412 831 TIGR02412, pepN_strep_liv, aminopeptidase N, Strep 5e-08
TIGR02414 863 TIGR02414, pepN_proteo, aminopeptidase N, Escheric 2e-06
cd09595 407 cd09595, M1, Peptidase M1 family contains aminopep 8e-06
cd09594125 cd09594, GluZincin, Peptidase Gluzincin family (th 3e-05
cd09600 861 cd09600, M1_APN_1, Peptidase M1 family containing 6e-05
cd09603 415 cd09603, M1_APN_4, Peptidase M1 family Aminopeptid 5e-04
TIGR02414 863 TIGR02414, pepN_proteo, aminopeptidase N, Escheric 0.002
>gnl|CDD|189008 cd09601, M1_APN_2, Peptidase M1 Aminopeptidase N family incudes tricorn interacting factor F3, Endoplasmic reticulum aminopeptidase 1 (ERAP1), Aminopeptidase Q (APQ) Back     alignment and domain information 
 Score =  272 bits (699), Expect = 2e-90
 Identities = 95/199 (47%), Positives = 121/199 (60%), Gaps = 21/199 (10%)

Query: 1   MKSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTF 60
            K+TFTI++ HP   T++SNMP+E  E +    GW    F+ + PMSTYLVAF++ DF +
Sbjct: 138 FKATFTITITHPAGYTALSNMPVESEEVLG--DGWKTTEFETTPPMSTYLVAFVVGDFDY 195

Query: 61  RQSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIP 120
            +  T N     V  R +AR   I+Q D+A E  P+ L FFE YF I YPLPK D+VAIP
Sbjct: 196 VEGTTKN----GVPVRVYARPGKIEQGDYALEVAPKILEFFEDYFGIPYPLPKLDLVAIP 251

Query: 121 SLSA---------------LLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDL 165
             +A               LL+D   SS  N+  +A  +AHELAHQWFGNLVTMKWW DL
Sbjct: 252 DFAAGAMENWGLITYRETALLYDPKTSSASNKQRVATVVAHELAHQWFGNLVTMKWWDDL 311

Query: 166 WLNEGFATYMAAQALNDVH 184
           WLNEGFATYM    ++ + 
Sbjct: 312 WLNEGFATYMEYLGVDHLE 330

This M1 peptidase family includes eukaryotic and bacterial members: aminopeptidase N (APN), aminopeptidase Q (APQ, laeverin), endoplasmic reticulum aminopeptidase 1 (ERAP1) as well as tricorn interacting factor F3. Aminopeptidase N (APN; CD13; Alanyl aminopeptidase; EC 3.4.11.2), a Type II integral membrane protease, consists of a small N-terminal cytoplasmic domain, a single transmembrane domain and a large extracellular ectodomain that contains the active site. It preferentially cleaves neutral amino acids from the N-terminus of oligopeptides and is present in a variety of human tissues and cell types (leukocyte, fibroblast, endothelial and epithelial cells). APN expression is dysregulated in inflammatory diseases such as chronic pain, rheumatoid arthritis, multiple sclerosis, systemic sclerosis, systemic lupus erythematosus, polymyositis/dermatomyosytis and pulmonary sarcoidosis, and is enhanced in tumor cells such as melanoma, renal, prostate, pancreas, colon, gastric and thyroid cancers. It is considered a marker of differentiation since it is predominantly expressed on stem cells and on cells of the granulocytic and monocytic lineages at distinct stages of differentiation. Thus, APN inhibition may lead to the development of anti-cancer and anti-inflammatory drugs. ERAP1 also known as endoplasmic reticulum aminopeptidase associated with antigen processing (ERAAP), adipocyte derived leucine aminopeptidase (A-LAP) or aminopeptidase regulating tumor necrosis factor receptor I (THFRI) shedding (ARTS-1), associates with the closely related ER aminopeptidase ERAP2, for the final trimming of peptides within the ER for presentation by MHC class I molecules. ERAP1 is associated with ankylosing spondylitis (AS), an inflammatory arthritis that predominantly affects the spine. ERAP1 also aids in the shedding of membrane-bound cytokine receptors. The tricorn interacting factor F3, together with factors F1 and F2, degrades the tricorn protease products, producing free amino acids, thus completing the proteasomal degradation pathway. F3 is homologous to F2, but not F1, and shows a strong preference for glutamate in the P1' position. APQ, also known as laeverin, is specifically expressed in human embryo-derived extravillous trophoblasts (EVTs) that invade the uterus during early placentation. It cleaves the N-terminal amino acid of various peptides such as angiotensin III, endokinin C, and kisspeptin-10, all expressed in the placenta in large quantities. APN is a receptor for coronaviruses, although the virus receptor interaction site seems to be distinct from the enzymatic site and aminopeptidase activity is not necessary for viral infection. APNs are also putative Cry toxin receptors. Cry1 proteins are pore-forming toxins that bind to the midgut epithelial cell membrane of susceptible insect larvae, causing extensive damage. Several different toxins, including Cry1Aa, Cry1Ab, Cry1Ac, Cry1Ba, Cry1Ca and Cry1Fa, have been shown to bind to APNs; however, a direct role of APN in cytotoxicity has been yet to be firmly established. Length = 446
>gnl|CDD|216501 pfam01433, Peptidase_M1, Peptidase family M1 Back     alignment and domain information
>gnl|CDD|223385 COG0308, PepN, Aminopeptidase N [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|189009 cd09602, M1_APN_3, Peptidase M1 family containing Aminopeptidase N Back     alignment and domain information
>gnl|CDD|189010 cd09603, M1_APN_4, Peptidase M1 family Aminopeptidase N Back     alignment and domain information
>gnl|CDD|233857 TIGR02412, pepN_strep_liv, aminopeptidase N, Streptomyces lividans type Back     alignment and domain information
>gnl|CDD|189008 cd09601, M1_APN_2, Peptidase M1 Aminopeptidase N family incudes tricorn interacting factor F3, Endoplasmic reticulum aminopeptidase 1 (ERAP1), Aminopeptidase Q (APQ) Back     alignment and domain information
>gnl|CDD|189002 cd09595, M1, Peptidase M1 family contains aminopeptidase N and leukotriene A4 hydrolase Back     alignment and domain information
>gnl|CDD|216501 pfam01433, Peptidase_M1, Peptidase family M1 Back     alignment and domain information
>gnl|CDD|189006 cd09599, M1_LTA4H, Peptidase M1 family contains leukotriene A4 hydrolase Back     alignment and domain information
>gnl|CDD|223385 COG0308, PepN, Aminopeptidase N [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|222169 pfam13485, Peptidase_MA_2, Peptidase MA superfamily Back     alignment and domain information
>gnl|CDD|233856 TIGR02411, leuko_A4_hydro, leukotriene A-4 hydrolase/aminopeptidase Back     alignment and domain information
>gnl|CDD|189009 cd09602, M1_APN_3, Peptidase M1 family containing Aminopeptidase N Back     alignment and domain information
>gnl|CDD|189018 cd09839, M1_TAF2, TATA binding protein (TBP) associated factor 2 Back     alignment and domain information
>gnl|CDD|189011 cd09604, M1_APN_5, Peptidase M1 family containing bacterial Aminopeptidase N Back     alignment and domain information
>gnl|CDD|233857 TIGR02412, pepN_strep_liv, aminopeptidase N, Streptomyces lividans type Back     alignment and domain information
>gnl|CDD|233858 TIGR02414, pepN_proteo, aminopeptidase N, Escherichia coli type Back     alignment and domain information
>gnl|CDD|189002 cd09595, M1, Peptidase M1 family contains aminopeptidase N and leukotriene A4 hydrolase Back     alignment and domain information
>gnl|CDD|189001 cd09594, GluZincin, Peptidase Gluzincin family (thermolysin-like proteinases, TLPs) includes peptidases M1, M2, M3, M4, M13, M32 and M36 (fungalysins) Back     alignment and domain information
>gnl|CDD|189007 cd09600, M1_APN_1, Peptidase M1 family containing Aminopeptidase N Back     alignment and domain information
>gnl|CDD|189010 cd09603, M1_APN_4, Peptidase M1 family Aminopeptidase N Back     alignment and domain information
>gnl|CDD|233858 TIGR02414, pepN_proteo, aminopeptidase N, Escherichia coli type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 240
KOG1046|consensus 882 100.0
PF01433390 Peptidase_M1: Peptidase family M1 This is family M 100.0
TIGR02412 831 pepN_strep_liv aminopeptidase N, Streptomyces livi 100.0
TIGR02414 863 pepN_proteo aminopeptidase N, Escherichia coli typ 100.0
PRK14015 875 pepN aminopeptidase N; Provisional 100.0
COG0308 859 PepN Aminopeptidase N [Amino acid transport and me 100.0
TIGR02411 601 leuko_A4_hydro leukotriene A-4 hydrolase/aminopept 100.0
KOG1047|consensus 613 99.97
KOG1932|consensus 1180 99.88
KOG1046|consensus 882 99.08
PF13485128 Peptidase_MA_2: Peptidase MA superfamily 98.56
TIGR02414 863 pepN_proteo aminopeptidase N, Escherichia coli typ 98.4
TIGR02412 831 pepN_strep_liv aminopeptidase N, Streptomyces livi 98.39
PRK14015 875 pepN aminopeptidase N; Provisional 98.2
COG0308 859 PepN Aminopeptidase N [Amino acid transport and me 98.18
PF01433 390 Peptidase_M1: Peptidase family M1 This is family M 98.08
COG3975 558 Predicted protease with the C-terminal PDZ domain 97.87
PF07607128 DUF1570: Protein of unknown function (DUF1570); In 97.16
PF05299122 Peptidase_M61: M61 glycyl aminopeptidase; InterPro 97.02
TIGR02411 601 leuko_A4_hydro leukotriene A-4 hydrolase/aminopept 97.02
PF10460 366 Peptidase_M30: Peptidase M30; InterPro: IPR019501 96.67
PF04450205 BSP: Peptidase of plants and bacteria; InterPro: I 96.17
PF10026195 DUF2268: Predicted Zn-dependent protease (DUF2268) 95.62
PRK04860160 hypothetical protein; Provisional 94.63
PF10023337 DUF2265: Predicted aminopeptidase (DUF2265); Inter 94.0
PF01447150 Peptidase_M4: Thermolysin metallopeptidase, cataly 92.76
COG4324376 Predicted aminopeptidase [General function predict 91.44
PF12315212 DUF3633: Protein of unknown function (DUF3633); In 89.89
COG3227507 LasB Zinc metalloprotease (elastase) [Amino acid t 89.76
PF12725318 DUF3810: Protein of unknown function (DUF3810); In 89.07
PF01435226 Peptidase_M48: Peptidase family M48 This is family 87.98
smart00731146 SprT SprT homologues. Predicted to have roles in t 87.68
PRK05457284 heat shock protein HtpX; Provisional 86.62
PRK04897298 heat shock protein HtpX; Provisional 85.33
PRK01345317 heat shock protein HtpX; Provisional 84.46
PF1369979 DUF4157: Domain of unknown function (DUF4157) 84.43
PRK03001283 M48 family peptidase; Provisional 84.03
PRK03072288 heat shock protein HtpX; Provisional 82.82
PRK03982288 heat shock protein HtpX; Provisional 81.53
PF10263157 SprT-like: SprT-like family; InterPro: IPR006640 T 81.41
PRK02391296 heat shock protein HtpX; Provisional 81.36
KOG2661|consensus424 80.3
PRK01265324 heat shock protein HtpX; Provisional 80.1
>KOG1046|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.3e-47  Score=361.70  Aligned_cols=214  Identities=46%  Similarity=0.772  Sum_probs=192.6

Q ss_pred             CceEEEEEEEecCCcEEEecCCccccccccCCCCeEEEEEecCCCccceeEEeEEeceeEeecCCCCCCCCCceEEEEEe
Q psy3708           1 MKSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFRQSNTSNPDLSRVQFRTWAR   80 (240)
Q Consensus         1 ~Katf~l~i~~p~~~~~~sng~~~~~~~~~~~~~~~~~~f~~t~p~~~y~~a~~vg~f~~~~~~~~~~~~~~~~i~v~~~   80 (240)
                      +||+|+|+|.||++++++|||+++++  ...++++++++|..|++||+|++||+||+|...+.    .+.+|+++++|++
T Consensus       176 ~KAtF~Itl~hp~~~~aLSNm~v~~~--~~~~~~~~~~~F~~Tp~MstYLvAf~V~~f~~~e~----~~~~~v~vrv~a~  249 (882)
T KOG1046|consen  176 FKATFTITLVHPKGYTALSNMPVIKE--EPVDDGWKTTTFEKTPKMSTYLVAFAVGDFVYVET----ITKSGVPVRVYAR  249 (882)
T ss_pred             ccCceEEEEEecCCceEeecCccccc--ccccCCeeEEEEEecCCCchhhheeeeecccccee----ecCCCceEEEEeC
Confidence            69999999999999999999999983  55666699999999999999999999999999988    4778899999999


Q ss_pred             CCccchHHHHHHHHHHHHHHHHHHhCCCCCCCCCCeEEcCCc---------------ceeeEcCCCCChhhHHHHHHHHH
Q psy3708          81 RDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSL---------------SALLFDDVRSSIHNEYSIANTIA  145 (240)
Q Consensus        81 ~~~~~~~~~~~~~~~~~l~~~e~~~g~~yp~~~l~~v~~p~~---------------~~~~~~~~~~~~~~~~~~~~~ia  145 (240)
                      |+...+.+++++.++++|+||+++||++||++|+|+|++|+|               ..+++++..+...++.+++.+||
T Consensus       250 p~~~~~~~~al~~~~~~L~~~e~~f~i~yPLpK~D~iavPdf~~GAMENwGLvtyre~~lL~~~~~ss~~~k~~va~vIa  329 (882)
T KOG1046|consen  250 PEKINQGQFALEVATKVLEFYEDYFGIPYPLPKLDLVAVPDFSAGAMENWGLVTYRETALLYDPQTSSSSNKQRVAEVIA  329 (882)
T ss_pred             hHHhhHHHHHHHHHHHHHHHHHHHhCCCCCCccccEEecCCccccchhcCcceeeeehhhccCCCcCcHHHHHHHHHHHH
Confidence            999999999999999999999999999999999999999998               66888898899999999999999


Q ss_pred             HHhhhhhhCCCCCccccchhhhhhhHHHHHHHHhhhhcccccchhhhhHhhcchhhHH--HHHHHhccCCCCCCccE
Q psy3708         146 HELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFDSQVDFAAEAGPEFLN--FFERYFNIRYPLPKQDM  220 (240)
Q Consensus       146 HEiaHqWfG~~v~~~~w~d~WL~EG~a~y~~~~~~~~~~~~~~~~~~~~~~~~~~~l~--~~~~~~~~~~p~~k~d~  220 (240)
                      ||+|||||||+||++||+|+|||||||+|++++.++..+|+|...++|..+.....+.  ....-+.+..|+...+.
T Consensus       330 HElAHQWFGNLVTm~wW~dLWLnEGfAt~~~~~~v~~~~p~~~~~~~~~~~~l~~~l~~D~l~~shpi~~~v~~~~e  406 (882)
T KOG1046|consen  330 HELAHQWFGNLVTMKWWNDLWLNEGFATYVEYLAVDHLFPEWDIWEQFLLENLERVLSLDALASSHPISVPVESPSE  406 (882)
T ss_pred             HHHHHHHhcCcccHhhhhhhhhcccHHHHHHHHhhccCCcchhhHHHHHHHHHHHHhhhhcccccCCeeeecCCcch
Confidence            9999999999999999999999999999999999999999999998887777766553  33344445555555543

>PF01433 Peptidase_M1: Peptidase family M1 This is family M1 in the peptidase classification Back     alignment and domain information
>TIGR02412 pepN_strep_liv aminopeptidase N, Streptomyces lividans type Back     alignment and domain information
>TIGR02414 pepN_proteo aminopeptidase N, Escherichia coli type Back     alignment and domain information
>PRK14015 pepN aminopeptidase N; Provisional Back     alignment and domain information
>COG0308 PepN Aminopeptidase N [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02411 leuko_A4_hydro leukotriene A-4 hydrolase/aminopeptidase Back     alignment and domain information
>KOG1047|consensus Back     alignment and domain information
>KOG1932|consensus Back     alignment and domain information
>KOG1046|consensus Back     alignment and domain information
>PF13485 Peptidase_MA_2: Peptidase MA superfamily Back     alignment and domain information
>TIGR02414 pepN_proteo aminopeptidase N, Escherichia coli type Back     alignment and domain information
>TIGR02412 pepN_strep_liv aminopeptidase N, Streptomyces lividans type Back     alignment and domain information
>PRK14015 pepN aminopeptidase N; Provisional Back     alignment and domain information
>COG0308 PepN Aminopeptidase N [Amino acid transport and metabolism] Back     alignment and domain information
>PF01433 Peptidase_M1: Peptidase family M1 This is family M1 in the peptidase classification Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>PF07607 DUF1570: Protein of unknown function (DUF1570); InterPro: IPR011464 This entry represents hypothetical proteins confined to bacteria Back     alignment and domain information
>PF05299 Peptidase_M61: M61 glycyl aminopeptidase; InterPro: IPR007963 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR02411 leuko_A4_hydro leukotriene A-4 hydrolase/aminopeptidase Back     alignment and domain information
>PF10460 Peptidase_M30: Peptidase M30; InterPro: IPR019501 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF04450 BSP: Peptidase of plants and bacteria; InterPro: IPR007541 These basic secretory proteins (BSPs) are believed to be part of the plants defence mechanism against pathogens [] Back     alignment and domain information
>PF10026 DUF2268: Predicted Zn-dependent protease (DUF2268); InterPro: IPR018728 This domain, found in various hypothetical bacterial proteins, as well as predicted zinc dependent proteases, has no known function Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF10023 DUF2265: Predicted aminopeptidase (DUF2265); InterPro: IPR014553 This group represents a predicted aminopeptidase Back     alignment and domain information
>PF01447 Peptidase_M4: Thermolysin metallopeptidase, catalytic domain This Prosite motif covers only the active site Back     alignment and domain information
>COG4324 Predicted aminopeptidase [General function prediction only] Back     alignment and domain information
>PF12315 DUF3633: Protein of unknown function (DUF3633); InterPro: IPR022087 This domain family is found in bacteria and eukaryotes, and is approximately 210 amino acids in length Back     alignment and domain information
>COG3227 LasB Zinc metalloprotease (elastase) [Amino acid transport and metabolism] Back     alignment and domain information
>PF12725 DUF3810: Protein of unknown function (DUF3810); InterPro: IPR024294 This family of bacterial proteins is functionally uncharacterised Back     alignment and domain information
>PF01435 Peptidase_M48: Peptidase family M48 This is family M48 in the peptidase classification Back     alignment and domain information
>smart00731 SprT SprT homologues Back     alignment and domain information
>PRK05457 heat shock protein HtpX; Provisional Back     alignment and domain information
>PRK04897 heat shock protein HtpX; Provisional Back     alignment and domain information
>PRK01345 heat shock protein HtpX; Provisional Back     alignment and domain information
>PF13699 DUF4157: Domain of unknown function (DUF4157) Back     alignment and domain information
>PRK03001 M48 family peptidase; Provisional Back     alignment and domain information
>PRK03072 heat shock protein HtpX; Provisional Back     alignment and domain information
>PRK03982 heat shock protein HtpX; Provisional Back     alignment and domain information
>PF10263 SprT-like: SprT-like family; InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT) Back     alignment and domain information
>PRK02391 heat shock protein HtpX; Provisional Back     alignment and domain information
>KOG2661|consensus Back     alignment and domain information
>PRK01265 heat shock protein HtpX; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
2yd0_A 897 Crystal Structure Of The Soluble Domain Of Human En 4e-41
2yd0_A 897 Crystal Structure Of The Soluble Domain Of Human En 4e-15
3qnf_A 954 Crystal Structure Of The Open State Of Human Endopl 5e-41
3qnf_A 954 Crystal Structure Of The Open State Of Human Endopl 4e-15
3mdj_A 921 Er Aminopeptidase, Erap1, Bound To The Zinc Aminope 6e-41
3mdj_A 921 Er Aminopeptidase, Erap1, Bound To The Zinc Aminope 4e-15
4f5c_A 959 Crystal Structure Of The Spike Receptor Binding Dom 4e-38
4f5c_A 959 Crystal Structure Of The Spike Receptor Binding Dom 1e-12
4h5h_A 908 Crystal Structure Of Porcine Aminopeptidase-N Compl 4e-38
4h5h_A 908 Crystal Structure Of Porcine Aminopeptidase-N Compl 1e-12
4fke_A 909 Crystal Structure Of Porcine Aminopeptidase-N Lengt 4e-38
4fke_A 909 Crystal Structure Of Porcine Aminopeptidase-N Lengt 1e-12
4hol_A 908 Crystal Structure Of Porcine Aminopeptidase-N Compl 1e-37
4hol_A 908 Crystal Structure Of Porcine Aminopeptidase-N Compl 1e-12
4fyq_A 903 Human Aminopeptidase N (Cd13) Length = 903 1e-37
4fyq_A 903 Human Aminopeptidase N (Cd13) Length = 903 5e-12
3se6_A 967 Crystal Structure Of The Human Endoplasmic Reticulu 3e-36
3se6_A 967 Crystal Structure Of The Human Endoplasmic Reticulu 3e-14
4e36_A 967 Crystal Structure Of The Human Endoplasmic Reticulu 1e-35
4e36_A 967 Crystal Structure Of The Human Endoplasmic Reticulu 2e-14
1z1w_A 780 Crystal Structures Of The Tricorn Interacting Facor 3e-24
1z1w_A 780 Crystal Structures Of The Tricorn Interacting Facor 6e-09
3q7j_A 780 Engineered Thermoplasma Acidophilum F3 Factor Mimic 1e-23
3q7j_A 780 Engineered Thermoplasma Acidophilum F3 Factor Mimic 6e-09
1gw6_A 610 Structure Of Leukotriene A4 Hydrolase D375n Mutant 3e-10
1sqm_A 610 Structure Of [r563a] Leukotriene A4 Hydrolase Lengt 3e-10
1h19_A 611 Structure Of [e271q] Leukotriene A4 Hydrolase Lengt 3e-10
2r59_A 616 Leukotriene A4 Hydrolase Complexed With Inhibitor R 3e-10
3cho_A 610 Crystal Structure Of Leukotriene A4 Hydrolase In Co 3e-10
1hs6_A 611 Structure Of Leukotriene A4 Hydrolase Complexed Wit 4e-10
3u9w_A 608 Structure Of Human Leukotriene A4 Hydrolase In Comp 4e-10
3b7s_A 616 [e296q]lta4h In Complex With Rsr Substrate Length = 8e-10
3cia_A 605 Crystal Structure Of Cold-Aminopeptidase From Colwe 1e-09
2xpy_A 632 Structure Of Native Leukotriene A4 Hydrolase From S 1e-07
2xq0_A 632 Structure Of Yeast Lta4 Hydrolase In Complex With B 3e-07
3q43_A 891 X-Ray Crystal Structure Of Pfa-M1 Bound To Bestatin 1e-05
3q43_A 891 X-Ray Crystal Structure Of Pfa-M1 Bound To Bestatin 1e-04
3ebi_A 890 Structure Of The M1 Alanylaminopeptidase From Malar 1e-05
3ebi_A 890 Structure Of The M1 Alanylaminopeptidase From Malar 1e-04
3t8v_A 895 A Bestatin-Based Chemical Biology Strategy Reveals 1e-05
3t8v_A 895 A Bestatin-Based Chemical Biology Strategy Reveals 1e-04
3ebg_A 889 Structure Of The M1 Alanylaminopeptidase From Malar 1e-05
3ebg_A 889 Structure Of The M1 Alanylaminopeptidase From Malar 1e-04
2hpo_A 891 Structure Of Aminopeptidase N From E. Coli Suggests 6e-05
3puu_A 891 Crystal Structure Of Glu121gln Mutant Of E. Coli Am 6e-05
2dq6_A 870 Crystal Structure Of Aminopeptidase N From Escheric 6e-05
2gtq_A 867 Crystal Structure Of Aminopeptidase N From Human Pa 5e-04
>pdb|2YD0|A Chain A, Crystal Structure Of The Soluble Domain Of Human Endoplasmic Reticulum Aminopeptidase 1 Erap1 Length = 897 Back     alignment and structure 
Iteration: 1

 Score =  164 bits (415), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 91/198 (45%), Positives = 120/198 (60%), Gaps = 21/198 (10%)
Query: 2   KSTFTISLGHPKKLTSISNMPLERSEDISTKPGWVLDVFQKSVPMSTYLVAFIISDFTFR 61
           K++F+I +    +  +ISNMPL +S  ++   G + D F  +V MSTYLVAFIISDF   
Sbjct: 155 KASFSIKIRREPRHLAISNMPLVKS--VTVAEGLIEDHFDVTVKMSTYLVAFIISDF--- 209
Query: 62  QSNTSNPDLSRVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPS 121
             + S    S V+   +A  D I+Q D+A +A    L F+E YF+I YPLPKQD+ AIP 
Sbjct: 210 -ESVSKITKSGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIPYPLPKQDLAAIPD 268
Query: 122 L---------------SALLFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLW 166
                           SALLFD  +SS  ++  I  T+AHELAHQWFGNLVTM+WW DLW
Sbjct: 269 FQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVAHELAHQWFGNLVTMEWWNDLW 328
Query: 167 LNEGFATYMAAQALNDVH 184
           LNEGFA +M   +++  H
Sbjct: 329 LNEGFAKFMEFVSVSVTH 346
>pdb|2YD0|A Chain A, Crystal Structure Of The Soluble Domain Of Human Endoplasmic Reticulum Aminopeptidase 1 Erap1 Length = 897 Back     alignment and structure
>pdb|3QNF|A Chain A, Crystal Structure Of The Open State Of Human Endoplasmic Reticulum Aminopeptidase 1 Erap1 Length = 954 Back     alignment and structure
>pdb|3QNF|A Chain A, Crystal Structure Of The Open State Of Human Endoplasmic Reticulum Aminopeptidase 1 Erap1 Length = 954 Back     alignment and structure
>pdb|3MDJ|A Chain A, Er Aminopeptidase, Erap1, Bound To The Zinc Aminopeptidase Inhibitor, Bestatin Length = 921 Back     alignment and structure
>pdb|3MDJ|A Chain A, Er Aminopeptidase, Erap1, Bound To The Zinc Aminopeptidase Inhibitor, Bestatin Length = 921 Back     alignment and structure
>pdb|4F5C|A Chain A, Crystal Structure Of The Spike Receptor Binding Domain Of A Porcine Respiratory Coronavirus In Complex With The Pig Aminopeptidase N Ectodomain Length = 959 Back     alignment and structure
>pdb|4F5C|A Chain A, Crystal Structure Of The Spike Receptor Binding Domain Of A Porcine Respiratory Coronavirus In Complex With The Pig Aminopeptidase N Ectodomain Length = 959 Back     alignment and structure
>pdb|4H5H|A Chain A, Crystal Structure Of Porcine Aminopeptidase-N Complexed With Cleaved Poly-Alanine Length = 908 Back     alignment and structure
>pdb|4H5H|A Chain A, Crystal Structure Of Porcine Aminopeptidase-N Complexed With Cleaved Poly-Alanine Length = 908 Back     alignment and structure
>pdb|4FKE|A Chain A, Crystal Structure Of Porcine Aminopeptidase-N Length = 909 Back     alignment and structure
>pdb|4FKE|A Chain A, Crystal Structure Of Porcine Aminopeptidase-N Length = 909 Back     alignment and structure
>pdb|4HOL|A Chain A, Crystal Structure Of Porcine Aminopeptidase-N Complexed With Poly- Alanine Length = 908 Back     alignment and structure
>pdb|4HOL|A Chain A, Crystal Structure Of Porcine Aminopeptidase-N Complexed With Poly- Alanine Length = 908 Back     alignment and structure
>pdb|4FYQ|A Chain A, Human Aminopeptidase N (Cd13) Length = 903 Back     alignment and structure
>pdb|4FYQ|A Chain A, Human Aminopeptidase N (Cd13) Length = 903 Back     alignment and structure
>pdb|3SE6|A Chain A, Crystal Structure Of The Human Endoplasmic Reticulum Aminopeptidase 2 Length = 967 Back     alignment and structure
>pdb|3SE6|A Chain A, Crystal Structure Of The Human Endoplasmic Reticulum Aminopeptidase 2 Length = 967 Back     alignment and structure
>pdb|4E36|A Chain A, Crystal Structure Of The Human Endoplasmic Reticulum Aminopeptidase 2 Variant N392k Length = 967 Back     alignment and structure
>pdb|4E36|A Chain A, Crystal Structure Of The Human Endoplasmic Reticulum Aminopeptidase 2 Variant N392k Length = 967 Back     alignment and structure
>pdb|1Z1W|A Chain A, Crystal Structures Of The Tricorn Interacting Facor F3 From Thermoplasma Acidophilum, A Zinc Aminopeptidase In Three Different Conformations Length = 780 Back     alignment and structure
>pdb|1Z1W|A Chain A, Crystal Structures Of The Tricorn Interacting Facor F3 From Thermoplasma Acidophilum, A Zinc Aminopeptidase In Three Different Conformations Length = 780 Back     alignment and structure
>pdb|3Q7J|A Chain A, Engineered Thermoplasma Acidophilum F3 Factor Mimics Human Aminopeptidase N (Apn) As A Target For Anticancer Drug Development Length = 780 Back     alignment and structure
>pdb|3Q7J|A Chain A, Engineered Thermoplasma Acidophilum F3 Factor Mimics Human Aminopeptidase N (Apn) As A Target For Anticancer Drug Development Length = 780 Back     alignment and structure
>pdb|1GW6|A Chain A, Structure Of Leukotriene A4 Hydrolase D375n Mutant Length = 610 Back     alignment and structure
>pdb|1SQM|A Chain A, Structure Of [r563a] Leukotriene A4 Hydrolase Length = 610 Back     alignment and structure
>pdb|1H19|A Chain A, Structure Of [e271q] Leukotriene A4 Hydrolase Length = 611 Back     alignment and structure
>pdb|2R59|A Chain A, Leukotriene A4 Hydrolase Complexed With Inhibitor Rb3041 Length = 616 Back     alignment and structure
>pdb|3CHO|A Chain A, Crystal Structure Of Leukotriene A4 Hydrolase In Complex With 2-Amino-N-[4-(Phenylmethoxy)phenyl]-Acetamide Length = 610 Back     alignment and structure
>pdb|1HS6|A Chain A, Structure Of Leukotriene A4 Hydrolase Complexed With Bestatin. Length = 611 Back     alignment and structure
>pdb|3U9W|A Chain A, Structure Of Human Leukotriene A4 Hydrolase In Complex With Inhibitor Sc57461a Length = 608 Back     alignment and structure
>pdb|3B7S|A Chain A, [e296q]lta4h In Complex With Rsr Substrate Length = 616 Back     alignment and structure
>pdb|3CIA|A Chain A, Crystal Structure Of Cold-Aminopeptidase From Colwellia Psychrerythraea Length = 605 Back     alignment and structure
>pdb|2XPY|A Chain A, Structure Of Native Leukotriene A4 Hydrolase From Saccharomyces Cerevisiae Length = 632 Back     alignment and structure
>pdb|2XQ0|A Chain A, Structure Of Yeast Lta4 Hydrolase In Complex With Bestatin Length = 632 Back     alignment and structure
>pdb|3Q43|A Chain A, X-Ray Crystal Structure Of Pfa-M1 Bound To Bestatin Derivative 15 Length = 891 Back     alignment and structure
>pdb|3Q43|A Chain A, X-Ray Crystal Structure Of Pfa-M1 Bound To Bestatin Derivative 15 Length = 891 Back     alignment and structure
>pdb|3EBI|A Chain A, Structure Of The M1 Alanylaminopeptidase From Malaria Complexed With The Phosphinate Dipeptide Analog Length = 890 Back     alignment and structure
>pdb|3EBI|A Chain A, Structure Of The M1 Alanylaminopeptidase From Malaria Complexed With The Phosphinate Dipeptide Analog Length = 890 Back     alignment and structure
>pdb|3T8V|A Chain A, A Bestatin-Based Chemical Biology Strategy Reveals Distinct Roles For Malaria M1- And M17-Family Aminopeptidases Length = 895 Back     alignment and structure
>pdb|3T8V|A Chain A, A Bestatin-Based Chemical Biology Strategy Reveals Distinct Roles For Malaria M1- And M17-Family Aminopeptidases Length = 895 Back     alignment and structure
>pdb|3EBG|A Chain A, Structure Of The M1 Alanylaminopeptidase From Malaria Length = 889 Back     alignment and structure
>pdb|3EBG|A Chain A, Structure Of The M1 Alanylaminopeptidase From Malaria Length = 889 Back     alignment and structure
>pdb|2HPO|A Chain A, Structure Of Aminopeptidase N From E. Coli Suggests A Compartmentalized, Gated Active Site Length = 891 Back     alignment and structure
>pdb|3PUU|A Chain A, Crystal Structure Of Glu121gln Mutant Of E. Coli Aminopeptidase N Length = 891 Back     alignment and structure
>pdb|2DQ6|A Chain A, Crystal Structure Of Aminopeptidase N From Escherichia Coli Length = 870 Back     alignment and structure
>pdb|2GTQ|A Chain A, Crystal Structure Of Aminopeptidase N From Human Pathogen Neisseria Meningitidis Length = 867 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query240
2xdt_A 897 Endoplasmic reticulum aminopeptidase 1; glycoprote 3e-83
2xdt_A 897 Endoplasmic reticulum aminopeptidase 1; glycoprote 3e-26
3se6_A 967 Endoplasmic reticulum aminopeptidase 2; thermolysi 5e-83
3se6_A 967 Endoplasmic reticulum aminopeptidase 2; thermolysi 2e-26
1z5h_A 780 Tricorn protease interacting factor F3; zinc amino 1e-80
1z5h_A 780 Tricorn protease interacting factor F3; zinc amino 4e-27
3b7s_A 616 Leukotriene A-4 hydrolase; transition state, analo 9e-61
3b7s_A 616 Leukotriene A-4 hydrolase; transition state, analo 5e-17
2xq0_A 632 LTA-4 hydrolase, leukotriene A-4 hydrolase; HET: B 8e-58
2xq0_A 632 LTA-4 hydrolase, leukotriene A-4 hydrolase; HET: B 7e-19
3cia_A 605 Cold-active aminopeptidase; psychrohilic, hydrolas 8e-56
3cia_A 605 Cold-active aminopeptidase; psychrohilic, hydrolas 1e-15
3ebh_A 889 PFA-M1, M1 family aminopeptidase; hydrolase, metal 5e-48
3ebh_A 889 PFA-M1, M1 family aminopeptidase; hydrolase, metal 5e-16
3b34_A 891 Aminopeptidase N; protease, hydrolase, thermolysin 4e-41
3b34_A 891 Aminopeptidase N; protease, hydrolase, thermolysin 9e-11
2gtq_A 867 Aminopeptidase N; alanine aminopeptidase, M1 famil 1e-39
2gtq_A 867 Aminopeptidase N; alanine aminopeptidase, M1 famil 8e-12
>3se6_A Endoplasmic reticulum aminopeptidase 2; thermolysin-like catalytic domain, zinc BIND glycosylation, hydrolase; HET: LYS NAG MES MAN; 3.08A {Homo sapiens} Length = 967 Back     alignment and structure
>3se6_A Endoplasmic reticulum aminopeptidase 2; thermolysin-like catalytic domain, zinc BIND glycosylation, hydrolase; HET: LYS NAG MES MAN; 3.08A {Homo sapiens} Length = 967 Back     alignment and structure
>1z5h_A Tricorn protease interacting factor F3; zinc aminopeptidase, gluzicins, superhelix, hydrolase; 2.30A {Thermoplasma acidophilum} PDB: 1z1w_A 3q7j_A* Length = 780 Back     alignment and structure
>1z5h_A Tricorn protease interacting factor F3; zinc aminopeptidase, gluzicins, superhelix, hydrolase; 2.30A {Thermoplasma acidophilum} PDB: 1z1w_A 3q7j_A* Length = 780 Back     alignment and structure
>3b7s_A Leukotriene A-4 hydrolase; transition state, analogue peptide, hydrolysis, hydrolase, leukotriene biosynthesis, metal-binding, metalloprotease; 1.47A {Homo sapiens} SCOP: a.118.1.7 b.98.1.1 d.92.1.13 PDB: 3b7t_A 3b7r_L* 2r59_A* 3b7u_X* 3fun_A* 1hs6_A* 2vj8_A* 3fh7_A* 3fh8_A* 3fhe_A* 3fts_A* 3ftu_A* 3ftv_A* 3ftw_A* 3ftx_A* 3fty_A* 3ftz_A* 3fu0_A* 3fu3_A* 3fu5_A* ... Length = 616 Back     alignment and structure
>3b7s_A Leukotriene A-4 hydrolase; transition state, analogue peptide, hydrolysis, hydrolase, leukotriene biosynthesis, metal-binding, metalloprotease; 1.47A {Homo sapiens} SCOP: a.118.1.7 b.98.1.1 d.92.1.13 PDB: 3b7t_A 3b7r_L* 2r59_A* 3b7u_X* 3fun_A* 1hs6_A* 2vj8_A* 3fh7_A* 3fh8_A* 3fhe_A* 3fts_A* 3ftu_A* 3ftv_A* 3ftw_A* 3ftx_A* 3fty_A* 3ftz_A* 3fu0_A* 3fu3_A* 3fu5_A* ... Length = 616 Back     alignment and structure
>2xq0_A LTA-4 hydrolase, leukotriene A-4 hydrolase; HET: BES; 1.96A {Saccharomyces cerevisiae} PDB: 2xpz_A* 2xpy_A* Length = 632 Back     alignment and structure
>2xq0_A LTA-4 hydrolase, leukotriene A-4 hydrolase; HET: BES; 1.96A {Saccharomyces cerevisiae} PDB: 2xpz_A* 2xpy_A* Length = 632 Back     alignment and structure
>3cia_A Cold-active aminopeptidase; psychrohilic, hydrolase; 2.70A {Colwellia psychrerythraea} Length = 605 Back     alignment and structure
>3cia_A Cold-active aminopeptidase; psychrohilic, hydrolase; 2.70A {Colwellia psychrerythraea} Length = 605 Back     alignment and structure
>3ebh_A PFA-M1, M1 family aminopeptidase; hydrolase, metal-binding, metalloprotease, P hydrolase inhibitor; HET: BES; 1.65A {Plasmodium falciparum} PDB: 3ebg_A* 3ebi_A* 3q43_A* 3q44_A* 3t8v_A* Length = 889 Back     alignment and structure
>3ebh_A PFA-M1, M1 family aminopeptidase; hydrolase, metal-binding, metalloprotease, P hydrolase inhibitor; HET: BES; 1.65A {Plasmodium falciparum} PDB: 3ebg_A* 3ebi_A* 3q43_A* 3q44_A* 3t8v_A* Length = 889 Back     alignment and structure
>3b34_A Aminopeptidase N; protease, hydrolase, thermolysin, phenylal membrane, metal-binding, metalloprotease; HET: PHE; 1.30A {Escherichia coli K12} PDB: 2hpt_A* 3b2p_A* 2hpo_A* 3b2x_A* 3b37_A* 3b3b_A* 3ked_A* 3qjx_A 3puu_A 2dq6_A 2dqm_A* 2zxg_A* Length = 891 Back     alignment and structure
>3b34_A Aminopeptidase N; protease, hydrolase, thermolysin, phenylal membrane, metal-binding, metalloprotease; HET: PHE; 1.30A {Escherichia coli K12} PDB: 2hpt_A* 3b2p_A* 2hpo_A* 3b2x_A* 3b37_A* 3b3b_A* 3ked_A* 3qjx_A 3puu_A 2dq6_A 2dqm_A* 2zxg_A* Length = 891 Back     alignment and structure
>2gtq_A Aminopeptidase N; alanine aminopeptidase, M1 family peptidas PSI-2, structural genomics, protein structure initiative; 2.05A {Neisseria meningitidis} Length = 867 Back     alignment and structure
>2gtq_A Aminopeptidase N; alanine aminopeptidase, M1 family peptidas PSI-2, structural genomics, protein structure initiative; 2.05A {Neisseria meningitidis} Length = 867 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 240
d3b7sa3252 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase cat 3e-18
d3b7sa3 252 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase cat 4e-08
d3b7sa2208 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-term 3e-11
>d3b7sa3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 252 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Leukotriene A4 hydrolase catalytic domain
domain: Leukotriene A4 hydrolase catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 78.9 bits (193), Expect = 3e-18
 Identities = 27/119 (22%), Positives = 49/119 (41%), Gaps = 8/119 (6%)

Query: 73  VQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIPSLSA-------L 125
            +   W+ ++ +++  +        L   E      Y   + D++ +P            
Sbjct: 8   PRTLVWSEKEQVEKSAYEFSETESMLKIAEDLG-GPYVWGQYDLLVLPPSFPYGGMENPC 66

Query: 126 LFDDVRSSIHNEYSIANTIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVH 184
           L     + +  + S++N IAH+++H W GNLVT K W   WLNEG   Y+       + 
Sbjct: 67  LTFVTPTLLAGDKSLSNVIAHQISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF 125
>d3b7sa3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Length = 252 Back     information, alignment and structure
>d3b7sa2 b.98.1.1 (A:1-208) Leukotriene A4 hydrolase N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 208 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query240
d3b7sa3252 Leukotriene A4 hydrolase catalytic domain {Human ( 99.95
d3b7sa3 252 Leukotriene A4 hydrolase catalytic domain {Human ( 98.04
d1u4ga_298 Elastase {Pseudomonas aeruginosa [TaxId: 287]} 95.18
d1kjpa_316 Thermolysin {Bacillus thermoproteolyticus [TaxId: 94.09
d1bqba_301 Aureolysin {Staphylococcus aureus [TaxId: 1280]} 93.77
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 83.07
>d3b7sa3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Leukotriene A4 hydrolase catalytic domain
domain: Leukotriene A4 hydrolase catalytic domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=2.6e-29  Score=204.66  Aligned_cols=114  Identities=24%  Similarity=0.461  Sum_probs=96.0

Q ss_pred             CceEEEEEeCCccchHHHHHHHHHHHHHHHHHHhCCCCCCCCCCeEEcC-Cc--------ceeeEcCCCCChhhHHHHHH
Q psy3708          72 RVQFRTWARRDVIDQVDFAAEAGPEFLNFFERYFNIRYPLPKQDMVAIP-SL--------SALLFDDVRSSIHNEYSIAN  142 (240)
Q Consensus        72 ~~~i~v~~~~~~~~~~~~~~~~~~~~l~~~e~~~g~~yp~~~l~~v~~p-~~--------~~~~~~~~~~~~~~~~~~~~  142 (240)
                      |++|+||++|+....++++++.++++|++|++++| |||++++++|++| ++        +.+++.+....  ....+..
T Consensus         7 g~~vrv~~~p~~~~~~~~~l~~~~~~l~~~e~~~g-~YP~~k~d~v~~~~~~~~ggmE~~~l~~~~~~~~~--~~~~~~~   83 (252)
T d3b7sa3           7 GPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGG-PYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLA--GDKSLSN   83 (252)
T ss_dssp             ETTEEEEECGGGHHHHHHHTTTHHHHHHHHHHHHC-CCCSSCCEEEECCTTCSSSEECCTTEEEECGGGCC--SSSTTTH
T ss_pred             CCceEEEEccchHHHHHHHHHHHHHHHHHHHHhCC-CCCchhcCEEEeCCCccccccccceeeeecchhcc--ccchHHH
Confidence            68899999999999999999999999999999999 9999999999995 54        22334333221  1123446


Q ss_pred             HHHHHhhhhhhCCCCCccccchhhhhhhHHHHHHHHhhhhcccccc
Q psy3708         143 TIAHELAHQWFGNLVTMKWWTDLWLNEGFATYMAAQALNDVHILFD  188 (240)
Q Consensus       143 ~iaHEiaHqWfG~~v~~~~w~d~WL~EG~a~y~~~~~~~~~~~~~~  188 (240)
                      +||||+|||||||+|++++|+|.||+||||+|++.+++++.++...
T Consensus        84 ~iaHE~aHqWfG~~Vt~~~w~~~WL~EG~a~y~~~~~~~~~~~~~~  129 (252)
T d3b7sa3          84 VIAHQISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLFGEKF  129 (252)
T ss_dssp             HHHHHHHTTTBTTTEEESSGGGHHHHHHHHHHHHHHHHHHHHCHHH
T ss_pred             HHHHHHHHHHHhhhceeccccchHhhccHHHHHHHHhhccccchhh
Confidence            9999999999999999999999999999999999999999877543
>d3b7sa3 d.92.1.13 (A:209-460) Leukotriene A4 hydrolase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u4ga_ d.92.1.2 (A:) Elastase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kjpa_ d.92.1.2 (A:) Thermolysin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d1bqba_ d.92.1.2 (A:) Aureolysin {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1r55a_ d.92.1.9 (A:) ADAM33 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure