Psyllid ID: psy3718


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540---
MENFFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLLSSAPPEFEIKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCEIKSQKISSQQMTYEASGLKKKQNYIFYVTASTNIGEGQPSKNVTLSPSNRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAENEIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPRGRNMYEELKSQGRGYLVPRGGPPPCPGSDETLYSRHRGESDKCKNDRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTFL
cccEEEEcccccEEEEcEEEEEccccEEEEEEEEEcccccccccEEEEccccEEEEccccEEEEccccEEEEEEEEEccccEEEEEEccEEccccccccEEEEEEEccccEEEcEEEEEEcccccEEEEEEEEccccccEEEEEEEEcccccccccEEEEEEEccccccccccEEEEccccccccccEEEEEEEEEEEEccccccEEEEEcccccccEEEEEEEEEEcccccccccccEEEEccccccccccccEEEEEccccEEEEEEEccccccccccccEEEEEEEEcccccccEEEEEEEEcccccEEEEEEcccccccEEEEEEEEEcccccccccccEEEEcccccccccccccEEEEEcccEEEEEEEcccccccccEEEEEEEEEEEcccccccccEEEEEEEEEEEccccEEEEEEEEEEEEEEEcccccccccccccccEEEccccccccccEEEEcccEEEEEcccccccccccEEEEEEEEEccccccccccccEEEEEccEEEEEEEccEEEEEEEcccccccEEEEEcc
ccccEEEccccccEEEEEEEEEcccccEEEEEEEEccccccccEEEEEEcccEEEcccccEEEcccccEEEEEEEEcccccEEEEEEcccEcccccccEEEEEEcccccccEEEEEEEEEEcccccEEEEEEEccccccccEEEEEEEcccccccccccEEEEEEcccccEEEEEEEccccccccEEEEEccEEcccccccEccccEEEEEEcccccccEEEEEEEEEcccccccccEEEEEccccccccccccEEEEEccccEEEEEEccccccccccccEEEEEEEEEccccccccEEEEEEEccccccEEEEEEccccccEEEEEEEEEEcccccccccEEEEEccccccccccccEEEEEccccEEEEEEcccccccccccEEEEEEEEEEcccccccccEEEEEEcccccEEEEEEccccccEEEEEEEEEEccccccccccEEEEEcccccccccccEEEccccEEEEEEcccccccccEEEEEEEcccccccEEEEEcccEEEEcccccccccEEEEEEEEEccccccEEEEEccc
menfffyrgfnprILLGRvllpigessfhfdpellnpsfngfpplllssappefeIKLRnqtsrrgepsvlqceakgekpigilwnmnnkrldpksdnrytireeilpngvlsdlsikrtergdsalftceiksqkiSSQQMTYEasglkkkqnYIFYVTAstnigegqpsknvtlspsnrvpariasfndnftatytediklpcltvgvpapeiiwKTYHIRIVAeneigssepsdtvtiltaeeapsgppthikveatdqntlkvswspperdhwngVIQGYYVgyketstdkpflfetvdfskeegkehhltlsslkTYTQYSVVVQALnklgpgpmseevkqytaegtpeqppqdntcttltsqtirvswvspplitangviKGYKvvygpsdtwygdpktdictdiraswvspplitangviKGYKvvygpsdtwyghpgsfrnhctwdprgrnMYEELKSqgrgylvprggpppcpgsdetlysrhrgesdkckndrvpariasfndnftatytediklpcltvgvpapEIIWKTFL
MENFFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLLSSAPPEFEIKLRNqtsrrgepsvlqceakgekpigilwnmnnkrldpksdNRYTIreeilpngvlsdlsiKRTErgdsalftceiksqkissQQMTYEasglkkkqNYIFYVTAstnigegqpsknvtlspsnRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAEneigssepsDTVTILTAEeapsgppthikveatdQNTLKvswspperdhwnGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLtlsslktyTQYSVVVQALNKLGPGPMSEEVKQYTaegtpeqppqdnTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPRGRNMYEELKSQGRGYLVPRGGPPPCPGSDETLYSRhrgesdkckndrvpariASFNDNFTatytediklpcltvgvpaPEIIWKTFL
MENFFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLLSSAPPEFEIKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCEIKSQKISSQQMTYEASGLKKKQNYIFYVTASTNIGEGQPSKNVTLSPSNRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAENEIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPRGRNMYEELKSQGRGYLVPRGGPPPCPGSDETLYSRHRGESDKCKNDRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTFL
***FFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLL*******************************KPIGILWNMNN*********RYTIREEILPNGVLSDLSIKR****DSALFTCEIK**************GLKKKQNYIFYVTASTNI******************ARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAENE***************************************W***ERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKE**KEHHLTLSSLKTYTQYSVVVQALNK***************************CTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPRGRNM*********************************************ARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTF*
**NFFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLLSSAPPEFEIKLR***S*RGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCEIKSQKISSQQMTY**********************EGQPSKNVTLSPSNRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAENEIG********************PT*IKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETST*****F**VDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTW**********DIRASWVSPPLITANGVIKGYKVVYGPSD**************************KSQGRGYLVPRGGPPPCPGSDETLYS****************RIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTFL
MENFFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLLSSAPPEFEIKLRNQ**********QCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCEIKSQ**********ASGLKKKQNYIFYVTASTNIGEGQPSKNVTLSPSNRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAENEIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEE******************CTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPRGRNMYEELKSQGRGYLVPRGGPPPCPGSDETL************NDRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTFL
*ENFFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLLSSAPPEFEIKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCEIKSQKISSQQMTYEASGLKKKQNYIFYVTASTNIGEGQPSKNVTLSPSNRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAENEIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPRGRNMYEELKSQGRGYLVPRGGPPPCPGSDETLYSRHRGESDKCKNDRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTFL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENFFFYRGFNPRILLGRVLLPIGESSFHFDPELLNPSFNGFPPLLLSSAPPEFEIKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCEIKSQKISSQQMTYEASGLKKKQNYIFYVTASTNIGEGQPSKNVTLSPSNRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTYHIRIVAENEIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPRGRNMYEELKSQGRGYLVPRGGPPPCPGSDETLYSRHRGESDKCKNDRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEIIWKTFL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query543 2.2.26 [Sep-21-2011]
Q9ERC8 2013 Down syndrome cell adhesi yes N/A 0.581 0.156 0.296 3e-36
Q8VHZ8 2013 Down syndrome cell adhesi yes N/A 0.581 0.156 0.296 3e-36
O60469 2012 Down syndrome cell adhesi yes N/A 0.581 0.157 0.293 1e-35
Q4VA61 2053 Down syndrome cell adhesi no N/A 0.318 0.084 0.413 1e-33
Q8TD84 2053 Down syndrome cell adhesi no N/A 0.318 0.084 0.413 1e-33
Q9VS29 2074 Down syndrome cell adhesi no N/A 0.322 0.084 0.384 2e-30
Q8AV58 2169 Protein sidekick-1 OS=Gal no N/A 0.589 0.147 0.270 2e-25
Q7Z5N4 2213 Protein sidekick-1 OS=Hom no N/A 0.591 0.145 0.260 2e-22
Q3UH53 2193 Protein sidekick-1 OS=Mus no N/A 0.589 0.145 0.265 2e-20
A2A8L5 1898 Receptor-type tyrosine-pr no N/A 0.425 0.121 0.293 3e-19
>sp|Q9ERC8|DSCAM_MOUSE Down syndrome cell adhesion molecule homolog OS=Mus musculus GN=Dscam PE=1 SV=1 Back     alignment and function desciption
 Score =  153 bits (387), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 101/341 (29%), Positives = 169/341 (49%), Gaps = 25/341 (7%)

Query: 65   RGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGD 124
            +G+   + C A GEKPI + W   ++ ++P+   RY +  + +   V+S L I  T R D
Sbjct: 801  QGQRKEMSCTAHGEKPIIVRWEKEDRIINPEM-ARYLVSTKEVGEEVISTLQILPTVRED 859

Query: 125  SALFTCEIKSQKISSQ---QMTYEAS------GLKKKQNYIFYVTASTNIGEGQPSKNVT 175
            S  F+C   +     +   Q+T +         +K  +     +  +       P     
Sbjct: 860  SGFFSCHAINSYGEDRGIIQLTVQEPPDPPEIEIKDVKARTITLRWTMGFDGNSPITGYD 919

Query: 176  LSPSNRVPARIASFNDNF-TATYTEDI--KLPCLTVGVPAPEIIWKTYHIRIVAENEIGS 232
            +   N+        +D++ +A  T+D+  +L   T+    P     TY IR+ A+N IG 
Sbjct: 920  IECKNK--------SDSWDSAQRTKDVSPQLNSATIIDIHPS---STYSIRMYAKNRIGK 968

Query: 233  SEPSDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETS 292
            SEPS+ +TI   E AP GPP  + +E T   +++V+W  P++   NG+I+GY +GY+E S
Sbjct: 969  SEPSNEITITADEAAPDGPPQEVHLEPTSSQSIRVTWKAPKKHLQNGIIRGYQIGYREYS 1028

Query: 293  TDKPFLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGT 352
            T   F F  +      G     TL +L  +TQY +VVQA N+ G GP S+E+   T E  
Sbjct: 1029 TGGNFQFNIISIDT-TGDSEVYTLDNLNKFTQYGLVVQACNRAGTGPSSQEIITTTLEDV 1087

Query: 353  PEQPPQDNTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVY 393
            P  PP++      + ++I +SW +      NG+++G++V+Y
Sbjct: 1088 PSYPPENVQAIATSPESISISWSTLSKEALNGILQGFRVIY 1128




Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Mediates within retinal amacrine and ganglion cell subtypes both isoneuronal self-avoidance for creating an orderly dendritic arborization and heteroneuronal self-avoidance to maintain the mosaic spacing between amacrine and ganglion cell bodies. Receptor for netrin required for axon guidance independently of and in collaboration with the receptor DCC. In spinal chord development plays a role in guiding commissural axons projection and pathfinding across the ventral midline to reach the floor plate upon ligand binding. Enhances netrin-induced phosphorylation of PAK1 and FYN. Mediates intracellular signaling by stimulating the activation of MAPK8 and MAP kinase p38.
Mus musculus (taxid: 10090)
>sp|Q8VHZ8|DSCAM_RAT Down syndrome cell adhesion molecule homolog OS=Rattus norvegicus GN=Dscam PE=1 SV=1 Back     alignment and function description
>sp|O60469|DSCAM_HUMAN Down syndrome cell adhesion molecule OS=Homo sapiens GN=DSCAM PE=1 SV=2 Back     alignment and function description
>sp|Q4VA61|DSCL1_MOUSE Down syndrome cell adhesion molecule-like protein 1 homolog OS=Mus musculus GN=Dscaml1 PE=1 SV=2 Back     alignment and function description
>sp|Q8TD84|DSCL1_HUMAN Down syndrome cell adhesion molecule-like protein 1 OS=Homo sapiens GN=DSCAML1 PE=1 SV=2 Back     alignment and function description
>sp|Q9VS29|DSCL_DROME Down syndrome cell adhesion molecule-like protein Dscam2 OS=Drosophila melanogaster GN=Dscam2 PE=2 SV=3 Back     alignment and function description
>sp|Q8AV58|SDK1_CHICK Protein sidekick-1 OS=Gallus gallus GN=SDK1 PE=2 SV=1 Back     alignment and function description
>sp|Q7Z5N4|SDK1_HUMAN Protein sidekick-1 OS=Homo sapiens GN=SDK1 PE=1 SV=3 Back     alignment and function description
>sp|Q3UH53|SDK1_MOUSE Protein sidekick-1 OS=Mus musculus GN=Sdk1 PE=2 SV=1 Back     alignment and function description
>sp|A2A8L5|PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus GN=Ptprf PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
195382125 2232 dscam [Drosophila virilis] gi|194144578| 0.913 0.222 0.458 1e-116
195474348 2283 dscam [Drosophila yakuba] gi|194175554|g 0.913 0.217 0.455 1e-116
386767221 2019 down syndrome cell adhesion molecule, is 0.913 0.245 0.455 1e-116
45552493 2022 down syndrome cell adhesion molecule, is 0.913 0.245 0.455 1e-116
116007666 2016 down syndrome cell adhesion molecule, is 0.913 0.246 0.455 1e-116
28573968 2019 down syndrome cell adhesion molecule, is 0.913 0.245 0.455 1e-116
116007610 2016 down syndrome cell adhesion molecule, is 0.913 0.246 0.455 1e-116
116007652 2017 down syndrome cell adhesion molecule, is 0.913 0.245 0.455 1e-115
198456023 6743 dscam [Drosophila pseudoobscura pseudoob 0.913 0.073 0.456 1e-115
8072217 2016 Dscam [Drosophila melanogaster] 0.913 0.246 0.455 1e-115
>gi|195382125|ref|XP_002049781.1| dscam [Drosophila virilis] gi|194144578|gb|EDW60974.1| dscam [Drosophila virilis] Back     alignment and taxonomy information
 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 261/569 (45%), Positives = 325/569 (57%), Gaps = 73/569 (12%)

Query: 33   ELLNPSFNGFPPLLLSS--APPEFEIKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNK 90
            E +N   +G   +++ S  APPEF  KLRNQT+RRGEP+VLQCEAKGEKPIGILWNMNN 
Sbjct: 1006 EAINGIGSGLSAVIMVSVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNM 1065

Query: 91   RLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTC----EIKSQKISSQQMTYEA 146
            RLDPK+DNRYTIREEIL  GV+S LSIKRTER DSALFTC       S   S   +  E 
Sbjct: 1066 RLDPKNDNRYTIREEILSAGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEV 1125

Query: 147  SGLKKKQNYIFYVTASTNIGEGQPSKNVTLSPSNRVPARIASFNDNFTATYTE--DIKLP 204
              +      +     S  +   QP      SP NR    I  F  +  A++ E   + +P
Sbjct: 1126 PEMPYALKVLDKSGRSVQLSWAQPYDGN--SPLNRY---IIEFKRS-RASWDEIDRVMVP 1179

Query: 205  CLTVGVPAPEII-WKTYHIRIVAENEIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQN 263
              T      ++    TY+IRIVAENEIGSS+ S+ VTI+TAEEAPSG P +IKV+  +Q 
Sbjct: 1180 GHTTEAQVQKLSPATTYNIRIVAENEIGSSQSSEAVTIITAEEAPSGKPQNIKVDPVNQT 1239

Query: 264  TLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYT 323
            TL+V W PP R  WNG I GYYVGYK ++T+  ++FET++F  EEGKEH L L++L+ YT
Sbjct: 1240 TLRVMWKPPPRSDWNGEILGYYVGYKLSNTNSSYIFETINFITEEGKEHSLELNNLRVYT 1299

Query: 324  QYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITAN 383
            QYSVV+QA NK+G GP+S+E KQ+TAEGTP QPP D  CTTLTSQTIRVSWVSPPL +AN
Sbjct: 1300 QYSVVIQAFNKIGAGPLSDEEKQFTAEGTPSQPPSDTACTTLTSQTIRVSWVSPPLESAN 1359

Query: 384  GVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGH 443
            GVIK YKVVY PS+ WY + K        +  V       +G+ K          T  G 
Sbjct: 1360 GVIKTYKVVYAPSEEWYDETKRHYKKTASSDTV------LHGLKKYTNYTMQVLATTAGG 1413

Query: 444  PG--SFRNHCTWDPRGRNMYEELKS--QGRGYLVPRGGPPPCPG---SDETLYSRHRGES 496
             G  S   HC  +P       ++K+   G   ++    PP  P    +  T+YS+  G  
Sbjct: 1414 DGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAE 1473

Query: 497  DKCKNDRV---------------------------------------------PARIASF 511
             + K  +V                                             PA+IASF
Sbjct: 1474 TETKTQKVPHYQMSFEATELEKNKPYEFWVTASTTIGEGQQSKSIVAMPSDQVPAKIASF 1533

Query: 512  NDNFTATYTEDIKLPCLTVGVPAPEIIWK 540
            +D FTAT+ ED K+PCL VG P PEI WK
Sbjct: 1534 DDTFTATFKEDAKMPCLAVGAPQPEITWK 1562




Source: Drosophila virilis

Species: Drosophila virilis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195474348|ref|XP_002089453.1| dscam [Drosophila yakuba] gi|194175554|gb|EDW89165.1| dscam [Drosophila yakuba] Back     alignment and taxonomy information
>gi|386767221|ref|NP_001246174.1| down syndrome cell adhesion molecule, isoform BO [Drosophila melanogaster] gi|383302302|gb|AFH07929.1| down syndrome cell adhesion molecule, isoform BO [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45552493|ref|NP_995769.1| down syndrome cell adhesion molecule, isoform E [Drosophila melanogaster] gi|45445657|gb|AAS64901.1| down syndrome cell adhesion molecule, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|116007666|ref|NP_001036529.1| down syndrome cell adhesion molecule, isoform AE [Drosophila melanogaster] gi|113194634|gb|ABI31080.1| down syndrome cell adhesion molecule, isoform AE [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28573968|ref|NP_523649.5| down syndrome cell adhesion molecule, isoform D [Drosophila melanogaster] gi|21627760|gb|AAM68883.1| down syndrome cell adhesion molecule, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|116007610|ref|NP_001036501.1| down syndrome cell adhesion molecule, isoform AA [Drosophila melanogaster] gi|113194606|gb|ABI31052.1| down syndrome cell adhesion molecule, isoform AA [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|116007652|ref|NP_001036522.1| down syndrome cell adhesion molecule, isoform AM [Drosophila melanogaster] gi|113194627|gb|ABI31073.1| down syndrome cell adhesion molecule, isoform AM [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|198456023|ref|XP_001360206.2| dscam [Drosophila pseudoobscura pseudoobscura] gi|198135489|gb|EAL24780.2| dscam [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|8072217|gb|AAF71926.1|AF260530_1 Dscam [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query543
FB|FBgn0033159 2037 Dscam "Down syndrome cell adhe 0.860 0.229 0.480 6.8e-117
FB|FBgn0263219 1918 Dscam4 "Down syndrome cell adh 0.696 0.197 0.322 2.3e-57
MGI|MGI:1196281 2013 Dscam "Down syndrome cell adhe 0.596 0.160 0.311 1.2e-48
RGD|619992 2013 Dscam "Down syndrome cell adhe 0.596 0.160 0.311 1.2e-48
UNIPROTKB|O60469 2012 DSCAM "Down syndrome cell adhe 0.596 0.161 0.308 3.9e-48
MGI|MGI:2150309 2053 Dscaml1 "Down syndrome cell ad 0.318 0.084 0.413 4.2e-47
UNIPROTKB|E1BZF3 1870 E1BZF3 "Uncharacterized protei 0.318 0.092 0.413 8.9e-47
UNIPROTKB|F1MKB9 1859 DSCAM "Uncharacterized protein 0.605 0.176 0.301 1.8e-46
UNIPROTKB|F1N4K6 1886 DSCAML1 "Uncharacterized prote 0.318 0.091 0.413 2.3e-46
UNIPROTKB|Q8TD84 2053 DSCAML1 "Down syndrome cell ad 0.318 0.084 0.413 2.8e-46
FB|FBgn0033159 Dscam "Down syndrome cell adhesion molecule" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1040 (371.2 bits), Expect = 6.8e-117, Sum P(2) = 6.8e-117
 Identities = 238/495 (48%), Positives = 300/495 (60%)

Query:    33 ELLNPSFNGFPPLLLSS--APPEFEIKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNK 90
             E +N   +G   +++ S  APPEF  KLRNQT+RRGEP+VLQCEAKGEKPIGILWNMNN 
Sbjct:   797 EAINGIGSGLSAVIMISVQAPPEFTEKLRNQTARRGEPAVLQCEAKGEKPIGILWNMNNM 856

Query:    91 RLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTC----EIKSQKISSQQMTYEA 146
             RLDPK+DNRYTIREEIL  GV+S LSIKRTER DSALFTC       S   S   +  E 
Sbjct:   857 RLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATNAFGSDDASINMIVQEV 916

Query:   147 SGLKKKQNYIFYVTASTNIGEGQPSKNVTLSPSNRVPARIASFNDNFTATYTE-D-IKLP 204
               +      +     S  +   QP      SP +R    I  F  +  A+++E D + +P
Sbjct:   917 PEMPYALKVLDKSGRSVQLSWAQPYDGN--SPLDRY---IIEFKRS-RASWSEIDRVIVP 970

Query:   205 CLTVGVPAPEII-WKTYHIRIVAENEIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQN 263
               T      ++    TY+IRIVAEN IG+S+ S+ VTI+TAEEAPSG P +IKVE  +Q 
Sbjct:   971 GHTTEAQVQKLSPATTYNIRIVAENAIGTSQSSEAVTIITAEEAPSGKPQNIKVEPVNQT 1030

Query:   264 TLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYT 323
             T++V+W PP R  WNG I GYYVGYK ++T+  ++FET++F  EEGKEH+L L +L+ YT
Sbjct:  1031 TMRVTWKPPPRTEWNGEILGYYVGYKLSNTNSSYVFETINFITEEGKEHNLELQNLRVYT 1090

Query:   324 QYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITAN 383
             QYSVV+QA NK+G GP+SEE KQ+TAEGTP QPP D  CTTLTSQTIRV WVSPPL +AN
Sbjct:  1091 QYSVVIQAFNKIGAGPLSEEEKQFTAEGTPSQPPSDTACTTLTSQTIRVGWVSPPLESAN 1150

Query:   384 GVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGH 443
             GVIK YKVVY PSD WY + K        +  V       +G+ K          T  G 
Sbjct:  1151 GVIKTYKVVYAPSDEWYDETKRHYKKTASSDTV------LHGLKKYTNYTMQVLATTAGG 1204

Query:   444 PG--SFRNHCTWDPRGRNMYEELKS--QGRGYLVPRGGPPPCPG---SDETLYSRHRGES 496
              G  S   HC  +P       ++K+   G   ++    PP  P    +  T+YS+  G  
Sbjct:  1205 DGVRSVPIHCQTEPDVPEAPTDVKALVMGNAAILVSWRPPAQPNGIITQYTVYSKAEGAE 1264

Query:   497 DKCKNDRVPARIASF 511
              + K  +VP    SF
Sbjct:  1265 TETKTQKVPHYQMSF 1279


GO:0005887 "integral to plasma membrane" evidence=ISM;ISS
GO:0007411 "axon guidance" evidence=IGI;IMP;TAS
GO:0008046 "axon guidance receptor activity" evidence=IMP;NAS
GO:0007422 "peripheral nervous system development" evidence=IMP
GO:0016319 "mushroom body development" evidence=IMP
GO:0007413 "axonal fasciculation" evidence=IMP
GO:0006909 "phagocytosis" evidence=IMP
GO:0051635 "bacterial cell surface binding" evidence=IDA
GO:0048666 "neuron development" evidence=IMP
GO:0030424 "axon" evidence=IDA
GO:0070593 "dendrite self-avoidance" evidence=IMP;IDA
GO:0043025 "neuronal cell body" evidence=IDA
GO:0030425 "dendrite" evidence=IDA
GO:0042802 "identical protein binding" evidence=IPI
GO:0021551 "central nervous system morphogenesis" evidence=IMP
GO:0048846 "axon extension involved in axon guidance" evidence=IMP
GO:0042803 "protein homodimerization activity" evidence=IPI
FB|FBgn0263219 Dscam4 "Down syndrome cell adhesion molecule 4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1196281 Dscam "Down syndrome cell adhesion molecule" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|619992 Dscam "Down syndrome cell adhesion molecule" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O60469 DSCAM "Down syndrome cell adhesion molecule" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2150309 Dscaml1 "Down syndrome cell adhesion molecule like 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZF3 E1BZF3 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKB9 DSCAM "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1N4K6 DSCAML1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TD84 DSCAML1 "Down syndrome cell adhesion molecule-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 6e-16
smart0006083 smart00060, FN3, Fibronectin type 3 domain 2e-12
pfam0004184 pfam00041, fn3, Fibronectin type III domain 8e-11
pfam0767990 pfam07679, I-set, Immunoglobulin I-set domain 1e-06
smart0041085 smart00410, IG_like, Immunoglobulin like 4e-05
smart0040985 smart00409, IG, Immunoglobulin 4e-05
cd0573588 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) doma 5e-05
cd0572295 cd05722, Ig1_Neogenin, First immunoglobulin (Ig)-l 6e-05
cd0009674 cd00096, Ig, Immunoglobulin domain 2e-04
cd0572569 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like 0.002
cd07693100 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like 0.003
cd0575898 cd05758, Ig5_KIRREL3-like, Fifth immunoglobulin (I 0.004
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
 Score = 72.9 bits (179), Expect = 6e-16
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 7/99 (7%)

Query: 250 GPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETVDFSKEEG 309
            PPT+++V      ++ +SW+PPE D   G I GY V Y+E  +      +  +     G
Sbjct: 2   SPPTNLRVTDVTSTSVTLSWTPPEDD--GGPITGYVVEYREKGSG-----DWKEVEVTPG 54

Query: 310 KEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYT 348
            E   TL+ LK  T+Y   V+A+N  G  P SE V   T
Sbjct: 55  SETSYTLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93


Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93

>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|191810 pfam07679, I-set, Immunoglobulin I-set domain Back     alignment and domain information
>gnl|CDD|214653 smart00410, IG_like, Immunoglobulin like Back     alignment and domain information
>gnl|CDD|214652 smart00409, IG, Immunoglobulin Back     alignment and domain information
>gnl|CDD|143212 cd05735, Ig8_DSCAM, Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>gnl|CDD|143199 cd05722, Ig1_Neogenin, First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>gnl|CDD|143165 cd00096, Ig, Immunoglobulin domain Back     alignment and domain information
>gnl|CDD|143202 cd05725, Ig3_Robo, Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>gnl|CDD|143317 cd07693, Ig1_Robo, First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>gnl|CDD|143235 cd05758, Ig5_KIRREL3-like, Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 543
KOG3513|consensus 1051 100.0
KOG4221|consensus 1381 100.0
KOG4221|consensus 1381 100.0
KOG3513|consensus 1051 100.0
KOG4222|consensus 1281 100.0
KOG4222|consensus 1281 99.92
KOG4194|consensus873 99.79
KOG0196|consensus 996 99.71
PHA02826227 IL-1 receptor-like protein; Provisional 99.66
PHA02785326 IL-beta-binding protein; Provisional 99.64
PHA02785326 IL-beta-binding protein; Provisional 99.63
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 99.62
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 99.6
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 99.56
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 99.55
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 99.54
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 99.52
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 99.5
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 99.5
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 99.5
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 99.5
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 99.5
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 99.49
KOG4194|consensus873 99.49
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 99.48
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 99.48
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 99.48
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 99.48
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 99.47
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 99.47
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 99.47
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 99.47
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 99.46
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 99.46
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 99.46
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 99.46
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 99.44
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 99.44
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 99.44
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 99.44
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 99.43
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 99.43
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 99.43
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 99.43
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 99.43
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 99.42
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 99.42
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 99.41
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 99.41
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 99.41
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 99.41
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 99.41
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 99.38
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 99.38
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 99.37
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 99.37
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 99.36
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 99.36
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 99.36
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 99.36
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 99.35
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 99.35
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 99.34
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 99.34
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 99.33
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 99.33
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 99.33
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 99.32
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 99.32
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 99.32
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 99.31
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 99.3
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 99.3
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 99.3
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 99.3
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 99.27
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 99.27
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 99.27
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 99.26
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 99.26
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 99.25
KOG4258|consensus 1025 99.25
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 99.25
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 99.25
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 99.24
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 99.24
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 99.23
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 99.22
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 99.21
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 99.2
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 99.18
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 99.17
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 99.15
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 99.15
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 99.14
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 99.13
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 99.13
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 99.13
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 99.13
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 99.11
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 99.1
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 99.09
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 99.09
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 99.07
KOG0196|consensus 996 98.99
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 98.99
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 98.99
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 98.92
smart0040863 IGc2 Immunoglobulin C-2 Type. 98.91
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 98.89
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 98.88
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 98.84
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 98.82
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.81
KOG4802|consensus 516 98.8
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 98.77
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 98.76
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 98.75
PF0004764 ig: Immunoglobulin domain The Prosite family only 98.75
smart0040986 IG Immunoglobulin. 98.71
smart0041086 IG_like Immunoglobulin like. IG domains that canno 98.71
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 98.69
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 98.69
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 98.65
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 98.65
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 98.63
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 98.61
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 98.58
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 98.54
PHA02826227 IL-1 receptor-like protein; Provisional 98.53
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 98.53
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 98.46
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 98.44
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 98.44
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 98.43
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 98.41
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.39
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 98.39
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 98.38
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 98.37
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 98.37
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 98.35
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 98.34
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 98.33
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 98.33
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 98.33
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 98.31
cd04982116 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) dom 98.3
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 98.29
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 98.29
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 98.28
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 98.27
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 98.27
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 98.26
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 98.26
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 98.24
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 98.22
KOG3515|consensus741 98.21
cd0588382 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain 98.2
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 98.2
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 98.19
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 98.18
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 98.18
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 98.18
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 98.18
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 98.17
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 98.17
cd07706116 IgV_TCR_delta Immunoglobulin (Ig) variable (V) dom 98.17
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 98.16
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 98.16
PF07686114 V-set: Immunoglobulin V-set domain; InterPro: IPR0 98.14
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 98.14
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 98.13
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 98.13
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 98.12
KOG4258|consensus1025 98.11
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 98.11
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 98.11
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 98.1
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 98.1
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 98.1
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 98.09
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 98.09
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 98.09
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 98.09
cd0571194 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of 98.08
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 98.08
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 98.06
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 98.06
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 98.06
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 98.06
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 98.05
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 98.03
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 98.03
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 98.03
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 98.02
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 98.02
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 98.02
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 98.01
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 98.01
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 98.01
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 98.01
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 97.99
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 97.97
cd07700107 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD 97.96
cd0770583 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain 97.96
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 97.94
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 97.93
cd04981117 IgV_H Immunoglobulin (Ig) heavy chain (H), variabl 97.93
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 97.91
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 97.91
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 97.91
KOG3515|consensus741 97.91
cd0588483 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain 97.9
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 97.88
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 97.88
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 97.86
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 97.86
cd0577093 IgC_beta2m Class I major histocompatibility comple 97.84
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.84
PHA03376221 BARF1; Provisional 97.84
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 97.83
cd0576794 IgC_MHC_II_alpha Class II major histocompatibility 97.81
cd0584794 IgC_CH2_IgE CH2 domain (second constant Ig domain 97.8
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 97.8
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 97.79
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 97.79
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 97.78
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 97.78
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 97.76
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 97.75
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 97.75
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 97.75
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 97.75
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 97.75
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 97.74
PHA02987189 Ig domain OX-2-like protein; Provisional 97.73
KOG4802|consensus516 97.73
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 97.72
cd05720104 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD 97.72
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 97.72
cd07699100 IgC_L Immunoglobulin Constant domain. IgC_L: Immun 97.71
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 97.71
smart0040775 IGc1 Immunoglobulin C-Type. 97.71
cd0006393 FN3 Fibronectin type 3 domain; One of three types 97.7
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 97.7
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 97.68
cd05768102 IgC_CH4 CH4 domain (fourth constant Ig domain of t 97.66
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 97.64
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 97.64
cd05772111 IgC_SIRP Signal-regulatory protein (SIRP) immunogl 97.62
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 97.62
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 97.62
cd0576694 IgC_MHC_II_beta Class II major histocompatibility 97.61
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 97.6
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 97.58
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 97.58
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 97.57
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 97.57
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 97.57
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 97.54
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 97.54
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 97.53
cd0769488 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. 97.52
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 97.52
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 97.48
PHA03376221 BARF1; Provisional 97.44
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 97.38
PF0765483 C1-set: Immunoglobulin C1-set domain; InterPro: IP 97.36
smart0040681 IGv Immunoglobulin V-Type. 97.35
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 97.35
cd0769796 IgC_TCR_gamma T cell receptor (TCR) gamma chain co 97.34
cd0769696 IgC_CH3 CH3 domain (third constant Ig domain of th 97.3
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 97.3
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 97.29
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 97.28
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 97.27
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 97.21
cd05769115 IgC_TCR_beta T cell receptor (TCR) beta chain cons 97.21
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 97.2
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.2
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 97.17
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.17
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 97.16
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 97.02
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 96.9
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 96.9
cd0498595 IgC_CH1 CH1 domain (first constant Ig domain of th 96.87
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 96.81
KOG3632|consensus 1335 96.75
smart0040863 IGc2 Immunoglobulin C-2 Type. 96.68
KOG4152|consensus830 96.65
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 96.64
cd0571995 Ig2_PVR_like Second immunoglobulin (Ig) domain of 96.62
cd05721115 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic 96.57
cd0498699 IgC_CH2 CH2 domain (second constant Ig domain of t 96.57
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 96.55
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 96.51
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 96.5
KOG4367|consensus699 96.46
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 96.44
cd0770395 Ig2_Nectin-2_like Second immunoglobulin (Ig) domai 96.33
KOG1480|consensus 909 96.31
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 96.26
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 96.21
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 96.14
KOG0613|consensus 1205 96.11
cd0768999 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain 95.99
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 95.87
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 95.82
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 95.81
smart0040986 IG Immunoglobulin. 95.8
smart0041086 IG_like Immunoglobulin like. IG domains that canno 95.8
COG3401343 Fibronectin type 3 domain-containing protein [Gene 95.75
KOG0613|consensus 1205 95.74
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 95.67
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 95.61
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 95.57
PHA03269566 envelope glycoprotein C; Provisional 95.56
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 95.49
PF0004764 ig: Immunoglobulin domain The Prosite family only 95.45
PHA03271490 envelope glycoprotein C; Provisional 95.44
PHA0263363 hypothetical protein; Provisional 95.26
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 95.24
cd0770497 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) dom 95.16
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 95.15
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 95.06
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 95.0
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 94.91
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 94.81
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 94.78
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 94.7
PHA03270466 envelope glycoprotein C; Provisional 94.59
KOG4597|consensus560 94.52
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 94.5
PHA03273486 envelope glycoprotein C; Provisional 94.36
KOG4367|consensus 699 94.28
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 94.11
PF09067104 EpoR_lig-bind: Erythropoietin receptor, ligand bin 94.06
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 93.98
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 93.94
KOG4228|consensus 1087 93.8
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 93.67
PHA02982251 hypothetical protein; Provisional 93.64
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 93.49
cd0575982 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like d 93.29
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 93.28
KOG4152|consensus830 93.03
PHA03042286 CD47-like protein; Provisional 92.9
PF11465108 Receptor_2B4: Natural killer cell receptor 2B4; In 92.89
PHA0263363 hypothetical protein; Provisional 92.81
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 92.63
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 92.43
PF0632889 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: 92.39
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 92.35
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 92.25
PF08204130 V-set_CD47: CD47 immunoglobulin-like domain; Inter 92.19
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 92.13
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 91.52
cd0575191 Ig1_LILRB1_like First immunoglobulin (Ig)-like dom 91.4
PHA02865338 MHC-like TNF binding protein; Provisional 91.29
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 91.18
PF0924099 IL6Ra-bind: Interleukin-6 receptor alpha chain, bi 90.92
cd05860101 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of 90.67
COG4733952 Phage-related protein, tail component [Function un 90.26
cd0769893 IgC_MHC_I_alpha3 Class I major histocompatibility 89.75
PLN02533427 probable purple acid phosphatase 89.72
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 89.59
cd05755100 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like do 89.55
cd0769169 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain 89.16
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 88.97
PHA0305269 Hypothetical protein; Provisional 88.84
cd04980106 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa 88.56
cd04983109 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V 88.52
cd00099105 IgV Immunoglobulin variable domain (IgV). IgV: Imm 88.37
COG3401343 Fibronectin type 3 domain-containing protein [Gene 88.03
PF0820589 C2-set_2: CD80-like C2-set immunoglobulin domain ; 87.78
cd0009895 IgC Immunoglobulin Constant domain. IgC: Immunoglo 86.88
PHA02987189 Ig domain OX-2-like protein; Provisional 85.81
PF0683289 BiPBP_C: Penicillin-Binding Protein C-terminus Fam 85.02
cd0009674 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) 84.86
cd0498498 IgV_L_lambda Immunoglobulin (Ig) lambda light chai 84.43
cd0571698 Ig_pIgR Immunoglobulin (Ig)-like domain in the pol 83.18
cd05899110 IgV_TCR_beta Immunoglobulin (Ig) variable (V) doma 82.17
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 81.82
cd05712119 Ig_Siglec_N Immunoglobulin (Ig) domain at the N te 80.62
cd0769265 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of 80.55
PHA02914500 Immunoglobulin-like domain protein; Provisional 80.31
cd0576182 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like 80.24
>KOG3513|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-47  Score=386.14  Aligned_cols=428  Identities=22%  Similarity=0.316  Sum_probs=324.8

Q ss_pred             cEEEeecCC------CeEEecCceEEEec----CCeEEEEEEecCCCCC-CCceEEEeCCCeEEeecceeEeecCCCeEE
Q psy3718           3 NFFFYRGFN------PRILLGRVLLPIGE----SSFHFDPELLNPSFNG-FPPLLLSSAPPEFEIKLRNQTSRRGEPSVL   71 (543)
Q Consensus         3 ~~~~~~~~~------~~~~~~~g~L~I~~----D~G~Y~C~a~n~~g~~-~s~~l~v~~~p~~~~~~~~~~v~~g~~~~l   71 (543)
                      -++|.++.+      ++.++.||+|.|.|    |+|.|+|+|.|.+|.. ..+.|.|..+++|+..|++..+..|+.+.|
T Consensus       457 ~~~W~k~~~~~~~~~r~~i~edGtL~I~n~t~~DaG~YtC~A~N~~G~a~~~~~L~Vkd~tri~~~P~~~~v~~g~~v~l  536 (1051)
T KOG3513|consen  457 KVSWLKGGEKLLQSGRIRILEDGTLEISNVTRSDAGKYTCVAENKLGKAESTGNLIVKDATRITLAPSNTDVKVGESVTL  536 (1051)
T ss_pred             eEEEEcCCcccccCceEEECCCCcEEecccCcccCcEEEEEEEcccCccceEEEEEEecCceEEeccchhhhccCceEEE
Confidence            467766544      55667999999999    9999999999999997 678999999999999999999999999999


Q ss_pred             EEEeeccCC--ceEEEccCCeecCCCCCCceEEeeeecCCCceeeEEEEeeecCCCccEEEEEecccceeeeee-eeccc
Q psy3718          72 QCEAKGEKP--IGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCEIKSQKISSQQMT-YEASG  148 (543)
Q Consensus        72 ~C~~~g~p~--~~i~W~~~~~~i~~~~~~~~~~~~~~~~~~~~~~L~i~~~~~~D~G~Y~C~a~n~~~sv~~~~-~~v~~  148 (543)
                      .|.+..++.  +.+.|.+||.+++............  ..+. +.|+|.|++..|+|.|.|+|+....++.... ..+++
T Consensus       537 ~Ce~shD~~ld~~f~W~~nG~~id~~~~~~~~~~~~--~~~~-g~L~i~nv~l~~~G~Y~C~aqT~~Ds~s~~A~l~V~g  613 (1051)
T KOG3513|consen  537 TCEASHDPSLDITFTWKKNGRPIDFNPDGDHFEIND--GSDS-GRLTIANVSLEDSGKYTCVAQTALDSASARADLLVRG  613 (1051)
T ss_pred             EeecccCCCcceEEEEEECCEEhhccCCCCceEEeC--CcCc-cceEEEeeccccCceEEEEEEEeecchhcccceEEec
Confidence            999998876  6888999999987765443333322  1222 4699999999999999999999644432111 11111


Q ss_pred             ccccceEEEEEEEecccCCCCCCCcEEee-------ecCCCCcceeEeccCcccccccceecccccccc----CCCCccc
Q psy3718         149 LKKKQNYIFYVTASTNIGEGQPSKNVTLS-------PSNRVPARIASFNDNFTATYTEDIKLPCLTVGV----PAPEIIW  217 (543)
Q Consensus       149 l~~~~~y~~~v~a~~~~g~~~~s~~~~~~-------pi~~~~~~~v~~~~~~~~~~~~~~~~~~~~~g~----p~p~~~w  217 (543)
                       .|+..-.+.+..     ....+..+.|+       ||..|   .|+++....+.|....+++....|.    -.++..|
T Consensus       614 -pPgpP~~v~~~~-----i~~t~~~lsW~~g~dn~SpI~~Y---~iq~rt~~~~~W~~v~~vp~~~~~~~sa~vv~L~Pw  684 (1051)
T KOG3513|consen  614 -PPGPPPDVHVDD-----ISDTTARLSWSPGSDNNSPIEKY---TIQFRTPFPGKWKAVTTVPGNITGDESATVVNLSPW  684 (1051)
T ss_pred             -CCCCCCceeEee-----eccceEEEEeecCCCCCCCceEE---eEEecCCCCCcceEeeECCCcccCccceeEEccCCC
Confidence             011100111111     11111222222       89999   9999999999999998888877642    3466788


Q ss_pred             eEEEEEEEEEcCCCCCCCCccE-EEeccCCCCCCCCeeeEEEecCCCeEEEEeeCCCCCCCCcceeEEEEEEEEcCCCCC
Q psy3718         218 KTYHIRIVAENEIGSSEPSDTV-TILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKP  296 (543)
Q Consensus       218 ~~y~~~v~a~n~~G~~~~s~~~-~~~t~~~~p~~~P~~~~~~~~~~~~i~l~W~~~~~~~~~~~i~~y~v~~~~~~~~~~  296 (543)
                      ..|+|||.|.|..|.+++|.+. .++|.+++|...|.++.......+.+.|.|++.....++++..+|+|.|+..+....
T Consensus       685 v~YeFRV~AvN~iG~gePS~pS~~~rT~ea~P~~~P~nv~g~g~~~~eLvItW~Pl~~~~qNG~gfgY~Vswr~~g~~~~  764 (1051)
T KOG3513|consen  685 VEYEFRVVAVNSIGIGEPSPPSEKVRTPEAAPSVNPSNVKGGGGSPTELVITWEPLPEEEQNGPGFGYRVSWRPQGADKE  764 (1051)
T ss_pred             cceEEEEEEEcccccCCCCCCccceecCCCCCccCCccccccCCCCceEEEEeccCCHHHccCCCceEEEEEEeCCCCcc
Confidence            9999999999999999999876 678999999999999999999999999999999888889999999999999998855


Q ss_pred             ceEEEEeeeccCCceeEEEECCCCCCCEEEEEEEEEeCCCCCCCCcceeeeccCCCCCCCCCCcEEEEeccCeEEEEccC
Q psy3718         297 FLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTPEQPPQDNTCTTLTSQTIRVSWVS  376 (543)
Q Consensus       297 ~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~n~~G~s~~s~~~~~~t~~~~p~~~P~~~~~~~~~~~~v~l~W~~  376 (543)
                      |....+.  .......-+......|++.|+++|+|+|..|.|+.+....+.+.++.|..+|..+.+...+.+.+.|.|++
T Consensus       765 W~~~~v~--~~d~~~~V~~~~st~~~tpyevKVqa~N~~GeGp~s~~~v~~S~Ed~P~~ap~~~~~~~~s~s~~~v~W~~  842 (1051)
T KOG3513|consen  765 WKEVIVS--NQDQPRYVVSNESTEPFTPYEVKVQAINDQGEGPESQVTVGYSGEDEPPVAPTKLSAKPLSSSEVNLSWKP  842 (1051)
T ss_pred             cceeEec--ccCCceEEEcCCCCCCcceeEEEEEEecCCCCCCCCceEEEEcCCCCCCCCCccceeecccCceEEEEecC
Confidence            5544442  11122333344556779999999999999999999999999999999999999999999999999999998


Q ss_pred             CCCCCCCCceEEEEEEEEeCCcccCCCCCCccceEEEEeeCCCCCCCCcceeEEEEEEeeCCCCCCCCCccceeeeeCCC
Q psy3718         377 PPLITANGVIKGYKVVYGPSDTWYGDPKTDICTDIRASWVSPPLITANGVIKGYKVVYGPSDTWYGHPGSFRNHCTWDPR  456 (543)
Q Consensus       377 p~~~~~~~~i~~Y~v~~~~~~~~~~~~~~~~~~~~~l~W~~p~~~~~~g~i~~Y~i~~~~~~~~~~~~~~~~~~~~~~~~  456 (543)
                      |.                                           ..||.+++|.|+|+..+..++......   ..-+.
T Consensus       843 ~~-------------------------------------------~~nG~l~gY~v~Y~~~~~~~~~~~~~~---i~~~~  876 (1051)
T KOG3513|consen  843 PL-------------------------------------------WDNGKLTGYEVKYWKINEKEGSLSRVQ---IAGNR  876 (1051)
T ss_pred             cC-------------------------------------------ccCCccceeEEEEEEcCCCccccccee---ecCCc
Confidence            73                                           234566666666666554311111111   11233


Q ss_pred             CccccccccCc-eeeEEEEeCCCCCCCCCCccccccccccCCCcccccc
Q psy3718         457 GRNMYEELKSQ-GRGYLVPRGGPPPCPGSDETLYSRHRGESDKCKNDRV  504 (543)
Q Consensus       457 ~~~~~~~L~p~-~Y~~~v~A~~~~~~~~~~~~~~~~~~G~g~~~~~~~v  504 (543)
                      ....++||+|. .|.|.|+|              .|.+|.|+.+....+
T Consensus       877 ~~~~ltgL~~~T~Y~~~vrA--------------~nsaG~Gp~s~~~~~  911 (1051)
T KOG3513|consen  877 TSWRLTGLEPNTKYRFYVRA--------------YTSAGGGPASSEENV  911 (1051)
T ss_pred             ceEeeeCCCCCceEEEEEEE--------------ecCCCCCCCccceec
Confidence            33455599999 99999999              999998888665555



>KOG4221|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>PF07686 V-set: Immunoglobulin V-set domain; InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain Back     alignment and domain information
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>KOG3515|consensus Back     alignment and domain information
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE) Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd07699 IgC_L Immunoglobulin Constant domain Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>smart00407 IGc1 Immunoglobulin C-Type Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>PF07654 C1-set: Immunoglobulin C1-set domain; InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>smart00406 IGv Immunoglobulin V-Type Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain Back     alignment and domain information
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) Back     alignment and domain information
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins Back     alignment and domain information
>KOG1480|consensus Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>KOG0613|consensus Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PHA03269 envelope glycoprotein C; Provisional Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>PHA03271 envelope glycoprotein C; Provisional Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>PHA03270 envelope glycoprotein C; Provisional Back     alignment and domain information
>KOG4597|consensus Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>PHA03273 envelope glycoprotein C; Provisional Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>KOG4228|consensus Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>PHA02982 hypothetical protein; Provisional Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PHA03042 CD47-like protein; Provisional Back     alignment and domain information
>PF11465 Receptor_2B4: Natural killer cell receptor 2B4; InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>PF06328 Lep_receptor_Ig: Ig-like C2-type domain; InterPro: IPR010457 This entry represents a ligand-binding domain that displays similarity to C2-set immunoglobulin domains (antibody constant domain 2) [] Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>PF08204 V-set_CD47: CD47 immunoglobulin-like domain; InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ] Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins Back     alignment and domain information
>PHA02865 MHC-like TNF binding protein; Provisional Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology Back     alignment and domain information
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins Back     alignment and domain information
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PHA03052 Hypothetical protein; Provisional Back     alignment and domain information
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain Back     alignment and domain information
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins Back     alignment and domain information
>cd00099 IgV Immunoglobulin variable domain (IgV) Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF08205 C2-set_2: CD80-like C2-set immunoglobulin domain ; InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd00098 IgC Immunoglobulin Constant domain Back     alignment and domain information
>PHA02987 Ig domain OX-2-like protein; Provisional Back     alignment and domain information
>PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) Back     alignment and domain information
>cd00096 Ig Immunoglobulin domain Back     alignment and domain information
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain Back     alignment and domain information
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR) Back     alignment and domain information
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins) Back     alignment and domain information
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain Back     alignment and domain information
>PHA02914 Immunoglobulin-like domain protein; Provisional Back     alignment and domain information
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
1va9_A122 Solution Structure Of The Second Fniii Domain Of Ds 7e-17
1va9_A122 Solution Structure Of The Second Fniii Domain Of Ds 4e-05
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 4e-12
2edx_A134 Solution Structures Of The Fn3 Domain Of Human Rece 3e-07
2ed9_A124 Solution Structure Of The Third Fibronectin Type Ii 1e-08
2ed9_A124 Solution Structure Of The Third Fibronectin Type Ii 1e-06
1cfb_A205 Crystal Structure Of Tandem Type Iii Fibronectin Do 2e-06
3lpw_A197 Crystal Structure Of The Fniii-Tandem A77-A78 From 2e-06
2dlh_A121 Solution Structure Of The Second Fn3 Domain Of Huma 4e-06
1x5g_A116 The Solution Structure Of The Second Fibronectin Ty 4e-06
1x5h_A132 The Solution Structure Of The Third Fibronectin Typ 5e-06
2jll_A389 Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 2e-05
2xyc_A291 Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 2e-05
1u2h_A99 X-Ray Structure Of The N-Terminally Truncated Human 3e-05
2rjm_A284 3ig Structure Of Titin Domains I67-I69 E-To-A Mutat 2e-04
2edw_A107 Solution Structure Of The I-Set Domain (3537-3630) 2e-04
2rik_A284 I-Band Fragment I67-I69 From Titin Length = 284 2e-04
1x5k_A124 The Solution Structure Of The Sixth Fibronectin Typ 4e-04
3pxj_A210 Tandem Ig Repeats Of Dlar Length = 210 5e-04
3b43_A570 I-band Fragment I65-i70 From Titin Length = 570 7e-04
>pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 Back     alignment and structure

Iteration: 1

Score = 85.5 bits (210), Expect = 7e-17, Method: Compositional matrix adjust. Identities = 43/111 (38%), Positives = 62/111 (55%), Gaps = 1/111 (0%) Query: 243 TAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDKPFLFETV 302 T E AP GPP + ++ +++V+W P+++ NGVI+GY +GY+E S + V Sbjct: 10 TEEAAPDGPPMDVTLQPVTSQSIQVTWKAPKKELQNGVIRGYQIGYRENSPGSNGQYSIV 69 Query: 303 DFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTP 353 + K G TL +LK + QY VVVQA N+ G GP S E+ T E P Sbjct: 70 EM-KATGDSEVYTLDNLKKFAQYGVVVQAFNRAGTGPSSSEINATTLESGP 119
>pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 Back     alignment and structure
>pdb|2ED9|A Chain A, Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 124 Back     alignment and structure
>pdb|2ED9|A Chain A, Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 124 Back     alignment and structure
>pdb|1CFB|A Chain A, Crystal Structure Of Tandem Type Iii Fibronectin Domains From Drosophila Neuroglian At 2.0 Angstroms Length = 205 Back     alignment and structure
>pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 Back     alignment and structure
>pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 Back     alignment and structure
>pdb|1X5G|A Chain A, The Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Neogenin Length = 116 Back     alignment and structure
>pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 Back     alignment and structure
>pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 Back     alignment and structure
>pdb|2XYC|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3i Length = 291 Back     alignment and structure
>pdb|1U2H|A Chain A, X-Ray Structure Of The N-Terminally Truncated Human Apep-1 Length = 99 Back     alignment and structure
>pdb|2RJM|A Chain A, 3ig Structure Of Titin Domains I67-I69 E-To-A Mutated Variant Length = 284 Back     alignment and structure
>pdb|2EDW|A Chain A, Solution Structure Of The I-Set Domain (3537-3630) Of Human Obscurin Length = 107 Back     alignment and structure
>pdb|2RIK|A Chain A, I-Band Fragment I67-I69 From Titin Length = 284 Back     alignment and structure
>pdb|1X5K|A Chain A, The Solution Structure Of The Sixth Fibronectin Type Iii Domain Of Human Neogenin Length = 124 Back     alignment and structure
>pdb|3PXJ|A Chain A, Tandem Ig Repeats Of Dlar Length = 210 Back     alignment and structure
>pdb|3B43|A Chain A, I-band Fragment I65-i70 From Titin Length = 570 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query543
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 3e-55
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-34
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 8e-24
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-19
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 8e-44
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 2e-23
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 3e-19
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 1e-41
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 9e-23
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 3e-38
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-17
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 1e-07
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 6e-38
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 1e-13
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 6e-38
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 5e-17
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-37
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 6e-32
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-14
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 5e-07
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 6e-37
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 1e-22
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-36
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-33
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-23
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 4e-19
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 6e-04
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 3e-35
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 5e-30
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-21
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-19
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 1e-34
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 9e-20
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 9e-34
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-29
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 4e-22
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-33
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 5e-31
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 5e-06
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 7e-05
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-33
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-32
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 4e-08
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 9e-07
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-33
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-14
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 7e-33
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 2e-14
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 9e-33
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-20
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 1e-13
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-32
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 5e-23
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 4e-07
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-32
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-22
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 9e-18
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 3e-31
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 6e-08
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 9e-31
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 5e-04
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 3e-30
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-10
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 5e-30
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 4e-12
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 6e-30
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-15
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 4e-29
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 3e-14
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 5e-29
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 1e-22
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 2e-06
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 9e-29
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 1e-21
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 7e-15
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 7e-14
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 2e-27
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 3e-11
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-06
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 2e-04
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 8e-27
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 1e-10
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 8e-07
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 1e-26
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 1e-11
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 5e-05
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 2e-26
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-20
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 3e-26
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 2e-11
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 3e-26
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 2e-10
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 7e-08
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-25
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 3e-25
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 6e-04
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 4e-25
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-08
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 5e-06
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 1e-04
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 4e-24
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-07
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 9e-07
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 1e-04
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 4e-24
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 3e-13
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 4e-24
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 2e-08
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 5e-05
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 5e-24
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 6e-07
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 1e-05
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 2e-05
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-23
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 5e-07
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 5e-04
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 9e-04
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-23
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-20
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 2e-20
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 4e-06
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 2e-22
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 3e-08
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 1e-04
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 2e-04
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 7e-22
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 1e-06
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 3e-04
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 1e-21
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 1e-05
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 1e-05
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-21
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 2e-05
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 6e-21
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 4e-07
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 7e-04
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 2e-20
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 3e-05
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 3e-20
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 5e-06
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 4e-20
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 1e-04
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 5e-04
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 1e-19
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 8e-07
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 2e-19
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-17
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 3e-19
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 6e-06
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 3e-19
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 2e-07
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 7e-04
3t04_D103 Monobody 7C12; engineered binding protein, antibod 9e-19
3t04_D103 Monobody 7C12; engineered binding protein, antibod 1e-06
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 5e-18
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 3e-17
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-09
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 1e-17
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 9e-16
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 2e-17
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-17
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-06
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 1e-16
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 8e-06
1x4x_A106 Fibronectin type-III domain containing protein 3A; 3e-16
1x4x_A106 Fibronectin type-III domain containing protein 3A; 1e-04
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 3e-16
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 5e-16
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 4e-05
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 7e-16
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 5e-12
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 5e-11
3k2m_C101 Monobody HA4; engineered binding protein, antibody 1e-15
3k2m_C101 Monobody HA4; engineered binding protein, antibody 4e-05
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 1e-15
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 6e-15
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 2e-10
1x3d_A118 Fibronectin type-III domain containing protein 3A; 1e-15
1x3d_A118 Fibronectin type-III domain containing protein 3A; 6e-06
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-15
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 2e-14
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 8e-14
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 9e-13
3b43_A570 Titin; I-SET IG fold, extended poly-IG filament, e 1e-11
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 2e-15
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 4e-13
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 2e-15
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-14
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 7e-09
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 3e-08
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 3e-15
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-04
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 6e-15
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 2e-04
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 8e-15
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 5e-10
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 1e-14
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 1e-14
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 5e-06
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 1e-14
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-06
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 2e-14
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 4e-04
2crm_A120 Fibronectin type-III domain containing protein 3A; 2e-14
2crm_A120 Fibronectin type-III domain containing protein 3A; 8e-05
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 3e-14
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 1e-07
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 5e-14
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 1e-06
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 7e-14
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 5e-11
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 1e-13
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 2e-04
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 1e-13
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 5e-09
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 1e-13
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-04
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 2e-13
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 6e-13
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 3e-09
2crz_A110 Fibronectin type-III domain containing protein 3A; 2e-13
2crz_A110 Fibronectin type-III domain containing protein 3A; 3e-05
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 2e-13
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 2e-08
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 2e-13
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 2e-13
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 4e-09
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 2e-13
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 4e-04
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 2e-13
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 5e-11
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-13
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 1e-04
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 3e-13
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 4e-13
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 4e-13
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 6e-10
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 5e-13
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 2e-07
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 5e-13
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 5e-13
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 3e-07
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 7e-06
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-13
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 5e-11
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 6e-13
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 1e-11
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 5e-10
3se4_A 414 Interferon alpha/beta receptor 1; type I interfero 7e-07
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 6e-13
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 4e-04
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 6e-13
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 2e-04
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 6e-13
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 7e-13
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 2e-12
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 2e-12
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-12
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-11
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 2e-06
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 2e-12
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 8e-10
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-12
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-10
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-10
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-10
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 9e-08
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 2e-07
3dmk_A816 DOWN syndrome cell adhesion molecule (dscam) ISOF 5e-06
3dmk_A 816 DOWN syndrome cell adhesion molecule (dscam) ISOF 3e-04
1x5x_A109 Fibronectin type-III domain containing protein 3A; 3e-12
1x5x_A109 Fibronectin type-III domain containing protein 3A; 7e-05
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 4e-12
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 1e-09
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 4e-12
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 4e-12
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 3e-09
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 6e-12
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 6e-12
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 9e-11
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 5e-08
3v2a_R 772 Vascular endothelial growth factor receptor 2; IG- 5e-06
3v2a_R772 Vascular endothelial growth factor receptor 2; IG- 4e-05
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 6e-12
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 1e-08
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 6e-12
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 2e-11
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 2e-11
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 3e-11
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 5e-07
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 1e-06
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 4e-11
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 4e-11
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 3e-04
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 4e-11
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 4e-11
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 1e-05
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 6e-11
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-09
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 2e-09
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 3e-07
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 6e-11
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 6e-11
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 7e-11
2v9t_A117 Roundabout homolog 1; structural protein-receptor 8e-11
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 1e-10
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 1e-10
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 4e-08
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 2e-07
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 8e-06
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 2e-10
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 1e-06
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 5e-06
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 7e-05
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 2e-10
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 2e-10
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 2e-10
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 2e-10
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 3e-10
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 5e-06
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 4e-10
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 3e-05
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 4e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 5e-10
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-07
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 2e-05
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 5e-10
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 5e-10
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 3e-04
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 5e-10
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 5e-10
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 6e-10
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 6e-06
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 7e-10
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 7e-10
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 7e-10
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 8e-10
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 8e-10
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 1e-09
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 3e-09
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 4e-08
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 6e-06
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 1e-09
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 4e-09
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 2e-08
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 9e-06
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 1e-09
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 9e-08
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 1e-09
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 5e-06
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 1e-09
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 1e-09
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 1e-09
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 4e-07
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 2e-09
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 2e-09
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-09
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 2e-09
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 3e-08
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 3e-09
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 5e-07
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 3e-09
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 4e-09
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 2e-07
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 5e-09
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 1e-07
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 5e-05
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 5e-09
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 6e-09
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 3e-05
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 7e-09
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 9e-09
1waa_A93 Titin; metal binding protein, calmodulin-binding, 9e-09
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 9e-09
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 1e-05
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 1e-08
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 1e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 1e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-08
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 2e-07
1e07_A642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-07
1e07_A 642 Carcinoembryonic antigen; glycoprotein, CEA, tumou 3e-06
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 1e-08
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 1e-08
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 7e-08
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 4e-07
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 2e-04
2ec8_A524 MAST/stem cell growth factor receptor; glycoprotei 4e-04
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 1e-08
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 4e-04
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 2e-08
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 1e-07
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 5e-05
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 2e-08
3mjg_X289 Beta-type platelet-derived growth factor receptor; 2e-08
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 2e-08
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 2e-08
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 2e-08
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 3e-08
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 4e-08
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 2e-05
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 3e-08
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 1e-06
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 3e-08
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 9e-05
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 4e-08
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 2e-06
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 4e-08
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 1e-07
2gys_A419 Cytokine receptor common beta chain; dimer of inte 4e-08
2gys_A419 Cytokine receptor common beta chain; dimer of inte 3e-07
2gys_A419 Cytokine receptor common beta chain; dimer of inte 5e-06
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 4e-08
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 4e-08
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 3e-05
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 2e-04
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 5e-08
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 1e-07
2ch8_A201 BARF1, P33, 33 kDa early protein; viral protein, i 5e-08
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 5e-08
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 6e-08
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 6e-08
2erj_C247 Cytokine receptor common gamma chain; immune syste 7e-08
2erj_C247 Cytokine receptor common gamma chain; immune syste 5e-07
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 7e-08
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 9e-08
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 1e-07
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 2e-07
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 1e-07
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 4e-07
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-07
1eer_B227 Epobp, erythropoietin receptor; signal transductio 1e-05
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 3e-07
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 3e-07
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 3e-07
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 1e-06
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 4e-07
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 4e-07
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 4e-07
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 5e-07
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 6e-07
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 6e-04
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 6e-07
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 6e-06
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 6e-07
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 1e-06
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 1e-06
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 1e-04
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 2e-06
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 3e-04
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 3e-04
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 2e-06
2ens_A96 Advanced glycosylation END product-specific recept 2e-06
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 3e-06
1nn8_R302 CD155 antigen, poliovirus receptor; icosahedral vi 3e-06
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 6e-06
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 6e-06
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 1e-04
1wio_A363 CD4, T-cell surface glycoprotein CD4; immunoglobul 9e-06
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 1e-05
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 1e-05
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 1e-05
3oq3_B329 IFN-alpha/beta binding protein C12R; mousepox viru 2e-05
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 2e-05
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 2e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 3e-05
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 3e-05
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 3e-05
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 3e-05
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 5e-05
1z7z_I450 Intercellular adhesion molecule-1; ICAM-1,kilifi,C 6e-04
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 5e-05
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 6e-05
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 9e-05
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 1e-04
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 1e-04
3rjd_A262 High affinity immunoglobulin gamma FC receptor I; 2e-04
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 2e-04
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 3e-04
1gl4_B98 Basement membrane-specific heparan sulfate proteog 3e-04
2fbo_J250 V1V2;, variable region-containing chitin-binding p 4e-04
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 6e-04
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 8e-04
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
 Score =  197 bits (501), Expect = 3e-55
 Identities = 54/353 (15%), Positives = 105/353 (29%), Gaps = 26/353 (7%)

Query: 56  IKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDL 115
           ++++N     G+ +  QC A G    G    +    +         +         ++  
Sbjct: 169 LRIQNVEVNAGQFATFQCSAIGRTVAGDRLWLQGIDVRDAPLKEIKVTSS---RRFIASF 225

Query: 116 SIKRTERGDSALFTCEIKSQ--KISSQQMTYEASGLKKKQNYIFYVTASTNIGEGQPSKN 173
           ++  T + D+  + C I+++     S                    +             
Sbjct: 226 NVVNTTKRDAGKYRCMIRTEGGVGISNYAELVVKEPPVPIAPPQLASVGAT------YLW 279

Query: 174 VTLSPSNRVPARIASFNDNFTATYTEDIKLPCLTVGVPAPEII------WKTYHIRIVAE 227
           + L+ +                 Y            V +             Y I ++  
Sbjct: 280 IQLNAN---SINGDGPIVAREVEYCTASGSWNDRQPVDSTSYKIGHLDPDTEYEISVLLT 336

Query: 228 N--EIGSSEPSDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYY 285
              E G+  P   +   T    P   P  ++V       + + W P   +          
Sbjct: 337 RPGEGGTGSPGPALRTRTKCADPMRGPRKLEVVEVKSRQITIRWEPFGYNVTRCHSYNLT 396

Query: 286 VGYKETSTDKPFLFETVDFSKEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVK 345
           V Y      +  + E V +  E     H T+++L  YT  SV +  +N  G    S+E+ 
Sbjct: 397 VHYCYQVGGQEQVREEVSWDTENSHPQH-TITNLSPYTNVSVKLILMNPEGRKE-SQELI 454

Query: 346 QYTAEGTPEQPPQDNTCTTLTSQTIRVSWVSPPLITANGVIKGYKVVYGPSDT 398
             T E  P   P ++   +   + I + W  P      GVI  Y++ Y    +
Sbjct: 455 VQTDEDLPGAVPTESIQGSTFEEKIFLQWREPT--QTYGVITLYEITYKAVSS 505


>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Length = 122 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Length = 284 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} Length = 570 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Length = 403 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Length = 189 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Length = 212 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Length = 291 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Length = 192 Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Length = 182 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Length = 191 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Length = 194 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Length = 197 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Length = 304 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Length = 197 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Length = 291 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Length = 212 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} Length = 816 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Length = 212 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R Length = 772 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Length = 217 Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Length = 317 Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Length = 201 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Length = 395 Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Length = 106 Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 114 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Length = 382 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Length = 388 Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 103 Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Length = 218 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Length = 241 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Length = 527 Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Length = 99 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Length = 103 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} Length = 108 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Length = 404 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Length = 384 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Length = 190 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Length = 231 Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Length = 212 Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Length = 108 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Length = 423 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} Length = 289 Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Length = 103 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Length = 93 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A Length = 642 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* Length = 524 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 334 Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Length = 99 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Length = 289 Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Length = 106 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Length = 93 Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Length = 154 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Length = 292 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Length = 212 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Length = 312 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 Back     alignment and structure
>2ch8_A BARF1, P33, 33 kDa early protein; viral protein, immunoglobulin domain, oncogene; HET: NAG MAN; 2.3A {Epstein-barr virus} Length = 201 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Length = 184 Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 104 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Length = 100 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Length = 195 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Length = 209 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Length = 97 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Length = 184 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Length = 339 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Length = 95 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Length = 100 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Length = 315 Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Length = 137 Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 113 Back     alignment and structure
>1nn8_R CD155 antigen, poliovirus receptor; icosahedral virus, picornavirus, virus/receptor complex; 15.00A {Homo sapiens} SCOP: i.6.1.1 PDB: 1dgi_R Length = 302 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Length = 290 Back     alignment and structure
>1wio_A CD4, T-cell surface glycoprotein CD4; immunoglobulin fold, transmembrane, MHC lipoprotein, polymorphism; 3.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.1 b.1.1.3 b.1.1.3 PDB: 1wip_A 1wiq_A 3t0e_E Length = 363 Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Length = 112 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 Back     alignment and structure
>3oq3_B IFN-alpha/beta binding protein C12R; mousepox virus, moscow strain, cytokine decoy RE virus/viral protein, type-1 interferon, soluble A/B-IFNR; HET: EPE; 2.10A {Ectromelia virus} Length = 329 Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Length = 91 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Length = 208 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Length = 202 Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Length = 226 Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Length = 126 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1z7z_I Intercellular adhesion molecule-1; ICAM-1,kilifi,CD54,human coxsackievirus A21, cryo-electron microscopy,virus-receptor complex, icosahedral virus; HET: NAG NDG; 8.00A {Homo sapiens} SCOP: b.1.1.3 b.1.1.3 b.1.1.4 b.1.1.4 b.1.1.4 Length = 450 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Length = 207 Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 3sku_E* 2l7j_A Length = 331 Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Length = 108 Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Length = 265 Back     alignment and structure
>3rjd_A High affinity immunoglobulin gamma FC receptor I; immune system; HET: NAG MAN FUC P33; 2.65A {Homo sapiens} Length = 262 Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Length = 98 Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Length = 250 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Length = 229 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 543
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-20
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 4e-06
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 4e-04
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-20
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 1e-06
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 2e-04
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 4e-20
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 8e-06
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 0.002
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 3e-15
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 8e-04
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 0.004
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 3e-15
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 0.004
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 3e-15
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 0.003
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 9e-15
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 6e-04
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 0.003
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 5e-14
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 3e-13
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 4e-04
d1cfba2105 b.1.2.1 (A:710-814) Neuroglian, two amino proximal 4e-13
d1x4ya1101 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { 2e-12
d2cspa1117 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho 6e-12
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 1e-11
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 8e-04
d1wj3a_117 b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s 3e-11
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 4e-11
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 5e-11
d1wk0a_137 b.1.2.1 (A:) Fibronectin type-III domain containin 0.003
d1ujta_120 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 8e-11
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 2e-10
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 9e-04
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 2e-10
d1x5ya198 b.1.2.1 (A:8-105) Myosin binding protein C, fast-t 0.004
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 3e-10
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 7e-04
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 3e-10
d1x5ja1100 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ 4e-10
d1x5aa194 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse 4e-10
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 9e-10
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 0.002
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 9e-10
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 3e-08
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 1e-09
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 1e-09
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 3e-09
d1qg3a2103 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum 4e-09
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 4e-09
d2crma1107 b.1.2.1 (A:8-114) Fibronectin type-III domain cont 1e-08
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 2e-08
d1tdqa292 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu 3e-08
d1fnaa_91 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 3e-08
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 4e-08
d2djsa195 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human 0.001
d1qg3a192 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum 5e-08
d2ibga195 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit 5e-08
d1wisa1111 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) 8e-08
d1fnfa291 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m 9e-08
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 1e-07
d1ueya_127 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 3e-05
d1fnfa194 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m 1e-07
d1iarb2101 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch 2e-07
d1x5xa196 b.1.2.1 (A:8-103) Fibronectin type-III domain cont 2e-07
d1n26a3104 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c 5e-07
d1wfua_120 b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat 6e-07
d2b5ib2104 b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch 9e-07
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 2e-06
d1bqua2115 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki 3e-04
d1qr4a288 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu 2e-06
d1j8ka_94 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 2e-06
d1fnha389 b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod 3e-06
d2ic2a1107 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit 3e-06
d1x4xa193 b.1.2.1 (A:8-100) Fibronectin type-III domain cont 3e-06
d1biha489 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecr 4e-06
d1qr4a187 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) 5e-06
d1cfba1100 b.1.2.1 (A:610-709) Neuroglian, two amino proximal 5e-06
d1fnha190 b.1.2.1 (A:3-92) Fibronectin, different Fn3 module 7e-06
d1g1ca_98 b.1.1.4 (A:) Titin {Human (Homo sapiens), differen 7e-06
d2cuma193 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) 9e-06
d2gysa2114 b.1.2.1 (A:104-217) Common beta-chain in the GM-CS 9e-06
d2cqva1101 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [T 1e-05
d1bpva_104 b.1.2.1 (A:) Type I titin module {Human (Homo sapi 2e-05
d1tena_90 b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId 2e-05
d1bqua195 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- 3e-05
d1tdqa193 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) 3e-05
d1koaa197 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorha 6e-05
d1qz1a3100 b.1.1.4 (A:190-289) Neural cell adhesion molecule 6e-05
d1tdqa386 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic 8e-05
d1fhga_102 b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) 8e-05
d3b5ha1101 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo 9e-05
d1x44a190 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-ty 1e-04
d2fdbp2109 b.1.1.4 (P:2252-2360) Fibroblast growth factor rec 3e-04
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 3e-04
d2avga1110 b.1.1.4 (A:1-110) Cardiac myosin binding protein C 3e-04
d1nbqa2104 b.1.1.4 (A:130-233) Junction adhesion molecule, JA 3e-04
d2haza1101 b.1.2.1 (A:489-589) Neural cell adhesion molecule 5e-04
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 5e-04
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 5e-04
d1fnha290 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu 6e-04
d2cuha1102 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) 8e-04
d1iama1103 b.1.1.3 (A:83-185) Intercellular cell adhesion mol 0.001
d1cs6a489 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gall 0.001
d2c9aa196 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein 0.001
d1cd9b1107 b.1.2.1 (B:1-107) Granulocyte colony-stimulating f 0.001
d1v5ja_108 b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId 0.002
d1uc6a_109 b.1.2.1 (A:) Ciliary neurotrophic factor receptor 0.002
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 0.002
d2vkwa293 b.1.2.1 (A:601-693) Neural cell adhesion molecule 0.003
d2aw2a1104 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator 0.003
d1k85a_88 b.1.2.1 (A:) Fibronectin type III domain from chit 0.003
d2cuia1101 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) 0.003
d3d85d394 b.1.2.1 (D:212-305) The p40 domain of interleukin- 0.003
d1owwa_93 b.1.2.1 (A:) Fibronectin, different Fn3 modules {H 0.004
d1zxqa1106 b.1.1.3 (A:87-192) Intercellular cell adhesion mol 0.004
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Fibronectin type III
family: Fibronectin type III
domain: KIAA0343 protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 85.3 bits (210), Expect = 1e-20
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 236 SDTVTILTAEEAPSGPPTHIKVEATDQNTLKVSWSPPERDHWNGVIQGYYVGYKETSTDK 295
           S   +  + E+ P   P +++V   +    +V W P       G +QGY + Y +T +  
Sbjct: 2   SSGSSGHSGEDLPMVAPGNVRVNVVNSTLAEVHWDPVPLKSIRGHLQGYRIYYWKTQSSS 61

Query: 296 PFLFETVDFS--KEEGKEHHLTLSSLKTYTQYSVVVQALNKLGPGPMSEEVKQYTAEGTP 353
                 ++      +G + H  L  L+ ++ Y++ V+ +N  G GP S +    T EG+ 
Sbjct: 62  KRNRRHIEKKILTFQGSKTHGMLPGLEPFSHYTLNVRVVNGKGEGPASPDRVFNTPEGSG 121


>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Length = 89 Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 97 Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 100 Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Length = 102 Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Length = 110 Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 89 Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query543
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.62
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.62
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 99.61
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 99.6
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 99.59
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.59
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 99.57
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.56
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.56
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 99.56
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.56
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 99.56
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.54
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.53
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 99.53
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.52
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 99.52
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 99.51
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.51
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.5
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 99.49
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 99.48
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 99.47
d2avga1110 Cardiac myosin binding protein C, different domain 99.46
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 99.46
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 99.46
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 99.45
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.45
d2ifga192 High affinity nerve growth factor receptor TrkA, d 99.45
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.43
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.43
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.43
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.43
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 99.42
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 99.42
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1gxea_130 Cardiac myosin binding protein C, different domain 99.41
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.41
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.41
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.41
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 99.41
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 99.4
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 99.4
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.39
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 99.38
d1pd6a_94 Cardiac myosin binding protein C, different domain 99.38
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 99.38
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.38
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 99.38
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 99.38
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.37
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.37
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.37
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.36
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 99.36
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 99.36
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.36
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 99.35
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 99.35
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 99.35
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.35
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.35
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 99.34
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 99.34
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.33
d2crza197 Fibronectin type-III domain containing protein 3a, 99.33
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.33
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.33
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.33
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.33
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.33
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.32
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 99.3
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.3
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.3
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.3
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 99.28
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.28
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.28
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 99.27
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.27
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.26
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.26
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.26
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 99.25
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.25
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.25
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 99.25
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.25
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.24
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.24
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.24
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.23
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.22
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 99.22
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 99.22
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.22
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 99.21
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 99.21
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 99.21
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.2
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.2
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 99.2
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.2
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.19
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.19
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.19
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.18
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 99.17
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 99.17
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.17
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 99.17
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.17
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.17
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.16
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.16
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.16
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 99.16
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 99.15
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.15
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.15
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.15
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.14
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 99.14
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 99.14
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.14
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 99.14
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.14
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.14
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.14
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 99.13
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.13
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.12
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.12
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.11
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.11
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 99.11
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.11
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.1
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 99.09
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 99.09
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 99.06
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.05
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 99.04
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.04
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.04
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 99.04
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.03
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 99.02
d2crza197 Fibronectin type-III domain containing protein 3a, 99.02
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.02
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.01
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 99.01
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 99.0
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.0
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.99
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.99
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.99
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.98
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 98.97
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.97
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 98.97
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.96
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.96
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.95
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.94
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.93
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.93
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.92
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.92
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.9
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.9
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.9
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.9
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.9
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.88
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.88
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 98.88
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.87
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.84
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.84
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.82
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.8
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.77
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.76
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.74
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.74
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.73
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.72
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.7
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.68
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.68
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.66
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.62
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 98.6
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 98.6
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.59
d1nezg_122 CD8 {Mouse (Mus musculus) [TaxId: 10090]} 98.58
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.57
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.57
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.57
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.57
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.56
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 98.55
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.53
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 98.52
d1k5nb_100 beta2-microglobulin {Human (Homo sapiens) [TaxId: 98.39
d1vesa_113 Novel antigen receptor 12Y-2 {Spotted wobbegong (O 98.39
d1ospl1107 Immunoglobulin light chain kappa variable domain, 98.38
d3bp5a1114 Programmed cell death protein 1, PD1, extracellula 98.35
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.35
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.33
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 98.32
d1muja1100 Class II MHC alpha chain, C-terminal domain {Mouse 98.32
d1i8ka_106 Immunoglobulin light chain kappa variable domain, 98.31
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.31
d1sq2n_112 Novel antigen receptor (against lysozyme) {Nurse s 98.31
d1de4a194 Hemochromatosis protein Hfe, alpha-3 domain {Human 98.3
d2cdea1114 T-cell antigen receptor {Human (Homo sapiens), bet 98.3
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.29
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.29
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 98.29
d1lk2b_99 beta2-microglobulin {Mouse (Mus musculus) [TaxId: 98.28
d1c5cl1107 Immunoglobulin light chain kappa variable domain, 98.28
d2ij0c1118 T-cell antigen receptor {Human (Homo sapiens), bet 98.27
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.26
d1j1pl_107 Immunoglobulin light chain kappa variable domain, 98.26
d2bnqd1113 T-cell antigen receptor {Human (Homo sapiens), alp 98.25
d1lp9e1115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.25
d1tjgl1107 Immunoglobulin light chain kappa variable domain, 98.25
d1a0ql1106 Immunoglobulin light chain kappa variable domain, 98.24
d1tvda_116 T-cell antigen receptor {Human (Homo sapiens), del 98.24
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.24
d2atpb1115 CD8 {Mouse (Mus musculus), beta-chain [TaxId: 1009 98.23
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 98.21
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.2
d1ucta199 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 98.18
d1xeda_116 Polymeric-immunoglobulin receptor, PIGR {Human (Ho 98.18
d1op3k1106 Immunoglobulin light chain kappa variable domain, 98.18
d1lk3l1106 Immunoglobulin light chain kappa variable domain, 98.16
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 98.16
d1jhll_108 Immunoglobulin light chain kappa variable domain, 98.16
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 98.15
d1olla195 Ligand binding domain of NK receptor NKp46 {Human 98.15
d1kcvl1107 Immunoglobulin light chain kappa variable domain, 98.15
d1j8hd1115 T-cell antigen receptor {Human (Homo sapiens), alp 98.13
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 98.13
d1u3ha1110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.13
d1i9ea_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.13
d1mqkl_109 Immunoglobulin light chain kappa variable domain, 98.12
d2fx7l1108 Immunoglobulin light chain kappa variable domain, 98.12
d1bwwa_109 Immunoglobulin light chain kappa variable domain, 98.11
d1mexl1107 Immunoglobulin light chain kappa variable domain, 98.11
d1akjd_114 CD8 {Human (Homo sapiens) [TaxId: 9606]} 98.1
d3cx5k1107 Immunoglobulin light chain kappa variable domain, 98.1
d1t7va194 Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Hu 98.09
d2ak4d1114 T-cell antigen receptor {Human (Homo sapiens), alp 98.09
d1bd2d1111 T-cell antigen receptor {Human (Homo sapiens), alp 98.09
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 98.08
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.07
d1d5il1107 Immunoglobulin light chain kappa variable domain, 98.07
d8faba1103 Immunoglobulin light chain lambda variable domain, 98.06
d1hkfa_108 NK cell activating receptor NKP44 {Human (Homo sap 98.05
d1j05a_111 Immunoglobulin light chain kappa variable domain, 98.05
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 98.04
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1fo0a_115 T-cell antigen receptor {Mouse (Mus musculus), alp 98.04
d1hdmb198 Class II MHC beta chain, C-terminal domain {Human 98.03
d1kgcd1112 T-cell antigen receptor {Human (Homo sapiens), alp 98.02
d1fnga1101 Class II MHC alpha chain, C-terminal domain {Mouse 98.02
d1hxma1120 T-cell antigen receptor {Human (Homo sapiens), gam 98.01
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 98.01
d1ac6a_110 T-cell antigen receptor {Mouse (Mus musculus), alp 98.0
d1d5mb198 Class II MHC beta chain, C-terminal domain {Human 98.0
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.99
d1f3rb2119 Immunoglobulin light chain kappa variable domain, 97.99
d1oaql_110 Immunoglobulin light chain lambda variable domain, 97.98
d2esvd1110 T-cell antigen receptor {Human (Homo sapiens), alp 97.97
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 97.96
d1uvqa199 Class II MHC alpha chain, C-terminal domain {Human 97.95
d3frua191 Fc (IgG) receptor, alpha-3 domain {Rat (Rattus nor 97.95
d1cd0a_111 Immunoglobulin light chain lambda variable domain, 97.95
d1h5ba_113 T-cell antigen receptor {Mouse (Mus musculus), alp 97.95
d2gsia1111 Immunoglobulin light chain kappa variable domain, 97.94
d2aq2a1110 T-cell antigen receptor {Mouse (Mus musculus), bet 97.93
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 97.93
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.93
d1hxmb1123 T-cell antigen receptor {Human (Homo sapiens), del 97.93
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 97.92
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.92
d2esve1111 T-cell antigen receptor {Human (Homo sapiens), bet 97.92
d1n4xl_113 Immunoglobulin light chain kappa variable domain, 97.92
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 97.91
d1ogad1115 T-cell antigen receptor {Human (Homo sapiens), alp 97.9
d2ntsp1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.9
d1dr9a295 CD80, second domain {Human (Homo sapiens) [TaxId: 97.89
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 97.89
d1ucta296 Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sa 97.88
d1yqvl1104 Immunoglobulin light chain kappa variable domain, 97.88
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.87
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 97.87
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 97.87
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 97.87
d1hdma1103 Class II MHC alpha chain, C-terminal domain {Human 97.86
d1kgce1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.86
d1mjul1112 Immunoglobulin light chain kappa variable domain, 97.85
d1smoa_113 TREM-1 (triggering receptor expressed on myeloid c 97.84
d1rzfl1111 Immunoglobulin light chain lambda variable domain, 97.84
d1ymmd196 T-cell antigen receptor {Human (Homo sapiens), alp 97.83
d2gj6d194 T-cell antigen receptor {Mouse (Mus musculus), bet 97.82
d2avga1110 Cardiac myosin binding protein C, different domain 97.82
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.82
d1ncwl1112 Immunoglobulin light chain kappa variable domain, 97.82
d1lgva1112 Immunoglobulin light chain lambda variable domain, 97.82
d1q9ra1113 Immunoglobulin light chain kappa variable domain, 97.81
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.81
d1ypzf1120 T-cell antigen receptor {Human (Homo sapiens), gam 97.8
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 97.8
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.79
d1w72l1109 Immunoglobulin light chain lambda variable domain, 97.79
d1xaua_104 B and T lymphocyte attenuator, Btla {Mouse (Mus mu 97.79
d1k5na195 Class I MHC, alpha-3 domain {Human (Homo sapiens) 97.78
d2h26a196 CD1, alpha-3 domain {Human (Homo sapiens), CD1a [T 97.78
d1uvqb197 Class II MHC beta chain, C-terminal domain {Human 97.78
d1qfoa_118 N-terminal domain of sialoadhesin {Mouse (Mus musc 97.77
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 97.77
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 97.77
d1nfde1108 Immunoglobulin light chain lambda variable domain, 97.76
d1hyrc194 Class I MHC homolog, alpha-3 domain {Human (Homo s 97.75
d2g5ra1121 N-terminal domain of sialic acid binding Ig-like l 97.74
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 97.72
d2mhaa189 Class I MHC, alpha-3 domain {Mouse (Mus musculus) 97.72
d2rhea_114 Immunoglobulin light chain lambda variable domain, 97.7
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.7
d1j8he1113 T-cell antigen receptor {Human (Homo sapiens), bet 97.69
d1vcaa1109 Vascular cell adhesion molecule-1 (VCAM-1) {Human 97.69
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 97.68
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 97.67
d2bnub1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.66
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.66
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 97.64
d1ugna298 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.63
d1nkra299 Killer cell inhibitory receptor {Human (Homo sapie 97.62
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 97.61
d1olla293 Ligand binding domain of NK receptor NKp46 {Human 97.6
d2cdeb1112 T-cell antigen receptor {Human (Homo sapiens), bet 97.6
d1rzfl2102 Immunoglobulin light chain lambda constant domain, 97.59
d1nfdb1113 T-cell antigen receptor {Mouse (Mus musculus), bet 97.56
d1nkra196 Killer cell inhibitory receptor {Human (Homo sapie 97.55
d1dqta_117 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.55
d1fp5a2105 Immunoglobulin heavy chain epsilon constant domain 97.54
d1q0xl2102 Immunoglobulin light chain lambda constant domain, 97.54
d2agjh1120 Immunoglobulin heavy chain variable domain, VH {En 97.53
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 97.53
d1dn0b1120 Immunoglobulin heavy chain variable domain, VH {Hu 97.49
d1ogae1114 T-cell antigen receptor {Human (Homo sapiens), bet 97.48
d1qnzh_119 Immunoglobulin heavy chain variable domain, VH {Mo 97.46
d7fabh1116 Immunoglobulin heavy chain variable domain, VH {Hu 97.46
d1sjva_107 Camelid IG heavy chain variable domain, VHh {Llama 97.45
d2ifga192 High affinity nerve growth factor receptor TrkA, d 97.44
d1i8lc_118 Immunoreceptor CTLA-4 (CD152), N-terminal fragment 97.43
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 97.42
d1kcvh2101 Immunoglobulin heavy chain gamma constant domain 1 97.42
d1u9ka_110 TREM-1 (triggering receptor expressed on myeloid c 97.41
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 97.4
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 97.4
d1ow0a2108 Immunoglobulin heavy chain alpha constant domain 3 97.4
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 97.39
d1kxvc_119 Camelid IG heavy chain variable domain, VHh {Camel 97.39
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 97.37
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 97.37
d1ugna196 Ligand binding domain of lir-1 (ilt2) {Human (Homo 97.37
d1c5db1117 Immunoglobulin heavy chain variable domain, VH {Ra 97.37
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 97.35
d1cqka_101 Immunoglobulin heavy chain gamma constant domain 3 97.35
d1mjul2107 Immunoglobulin light chain kappa constant domain, 97.35
d1pg7x1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.34
d1igtb4102 Immunoglobulin heavy chain gamma constant domain 3 97.34
d1o0va1104 Immunoglobulin heavy chain epsilon constant domain 97.3
d1nlbh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.3
d2jelh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.29
d1mfah1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.29
d2ck0h1109 Immunoglobulin heavy chain variable domain, VH {Mo 97.29
d1a2yb_116 Immunoglobulin heavy chain variable domain, VH {Mo 97.29
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 97.28
d1vgeh1122 Immunoglobulin heavy chain variable domain, VH {Hu 97.28
d1jpth1117 Immunoglobulin heavy chain variable domain, VH {En 97.28
d1um5h1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.28
d1r0ah1123 Immunoglobulin heavy chain variable domain, VH {Mo 97.26
d1iqdb1117 Immunoglobulin heavy chain variable domain, VH {Hu 97.26
d1u58a198 Immunomodulatory protein m144, alpha-3 domain {Mur 97.25
d1fo0b_112 T-cell antigen receptor {Mouse (Mus musculus), bet 97.24
d1f3dh1115 Immunoglobulin heavy chain variable domain, VH {Mo 97.24
d1i1ca2102 Immunoglobulin heavy chain gamma constant domain 3 97.24
d1ncwh1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.23
d1jnhb1117 Immunoglobulin heavy chain variable domain, VH {Mo 97.23
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 97.23
d1rz7h1119 Immunoglobulin heavy chain variable domain, VH {Hu 97.22
d1indh1114 Immunoglobulin heavy chain variable domain, VH {Mo 97.21
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 97.2
d1mjuh2102 Immunoglobulin heavy chain gamma constant domain 1 97.2
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 97.2
d1hxmb2107 T-cell antigen receptor {Human (Homo sapiens), del 97.19
d1op3h1125 Immunoglobulin heavy chain variable domain, VH {En 97.18
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 97.18
d1nfde2104 Immunoglobulin light chain lambda constant domain, 97.18
d1j05b_121 Immunoglobulin heavy chain variable domain, VH {Mo 97.18
d2nxyd1128 Immunoglobulin heavy chain variable domain, VH {Hu 97.17
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 97.17
d1ogae2127 T-cell antigen receptor {Human (Homo sapiens), bet 97.17
d1ai1h1120 Immunoglobulin heavy chain variable domain, VH {Mo 97.15
d1gxea_130 Cardiac myosin binding protein C, different domain 97.15
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 97.14
d1eapb1119 Immunoglobulin heavy chain variable domain, VH {Mo 97.14
d1mjuh1116 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 97.13
d1tjgh1132 Immunoglobulin heavy chain variable domain, VH {En 97.13
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.13
d1etzb1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d2fbjh1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.13
d1oari_103 Immunoglobulin heavy chain variable domain, VH {Ra 97.1
d2b1hh1124 Immunoglobulin heavy chain variable domain, VH {En 97.1
d1dlfh_120 Immunoglobulin heavy chain variable domain, VH {Mo 97.1
d1lmka1126 Immunoglobulin heavy chain variable domain, VH {Mo 97.09
d3cx5j1127 Immunoglobulin heavy chain variable domain, VH {Mo 97.08
d1rjca1126 Camelid IG heavy chain variable domain, VHh {Camel 97.08
d1mqkh_123 Immunoglobulin heavy chain variable domain, VH {Mo 97.07
d1ieha_135 Camelid IG heavy chain variable domain, VHh {Llama 97.07
d1n0xh1127 Immunoglobulin heavy chain variable domain, VH {Hu 97.07
d1lo4h1118 Immunoglobulin heavy chain variable domain, VH {Mo 97.05
d1i1ca1103 Immunoglobulin heavy chain gamma constant domain 2 97.05
d1ol0a_121 Immunoglobulin heavy chain variable domain, VH {En 97.03
d2p49b1121 Camelid IG heavy chain variable domain, VHh {Camel 97.03
d1rihh1125 Immunoglobulin heavy chain variable domain, VH {Mo 97.02
d1i3ua_127 Camelid IG heavy chain variable domain, VHh {Llama 97.01
d3b5ha280 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 97.0
d1rhhb1130 Immunoglobulin heavy chain variable domain, VH {Hu 97.0
d1yjdc1118 CD28 {Human (Homo sapiens) [TaxId: 9606]} 96.99
d2fx7h1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.99
d1q9rb1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.98
d1dfbh1126 Immunoglobulin heavy chain variable domain, VH {Hu 96.97
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 96.96
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 96.95
d1nfdf1121 Immunoglobulin heavy chain variable domain, VH {Ha 96.94
d1ad9b1120 Immunoglobulin heavy chain variable domain, VH {En 96.94
d1fp5a1103 Immunoglobulin heavy chain epsilon constant domain 96.89
d1l6xa2102 Immunoglobulin heavy chain gamma constant domain 3 96.88
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.88
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 96.88
d1zvya1124 Camelid IG heavy chain variable domain, VHh {Camel 96.88
d1c5cl2107 Immunoglobulin light chain kappa constant domain, 96.86
d2fb4h1127 Immunoglobulin heavy chain variable domain, VH {Hu 96.86
d1yedb1124 Immunoglobulin heavy chain variable domain, VH {Mo 96.84
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 96.84
d1bz7b1122 Immunoglobulin heavy chain variable domain, VH {Mo 96.83
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 96.83
d1dn0b2105 Immunoglobulin heavy chain mu constant domain 1, C 96.82
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 96.81
d1fltx_95 Second domain of the Flt-1 receptor {Human (Homo s 96.79
d1rzga1130 Immunoglobulin heavy chain variable domain, VH {Hu 96.78
d1rzfh1133 Immunoglobulin heavy chain variable domain, VH {Hu 96.78
d1ct8b1118 Immunoglobulin heavy chain variable domain, VH {Mo 96.76
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 96.76
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 96.7
d1fn4b1116 Immunoglobulin heavy chain variable domain, VH {Ra 96.64
d3c2ah1131 Immunoglobulin heavy chain variable domain, VH {Hu 96.59
d1pd6a_94 Cardiac myosin binding protein C, different domain 96.56
d1jbja2100 CD3 epsilon chain ectodomain fragment {Mouse (Mus 96.49
d1l6xa1105 Immunoglobulin heavy chain gamma constant domain 2 96.49
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 96.49
d1c5ch2103 Immunoglobulin heavy chain gamma constant domain 1 96.48
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 96.46
d1igtb3119 Immunoglobulin heavy chain gamma constant domain 2 96.45
d1hxma286 T-cell antigen receptor {Human (Homo sapiens), gam 96.35
d2fbjh2102 Immunoglobulin heavy chain alpha constant domain 1 96.3
d1b2wh1117 Immunoglobulin heavy chain variable domain, VH {En 96.25
d1xiwa_91 CD3 epsilon chain ectodomain fragment {Human (Homo 96.15
d1pfca_111 Immunoglobulin heavy chain gamma constant domain 3 96.1
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 95.83
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 95.72
d1ow0a1101 Immunoglobulin heavy chain alpha constant domain 2 95.56
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Immunoglobulin
family: I set domains
domain: Axonin-1
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.62  E-value=5.7e-16  Score=114.59  Aligned_cols=79  Identities=16%  Similarity=0.347  Sum_probs=70.0

Q ss_pred             CeEEeecceeEeecCCCeEEEEEeeccCCceEEEccCCeecCCCCCCceEEeeeecCCCceeeEEEEeeecCCCccEEEE
Q psy3718          52 PEFEIKLRNQTSRRGEPSVLQCEAKGEKPIGILWNMNNKRLDPKSDNRYTIREEILPNGVLSDLSIKRTERGDSALFTCE  131 (543)
Q Consensus        52 p~~~~~~~~~~v~~g~~~~l~C~~~g~p~~~i~W~~~~~~i~~~~~~~~~~~~~~~~~~~~~~L~i~~~~~~D~G~Y~C~  131 (543)
                      |.|+..|.++.+..|+++.|.|.+.|.|.|++.|+|||.+|..  +.++.+..        +.|.|.++..+|+|.|+|.
T Consensus         2 P~f~~~~~~~~v~~G~~~~l~C~~~g~P~p~v~W~k~g~~i~~--~~~~~~~~--------~~L~i~~v~~~D~G~Y~C~   71 (89)
T d1cs6a4           2 PDWLDVITDTEADIGSDLRWSCVASGKPRPAVRWLRDGQPLAS--QNRIEVSG--------GELRFSKLVLEDSGMYQCV   71 (89)
T ss_dssp             EEEEECCCCEEEETTCCEEEECEEEEESCCEEEEEETTEECCC--CSSEEEET--------TEEEESSCCGGGCEEEEEE
T ss_pred             CCeEEECCCEEECCCCcEEEEEEEEEEcCCEEEEEEeeccccc--cceeeeee--------eeEEEEeecccCCEEEEEE
Confidence            7899999999999999999999999999999999999999864  44555532        3799999999999999999


Q ss_pred             Eecccceee
Q psy3718         132 IKSQKISSQ  140 (543)
Q Consensus       132 a~n~~~sv~  140 (543)
                      |.|..|++.
T Consensus        72 a~N~~G~~~   80 (89)
T d1cs6a4          72 AENKHGTVY   80 (89)
T ss_dssp             EEETTEEEE
T ss_pred             EEeCCCEEE
Confidence            999988754



>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nezg_ b.1.1.1 (G:) CD8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k5nb_ b.1.1.2 (B:) beta2-microglobulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vesa_ b.1.1.1 (A:) Novel antigen receptor 12Y-2 {Spotted wobbegong (Orectolobus maculatus) [TaxId: 168098]} Back     information, alignment and structure
>d1ospl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d3bp5a1 b.1.1.1 (A:1-114) Programmed cell death protein 1, PD1, extracellular domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1muja1 b.1.1.2 (A:84-183) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]} Back     information, alignment and structure
>d1i8ka_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq2n_ b.1.1.1 (N:) Novel antigen receptor (against lysozyme) {Nurse shark (Ginglymostoma cirratum) [TaxId: 7801]} Back     information, alignment and structure
>d1de4a1 b.1.1.2 (A:182-275) Hemochromatosis protein Hfe, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdea1 b.1.1.1 (A:2-115) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lk2b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c5cl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2ij0c1 b.1.1.1 (C:1-117) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1pl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2bnqd1 b.1.1.1 (D:2-114) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1lp9e1 b.1.1.1 (E:0-117) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1tjgl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1a0ql1 b.1.1.1 (L:2-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1tvda_ b.1.1.1 (A:) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2atpb1 b.1.1.1 (B:1-115) CD8 {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ucta1 b.1.1.4 (A:2-100) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xeda_ b.1.1.1 (A:) Polymeric-immunoglobulin receptor, PIGR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1op3k1 b.1.1.1 (K:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)} Back     information, alignment and structure
>d1lk3l1 b.1.1.1 (L:1-106) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1jhll_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla1 b.1.1.4 (A:1-95) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcvl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1j8hd1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u3ha1 b.1.1.1 (A:2-116) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1i9ea_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1mqkl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2fx7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 3.2 [TaxId: 9606]} Back     information, alignment and structure
>d1bwwa_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1mexl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1akjd_ b.1.1.1 (D:) CD8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cx5k1 b.1.1.1 (K:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d1t7va1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak4d1 b.1.1.1 (D:1-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1bd2d1 b.1.1.1 (D:1-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d5il1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d8faba1 b.1.1.1 (A:3-105) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1hkfa_ b.1.1.1 (A:) NK cell activating receptor NKP44 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j05a_ b.1.1.1 (A:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo0a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1hdmb1 b.1.1.2 (B:88-185) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1kgcd1 b.1.1.1 (D:2-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d1fnga1 b.1.1.2 (A:82-182) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-E group [TaxId: 10090]} Back     information, alignment and structure
>d1hxma1 b.1.1.1 (A:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ac6a_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d1d5mb1 b.1.1.2 (B:93-190) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DR group [TaxId: 9606]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1f3rb2 b.1.1.1 (B:139-257) Immunoglobulin light chain kappa variable domain, VL-kappa {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1oaql_ b.1.1.1 (L:) Immunoglobulin light chain lambda variable domain, VL-lambda {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2esvd1 b.1.1.1 (D:4-116) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uvqa1 b.1.1.2 (A:85-183) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d3frua1 b.1.1.2 (A:179-269) Fc (IgG) receptor, alpha-3 domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cd0a_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1h5ba_ b.1.1.1 (A:) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]} Back     information, alignment and structure
>d2gsia1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]} Back     information, alignment and structure
>d2aq2a1 b.1.1.1 (A:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb1 b.1.1.1 (B:1-123) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esve1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1n4xl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogad1 b.1.1.1 (D:3-117) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2ntsp1 b.1.1.1 (P:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a2 b.1.1.3 (A:106-200) CD80, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1ucta2 b.1.1.4 (A:101-196) Ig alpha Fc receptor, FCARI (CD89) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqvl1 b.1.1.1 (L:2-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1hdma1 b.1.1.2 (A:94-196) Class II MHC alpha chain, C-terminal domain {Human (Homo sapiens), HLA-DM [TaxId: 9606]} Back     information, alignment and structure
>d1kgce1 b.1.1.1 (E:3-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1mjul1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl1 b.1.1.1 (L:2-108) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1ymmd1 b.1.1.1 (D:9-104) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} Back     information, alignment and structure
>d2gj6d1 b.1.1.1 (D:15-114) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1ncwl1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]} Back     information, alignment and structure
>d1lgva1 b.1.1.1 (A:1-112) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1q9ra1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1ypzf1 b.1.1.1 (F:1-120) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w72l1 b.1.1.1 (L:1-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 5 [TaxId: 9606]} Back     information, alignment and structure
>d1xaua_ b.1.1.4 (A:) B and T lymphocyte attenuator, Btla {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k5na1 b.1.1.2 (A:182-276) Class I MHC, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h26a1 b.1.1.2 (A:184-279) CD1, alpha-3 domain {Human (Homo sapiens), CD1a [TaxId: 9606]} Back     information, alignment and structure
>d1uvqb1 b.1.1.2 (B:95-191) Class II MHC beta chain, C-terminal domain {Human (Homo sapiens), HLA-DQ group [TaxId: 9606]} Back     information, alignment and structure
>d1qfoa_ b.1.1.1 (A:) N-terminal domain of sialoadhesin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfde1 b.1.1.1 (E:2-107) Immunoglobulin light chain lambda variable domain, VL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1hyrc1 b.1.1.2 (C:181-274) Class I MHC homolog, alpha-3 domain {Human (Homo sapiens), Mic-a [TaxId: 9606]} Back     information, alignment and structure
>d2g5ra1 b.1.1.1 (A:24-144) N-terminal domain of sialic acid binding Ig-like lectin 7 (SIGLEC-7, p75/AIRM1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2mhaa1 b.1.1.2 (A:182-270) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rhea_ b.1.1.1 (A:) Immunoglobulin light chain lambda variable domain, VL-lambda {Human (Homo sapiens), cluster 2 [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1j8he1 b.1.1.1 (E:2-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bnub1 b.1.1.1 (B:2-113) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugna2 b.1.1.4 (A:98-195) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkra2 b.1.1.4 (A:102-200) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olla2 b.1.1.4 (A:96-188) Ligand binding domain of NK receptor NKp46 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cdeb1 b.1.1.1 (B:5-116) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1rzfl2 b.1.1.2 (L:109-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdb1 b.1.1.1 (B:1-117) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1nkra1 b.1.1.4 (A:6-101) Killer cell inhibitory receptor {Human (Homo sapiens), p58-cl42 kir [TaxId: 9606]} Back     information, alignment and structure
>d1dqta_ b.1.1.1 (A:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fp5a2 b.1.1.2 (A:439-543) Immunoglobulin heavy chain epsilon constant domain 4, CH4-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q0xl2 b.1.1.2 (L:108-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2agjh1 b.1.1.1 (H:1-120) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dn0b1 b.1.1.1 (B:1-120) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1ogae1 b.1.1.1 (E:5-118) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1qnzh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d7fabh1 b.1.1.1 (H:1-116) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 2.1 [TaxId: 9606]} Back     information, alignment and structure
>d1sjva_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8lc_ b.1.1.1 (C:) Immunoreceptor CTLA-4 (CD152), N-terminal fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1kcvh2 b.1.1.2 (H:117-217) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u9ka_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a2 b.1.1.2 (A:343-450) Immunoglobulin heavy chain alpha constant domain 3, CH3-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kxvc_ b.1.1.1 (C:) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ugna1 b.1.1.4 (A:2-97) Ligand binding domain of lir-1 (ilt2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5db1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cqka_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mjul2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1o0va1 b.1.1.2 (A:228-330) Immunoglobulin heavy chain epsilon constant domain 2, CH2-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nlbh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 4 [TaxId: 10090]} Back     information, alignment and structure
>d2jelh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mfah1 b.1.1.1 (H:251-367) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2ck0h1 b.1.1.1 (H:1-106) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1a2yb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vgeh1 b.1.1.1 (H:1-122) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1jpth1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1um5h1 b.1.1.1 (H:3-119) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1r0ah1 b.1.1.1 (H:1-123) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d1iqdb1 b.1.1.1 (B:1-114) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1u58a1 b.1.1.2 (A:145-242) Immunomodulatory protein m144, alpha-3 domain {Murine cytomegalovirus [TaxId: 10366]} Back     information, alignment and structure
>d1fo0b_ b.1.1.1 (B:) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} Back     information, alignment and structure
>d1f3dh1 b.1.1.1 (H:1-121) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ncwh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1jnhb1 b.1.1.1 (B:1-117) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1rz7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1indh1 b.1.1.1 (H:1-114) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mjuh2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxmb2 b.1.1.2 (B:124-230) T-cell antigen receptor {Human (Homo sapiens), delta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1op3h1 b.1.1.1 (H:1-115) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1nfde2 b.1.1.2 (E:108-215) Immunoglobulin light chain lambda constant domain, CL-lambda {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1j05b_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d2nxyd1 b.1.1.1 (D:3001-3128) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogae2 b.1.1.2 (E:119-245) T-cell antigen receptor {Human (Homo sapiens), beta-chain [TaxId: 9606]} Back     information, alignment and structure
>d1ai1h1 b.1.1.1 (H:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.3 [TaxId: 10090]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1eapb1 b.1.1.1 (B:1-124) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1mjuh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjgh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1etzb1 b.1.1.1 (B:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 6 [TaxId: 10090]} Back     information, alignment and structure
>d2fbjh1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1oari_ b.1.1.1 (I:) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b1hh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1dlfh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1lmka1 b.1.1.1 (A:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d3cx5j1 b.1.1.1 (J:1-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 7.1 [TaxId: 10090]} Back     information, alignment and structure
>d1rjca1 b.1.1.1 (A:2-127) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1mqkh_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1ieha_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d1n0xh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1lo4h1 b.1.1.1 (H:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.1 [TaxId: 10090]} Back     information, alignment and structure
>d1i1ca1 b.1.1.2 (A:239-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ol0a_ b.1.1.1 (A:) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d2p49b1 b.1.1.1 (B:1-121) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1rihh1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1i3ua_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama) [TaxId: 9844]} Back     information, alignment and structure
>d3b5ha2 b.1.1.4 (A:23-102) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhhb1 b.1.1.1 (B:3-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1yjdc1 b.1.1.1 (C:1-118) CD28 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fx7h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1q9rb1 b.1.1.1 (B:1-111) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} Back     information, alignment and structure
>d1dfbh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nfdf1 b.1.1.1 (F:1-114) Immunoglobulin heavy chain variable domain, VH {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1ad9b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1fp5a1 b.1.1.2 (A:336-438) Immunoglobulin heavy chain epsilon constant domain 3, CH3-epsilon {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6xa2 b.1.1.2 (A:342-443) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zvya1 b.1.1.1 (A:2-125) Camelid IG heavy chain variable domain, VHh {Camel (Camelus dromedarius) [TaxId: 9838]} Back     information, alignment and structure
>d1c5cl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fb4h1 b.1.1.1 (H:1-119) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 3 [TaxId: 9606]} Back     information, alignment and structure
>d1yedb1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bz7b1 b.1.1.1 (B:1-122) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fltx_ b.1.1.4 (X:) Second domain of the Flt-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzga1 b.1.1.1 (A:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1rzfh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 1 [TaxId: 9606]} Back     information, alignment and structure
>d1ct8b1 b.1.1.1 (B:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.3 [TaxId: 10090]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d1fn4b1 b.1.1.1 (B:1-106) Immunoglobulin heavy chain variable domain, VH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d3c2ah1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Human (Homo sapiens), cluster 4 [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l6xa1 b.1.1.2 (A:237-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c5ch2 b.1.1.2 (H:114-230) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]} Back     information, alignment and structure
>d1hxma2 b.1.1.2 (A:121-206) T-cell antigen receptor {Human (Homo sapiens), gamma-chain [TaxId: 9606]} Back     information, alignment and structure
>d2fbjh2 b.1.1.2 (H:119-220) Immunoglobulin heavy chain alpha constant domain 1, CH1-alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b2wh1 b.1.1.1 (H:1-117) Immunoglobulin heavy chain variable domain, VH {Engineered (including hybrid species)} Back     information, alignment and structure
>d1xiwa_ b.1.1.4 (A:) CD3 epsilon chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pfca_ b.1.1.2 (A:) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ow0a1 b.1.1.2 (A:242-342) Immunoglobulin heavy chain alpha constant domain 2, CH2-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure