Psyllid ID: psy3858

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MSLHHRVNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSKPNPT
cccccEEcccccccccHHHHHHHHHHHcccccccccccEEEccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHHHHHcccccEEEEcccccccccEEEEccccccccccccEEEEEcccccEEEccccccEEEEEEEEEEcccc
ccHHHEHcccccHHHccccHHHHHHHHHcccEEEccccccEEEEEcccccHHHHHHHHcEHcccccccHHHHHHHHHHHHHHHHHHccccccEcccEEEccccHHHHHHHHHHccccEEEEEccccccccEEEEEccHHHcccccccEEEEEEEcccEEEcccEEEEEEEEEEEcccccc
mslhhrvnhfpgmanlESKAILAYHLNRmkyffpdeynifpkswslprqWKEVISYNREhmnhfpgmanLESKAILAYHLNRmkyffpdeynifpkswslprqWKEVISYNREhadetlilkptrgaegkgikilnfipehevmdqdaSCQVYLSNVLLINGFKFDLRVYVLMTSKPNPT
mslhhrvnhfpgmanLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREhadetlilkptrgaegkGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSKPNPT
MSLHHRVNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSKPNPT
*********FPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLM*******
**LHHRVNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSKPN**
MSLHHRVNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSKPNPT
*SLHHRVNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSK****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLHHRVNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSKPNPT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q8N841 843 Tubulin polyglutamylase T yes N/A 0.672 0.143 0.427 3e-25
A4Q9E8 822 Tubulin polyglutamylase T yes N/A 0.672 0.147 0.427 4e-25
A6NNM8 815 Tubulin polyglutamylase T no N/A 0.644 0.142 0.470 6e-25
A4Q9F6 804 Tubulin polyglutamylase T no N/A 0.644 0.144 0.427 1e-24
A8CVX7 778 Tubulin polyglutamylase t yes N/A 0.616 0.142 0.442 7e-24
A4Q9F4 727 Tubulin polyglutamylase T no N/A 0.644 0.159 0.333 6e-14
Q8NHH1 538 Tubulin polyglutamylase T no N/A 0.644 0.215 0.325 9e-14
Q23MT7 1189 Probable beta-tubulin pol N/A N/A 0.805 0.121 0.318 2e-13
A4Q9F0 912 Tubulin polyglutamylase T no N/A 0.777 0.153 0.322 4e-13
Q6ZT98 887 Tubulin polyglutamylase T no N/A 0.766 0.155 0.311 5e-13
>sp|Q8N841|TTLL6_HUMAN Tubulin polyglutamylase TTLL6 OS=Homo sapiens GN=TTLL6 PE=1 SV=2 Back     alignment and function desciption
 Score =  114 bits (285), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/124 (42%), Positives = 82/124 (66%), Gaps = 3/124 (2%)

Query: 52  EVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYN 111
           E+ SY +  +NHFPGM+ +  K +LA +++RM   FP ++  FP++W LP  W ++ +Y+
Sbjct: 107 EMKSYQK--INHFPGMSEICRKDLLARNMSRMLKMFPKDFRFFPRTWCLPADWGDLQTYS 164

Query: 112 REHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYV 171
           R   ++T I KP  G +GKGI I   + E +   +D  CQ+Y+S   +I+GFKFDLR+YV
Sbjct: 165 RSRKNKTYICKPDSGCQGKGIFITRTVKEIKP-GEDMICQLYISKPFIIDGFKFDLRIYV 223

Query: 172 LMTS 175
           L+TS
Sbjct: 224 LVTS 227
Polyglutamylase which preferentially modifies alpha-tubulin. Mediates tubulin polyglutamylation in cilia. Involved in the side-chain elongation step of the polyglutamylation reaction rather than in the initiation step.
Homo sapiens (taxid: 9606)
EC: 6EC: .EC: -EC: .EC: -EC: .EC: -
>sp|A4Q9E8|TTLL6_MOUSE Tubulin polyglutamylase TTLL6 OS=Mus musculus GN=Ttll6 PE=2 SV=1 Back     alignment and function description
>sp|A6NNM8|TTL13_HUMAN Tubulin polyglutamylase TTLL13 OS=Homo sapiens GN=TTLL13 PE=2 SV=2 Back     alignment and function description
>sp|A4Q9F6|TTL13_MOUSE Tubulin polyglutamylase TTLL13 OS=Mus musculus GN=Ttll13 PE=2 SV=1 Back     alignment and function description
>sp|A8CVX7|TTLL6_DANRE Tubulin polyglutamylase ttll6 OS=Danio rerio GN=ttll6 PE=2 SV=1 Back     alignment and function description
>sp|A4Q9F4|TTL11_MOUSE Tubulin polyglutamylase TTLL11 OS=Mus musculus GN=Ttll11 PE=2 SV=1 Back     alignment and function description
>sp|Q8NHH1|TTL11_HUMAN Tubulin polyglutamylase TTLL11 OS=Homo sapiens GN=TTLL11 PE=2 SV=1 Back     alignment and function description
>sp|Q23MT7|TTL6A_TETTS Probable beta-tubulin polyglutamylase OS=Tetrahymena thermophila (strain SB210) GN=Ttll6a PE=4 SV=1 Back     alignment and function description
>sp|A4Q9F0|TTLL7_MOUSE Tubulin polyglutamylase TTLL7 OS=Mus musculus GN=Ttll7 PE=1 SV=1 Back     alignment and function description
>sp|Q6ZT98|TTLL7_HUMAN Tubulin polyglutamylase TTLL7 OS=Homo sapiens GN=TTLL7 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
358340896 806 tubulin polyglutamylase ttll6 [Clonorchi 0.644 0.143 0.495 2e-26
256084896 1069 tubulin tyrosine ligase [Schistosoma man 0.661 0.111 0.453 7e-26
312379503 885 hypothetical protein AND_08633 [Anophele 0.644 0.131 0.478 1e-24
402899509 857 PREDICTED: LOW QUALITY PROTEIN: tubulin 0.672 0.141 0.435 4e-24
157137257 698 hypothetical protein AaeL_AAEL013750 [Ae 0.644 0.166 0.478 4e-24
297486955 901 PREDICTED: LOW QUALITY PROTEIN: tubulin 0.672 0.134 0.435 6e-24
297462550 901 PREDICTED: LOW QUALITY PROTEIN: tubulin 0.672 0.134 0.435 6e-24
405953519 810 Tubulin polyglutamylase TTLL13 [Crassost 0.627 0.139 0.466 6e-24
440910517 459 Tubulin polyglutamylase TTLL6, partial [ 0.672 0.263 0.435 1e-23
363737658 889 PREDICTED: tubulin polyglutamylase TTLL1 0.644 0.130 0.470 1e-23
>gi|358340896|dbj|GAA48693.1| tubulin polyglutamylase ttll6 [Clonorchis sinensis] Back     alignment and taxonomy information
 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 58/117 (49%), Positives = 79/117 (67%), Gaps = 1/117 (0%)

Query: 59  EHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADET 118
           + +NHFPGM+ L  K  LA +LNRM   FP +Y IFPK+WSLP +W E+ +Y R+    T
Sbjct: 5   QKINHFPGMSELCRKDSLARNLNRMAKMFPKDYAIFPKTWSLPAEWNELQAYTRKRKSRT 64

Query: 119 LILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTS 175
            ILKP  G +G+GI +   I E   M ++  CQVY+S   LI+G+KFD+R+YVL+TS
Sbjct: 65  YILKPDSGCQGRGIYLTRSIKEIRPM-ENMICQVYISKPFLIDGYKFDMRLYVLLTS 120

Source: Clonorchis sinensis

Species: Clonorchis sinensis

Genus: Clonorchis

Family: Opisthorchiidae

Order: Opisthorchiida

Class: Trematoda

Phylum: Platyhelminthes

Superkingdom: Eukaryota
>gi|256084896|ref|XP_002578661.1| tubulin tyrosine ligase [Schistosoma mansoni] gi|360042883|emb|CCD78293.1| tubulin tyrosine ligase-related [Schistosoma mansoni] Back     alignment and taxonomy information
>gi|312379503|gb|EFR25755.1| hypothetical protein AND_08633 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|402899509|ref|XP_003912737.1| PREDICTED: LOW QUALITY PROTEIN: tubulin polyglutamylase TTLL6, partial [Papio anubis] Back     alignment and taxonomy information
>gi|157137257|ref|XP_001663960.1| hypothetical protein AaeL_AAEL013750 [Aedes aegypti] gi|108869763|gb|EAT33988.1| AAEL013750-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|297486955|ref|XP_002695986.1| PREDICTED: LOW QUALITY PROTEIN: tubulin polyglutamylase TTLL6 [Bos taurus] gi|296476557|tpg|DAA18672.1| TPA: tubulin tyrosine ligase-like family, member 6 [Bos taurus] Back     alignment and taxonomy information
>gi|297462550|ref|XP_002702247.1| PREDICTED: LOW QUALITY PROTEIN: tubulin polyglutamylase TTLL6 [Bos taurus] Back     alignment and taxonomy information
>gi|405953519|gb|EKC21166.1| Tubulin polyglutamylase TTLL13 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|440910517|gb|ELR60311.1| Tubulin polyglutamylase TTLL6, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|363737658|ref|XP_429033.3| PREDICTED: tubulin polyglutamylase TTLL13 [Gallus gallus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
UNIPROTKB|E1BIV0 837 TTLL6 "Uncharacterized protein 0.766 0.164 0.394 2.3e-24
UNIPROTKB|G3N2U5 847 TTLL6 "Uncharacterized protein 0.766 0.162 0.394 2.4e-24
UNIPROTKB|F1RWF8 834 TTLL6 "Uncharacterized protein 0.766 0.165 0.394 3e-24
UNIPROTKB|F1P1K7 525 TTLL13 "Uncharacterized protei 0.766 0.262 0.408 4.1e-24
UNIPROTKB|Q8N841 843 TTLL6 "Tubulin polyglutamylase 0.766 0.163 0.387 6.4e-24
RGD|1311922 820 Ttll6 "tubulin tyrosine ligase 0.766 0.168 0.387 9.9e-24
MGI|MGI:2683461 822 Ttll6 "tubulin tyrosine ligase 0.766 0.167 0.387 9.9e-24
UNIPROTKB|E2RTL2 888 TTLL6 "Uncharacterized protein 0.716 0.145 0.421 2.4e-23
UNIPROTKB|A6NNM8 815 TTLL13 "Tubulin polyglutamylas 0.688 0.152 0.452 5.5e-23
UNIPROTKB|F1PAQ0 818 TTLL13 "Uncharacterized protei 0.688 0.151 0.436 9.1e-23
UNIPROTKB|E1BIV0 TTLL6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 289 (106.8 bits), Expect = 2.3e-24, P = 2.3e-24
 Identities = 56/142 (39%), Positives = 92/142 (64%)

Query:    35 DEYNIFPKSWSLP-RQWKEVISYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNI 93
             D++ ++   +S+   +  E+ SY +  +NHFPGM+ +  K +LA +++RM   FP +++ 
Sbjct:    89 DDWTLYWTDFSVSLERVMEMKSYQK--INHFPGMSEICRKDLLARNMSRMLKMFPKDFHF 146

Query:    94 FPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEHEVMDQDASCQVY 153
             FP++W LP  W ++ +Y+R   ++T I KP  G +GKGI I   + E +   +D  CQ+Y
Sbjct:   147 FPRTWCLPADWGDLQNYSRSRKNKTYICKPDSGCQGKGIFITRTVKEIKP-GEDMICQLY 205

Query:   154 LSNVLLINGFKFDLRVYVLMTS 175
             +S   +I+GFKFDLR+YVLMTS
Sbjct:   206 ISKPFIIDGFKFDLRIYVLMTS 227
GO:0006464 "cellular protein modification process" evidence=IEA
GO:0004835 "tubulin-tyrosine ligase activity" evidence=IEA
UNIPROTKB|G3N2U5 TTLL6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWF8 TTLL6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1K7 TTLL13 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N841 TTLL6 "Tubulin polyglutamylase TTLL6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1311922 Ttll6 "tubulin tyrosine ligase-like family, member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2683461 Ttll6 "tubulin tyrosine ligase-like family, member 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RTL2 TTLL6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A6NNM8 TTLL13 "Tubulin polyglutamylase TTLL13" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAQ0 TTLL13 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam03133 291 pfam03133, TTL, Tubulin-tyrosine ligase family 6e-20
>gnl|CDD|217380 pfam03133, TTL, Tubulin-tyrosine ligase family Back     alignment and domain information 
 Score = 83.9 bits (208), Expect = 6e-20
 Identities = 40/117 (34%), Positives = 66/117 (56%), Gaps = 4/117 (3%)

Query: 62  NHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLIL 121
           NHFPG   +  K +L  ++ R    F  +++  P+++ LP    E + Y  ++   T I+
Sbjct: 12  NHFPGSYEITRKDLLWKNIKRQPCDFGRKFDFLPRTFILPTDLAEFVDYFEDNERNTWIV 71

Query: 122 KPTRGAEGKGIKI---LNFIPEHEVMDQDASCQVYLSNVLLINGFKFDLRVYVLMTS 175
           KP+  A G+GI+I   L+ I +  +  +    Q Y+   LLI+G KFD+R+YVL+TS
Sbjct: 72  KPSASARGRGIRITNDLSQILKQ-IQSRPLVVQKYIERPLLIDGRKFDIRLYVLVTS 127

Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed. This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL). The true physiological function of TTL has so far not been established. Tubulin-tyrosine ligase (TTL) catalyzes the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness. On the other hand, 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis. Bacterial homologs of TTL are predicted to form peptide tags. Some of these are fused to a 2-oxoglutarate Fe(II)-dependent dioxygenase domain. Length = 291

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
PF03133 292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 100.0
KOG2156|consensus 662 100.0
KOG2158|consensus 565 99.96
KOG2157|consensus 497 99.94
KOG2155|consensus 631 99.87
PF14398 262 ATPgrasp_YheCD: YheC/D like ATP-grasp 98.85
KOG2156|consensus 662 98.6
KOG2158|consensus 565 98.39
PF08443190 RimK: RimK-like ATP-grasp domain; InterPro: IPR013 98.26
PLN02941 328 inositol-tetrakisphosphate 1-kinase 98.25
PF03133 292 TTL: Tubulin-tyrosine ligase family; InterPro: IPR 98.15
PF02955173 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP 98.03
PRK05246316 glutathione synthetase; Provisional 97.94
PRK12458 338 glutathione synthetase; Provisional 97.79
TIGR01380312 glut_syn glutathione synthetase, prokaryotic. This 97.73
PF13535184 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 97.7
COG0189318 RimK Glutathione synthase/Ribosomal protein S6 mod 97.7
PRK10446300 ribosomal protein S6 modification protein; Provisi 97.69
TIGR00768277 rimK_fam alpha-L-glutamate ligases, RimK family. T 97.62
TIGR02144280 LysX_arch Lysine biosynthesis enzyme LysX. The fam 97.35
PRK12767 326 carbamoyl phosphate synthase-like protein; Provisi 97.29
PF14403445 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 97.13
PRK06849 389 hypothetical protein; Provisional 97.04
TIGR02291 317 rimK_rel_E_lig alpha-L-glutamate ligase-related pr 96.91
PRK02471 752 bifunctional glutamate--cysteine ligase/glutathion 96.75
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 96.65
PRK14016 727 cyanophycin synthetase; Provisional 96.59
PF02655161 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 96.5
COG0439 449 AccC Biotin carboxylase [Lipid metabolism] 96.47
KOG2157|consensus 497 96.36
PRK01372304 ddl D-alanine--D-alanine ligase; Reviewed 96.3
TIGR01435 737 glu_cys_lig_rel glutamate--cysteine ligase/gamma-g 96.2
PF14397 285 ATPgrasp_ST: Sugar-transfer associated ATP-grasp 96.14
PRK07206 416 hypothetical protein; Provisional 96.07
PRK08462 445 biotin carboxylase; Validated 95.94
TIGR01205 315 D_ala_D_alaTIGR D-alanine--D-alanine ligase. but a 95.87
PRK08654 499 pyruvate carboxylase subunit A; Validated 95.76
PF15632329 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathwa 95.6
TIGR02068 864 cya_phycin_syn cyanophycin synthetase. Cyanophycin 95.5
PRK08463 478 acetyl-CoA carboxylase subunit A; Validated 95.37
TIGR01161 352 purK phosphoribosylaminoimidazole carboxylase, Pur 95.37
PRK01966333 ddl D-alanyl-alanine synthetase A; Reviewed 95.33
PRK02186 887 argininosuccinate lyase; Provisional 95.31
TIGR00514 449 accC acetyl-CoA carboxylase, biotin carboxylase su 95.24
PRK14571 299 D-alanyl-alanine synthetase A; Provisional 95.18
PRK12833 467 acetyl-CoA carboxylase biotin carboxylase subunit; 95.11
TIGR01235 1143 pyruv_carbox pyruvate carboxylase. This enzyme pla 94.87
PRK13790 379 phosphoribosylamine--glycine ligase; Provisional 94.87
PRK12999 1146 pyruvate carboxylase; Reviewed 94.72
TIGR01142 380 purT phosphoribosylglycinamide formyltransferase 2 94.61
PRK08591 451 acetyl-CoA carboxylase biotin carboxylase subunit; 94.59
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 94.29
PRK13277 366 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribo 94.2
PRK00885 420 phosphoribosylamine--glycine ligase; Provisional 94.19
PRK07178 472 pyruvate carboxylase subunit A; Validated 94.12
PRK14568 343 vanB D-alanine--D-lactate ligase; Provisional 94.08
TIGR00877 423 purD phosphoribosylamine--glycine ligase. This enz 93.93
PRK10507619 bifunctional glutathionylspermidine amidase/glutat 93.88
PRK05586 447 biotin carboxylase; Validated 93.86
PRK06395 435 phosphoribosylamine--glycine ligase; Provisional 93.83
PRK14569296 D-alanyl-alanine synthetase A; Provisional 93.75
PRK13278 358 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D 93.74
PHA02117397 glutathionylspermidine synthase domain-containing 93.6
PRK06111 450 acetyl-CoA carboxylase biotin carboxylase subunit; 93.49
PRK09288 395 purT phosphoribosylglycinamide formyltransferase 2 93.46
PRK06019 372 phosphoribosylaminoimidazole carboxylase ATPase su 93.44
PRK12815 1068 carB carbamoyl phosphate synthase large subunit; R 93.26
PRK14572 347 D-alanyl-alanine synthetase A; Provisional 93.05
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 93.04
COG1821 307 Predicted ATP-utilizing enzyme (ATP-grasp superfam 92.81
), forming GARS-AIRS-GART. This entry represents the A-domain of the enzyme, and is related to the ATP-grasp domain of biotin carboxylase/carbamoyl phosphate synthetase.; PDB: 1GSO_A 3LP8_A 2IP4_A 1VKZ_A 2QK4_A 2XD4_A 2XCL_A 3MJF_A 2YRW_A 2YS6_A ...." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF01071">PF01071194 GARS_A: Phosphoribosylglycinamide synthetase, ATP- 92.45
PF02786211 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, 92.15
PF07478203 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; In 92.06
PRK14570 364 D-alanyl-alanine synthetase A; Provisional 91.84
PRK05784 486 phosphoribosylamine--glycine ligase; Provisional 91.72
COG2308488 Uncharacterized conserved protein [Function unknow 90.72
TIGR02712 1201 urea_carbox urea carboxylase. Members of this fami 90.36
COG0754387 Gsp Glutathionylspermidine synthase [Amino acid tr 89.87
PRK13789 426 phosphoribosylamine--glycine ligase; Provisional 89.19
PRK06524 493 biotin carboxylase-like protein; Validated 87.1
PRK05294 1066 carB carbamoyl phosphate synthase large subunit; R 86.42
COG4770 645 Acetyl/propionyl-CoA carboxylase, alpha subunit [L 85.89
TIGR01369 1050 CPSaseII_lrg carbamoyl-phosphate synthase, large s 85.67
PLN02257 434 phosphoribosylamine--glycine ligase 85.43
KOG0238|consensus 670 82.91
COG1038 1149 PycA Pyruvate carboxylase [Energy production and c 82.9
COG3919 415 Predicted ATP-grasp enzyme [General function predi 82.66
COG2232 389 Predicted ATP-dependent carboligase related to bio 82.39
PLN02735 1102 carbamoyl-phosphate synthase 81.97
PF04174330 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; In 81.46
KOG0369|consensus 1176 80.61
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information 
Probab=100.00  E-value=1.2e-39  Score=265.36  Aligned_cols=125  Identities=38%  Similarity=0.692  Sum_probs=63.6

Q ss_pred             hcc-cccccCCCCccccchHhHHHHHHHHHhhCCCCCCcccccCCCcchHHHHHHHHHhCCCceEEEcCCCCCCCCCEEE
Q psy3858          56 YNR-EHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKI  134 (180)
Q Consensus        56 ~~~-q~vNhfpg~~~l~~K~~l~~~l~~~~~~~~~~~~~~P~t~~lp~e~~~f~~~~~~~~~~~wI~KP~~~~~G~GI~l  134 (180)
                      +.+ |+||||||+.+||+|+.|+++++++.+..+..++|+|+||.||.|.++|..++.+.+.+.||+||+++++|+||++
T Consensus         4 ~~~~q~vN~~p~~~~l~~K~~l~~~l~~~~~~~~~~~~~~p~t~~l~~~~~~~~~~~~~~~~~~wI~KP~~~~rG~GI~l   83 (292)
T PF03133_consen    4 MKPFQKVNHFPGSQELTRKDLLAKNLQRYRKKFPKEFDFYPETFILPQDYKEFLKYFEKNPKNLWIVKPSNGSRGRGIKL   83 (292)
T ss_dssp             -CHHTT-TSS--EEEE-----------------------------HHHHHHHHHHHHHTTS---EEEEES-------EEE
T ss_pred             CCCCeeEccCCCCchhhhhHHHHHHHHHHHhhcCCcccCCcceEecHHHHHHHHHHHhcCCCCEEEEeccccCCCCCcee
Confidence            455 9999999999999999999999999998888899999999999999999998888778899999999999999999


Q ss_pred             eCCCCccc----ccCCceEEeeecCCccccCCceeEEEEEEEeeeecCCC
Q psy3858         135 LNFIPEHE----VMDQDASCQVYLSNVLLINGFKFDLRVYVLMTSKPNPT  180 (180)
Q Consensus       135 ~~~~~~~~----~~~~~~vvQ~YI~~P~Li~g~KfD~R~yvlvts~~Pl~  180 (180)
                      ++++.+..    ....++|||+||+||+||+|||||||+||||||++||+
T Consensus        84 ~~~~~~i~~~~~~~~~~~vvQkYI~~PlLi~grKFDlR~yvlvts~~pl~  133 (292)
T PF03133_consen   84 FNNLEQILRFSKNKNQPYVVQKYIENPLLIDGRKFDLRVYVLVTSLNPLR  133 (292)
T ss_dssp             ES-HHHHHCCHCCTTS-EEEEE--SSB--BTTB-EEEEEEEEE-T--T--
T ss_pred             cCCHHHHHHHhhhhhhhhhhhhccCCCeEEeeeeEEEEEEEEEeecccee
Confidence            99966544    25678999999999999999999999999999999985

This modification cycle involves a specific carboxypeptidase and the activity of the tubulin-tyrosine ligase (TTL) []. Tubulin-tyrosine ligase (TTL) catalyses the ATP-dependent post-translational addition of a tyrosine to the carboxy terminal end of detyrosinated alpha-tubulin. The true physiological function of TTL has so far not been established. In normally cycling cells, the tyrosinated form of tubulin predominates. However, in breast cancer cells, the detyrosinated form frequently predominates, with a correlation to tumour aggressiveness []. 3-nitrotyrosine has been shown to be incorporated, by TTL, into the carboxy terminal end of detyrosinated alpha-tubulin. This reaction is not reversible by the carboxypeptidase enzyme. Cells cultured in 3-nitrotyrosine rich medium showed evidence of altered microtubule structure and function, including altered cell morphology, epithelial barrier dysfunction, and apoptosis [].; GO: 0004835 tubulin-tyrosine ligase activity, 0006464 protein modification process; PDB: 3TII_A 3TIN_A 3TIG_A.
>KOG2156|consensus Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>KOG2157|consensus Back     alignment and domain information
>KOG2155|consensus Back     alignment and domain information
>PF14398 ATPgrasp_YheCD: YheC/D like ATP-grasp Back     alignment and domain information
>KOG2156|consensus Back     alignment and domain information
>KOG2158|consensus Back     alignment and domain information
>PF08443 RimK: RimK-like ATP-grasp domain; InterPro: IPR013651 This ATP-grasp domain is found in the ribosomal S6 modification enzyme RimK [] Back     alignment and domain information
>PLN02941 inositol-tetrakisphosphate 1-kinase Back     alignment and domain information
>PF03133 TTL: Tubulin-tyrosine ligase family; InterPro: IPR004344 Tubulins and microtubules are subjected to several post-translational modifications of which the reversible detyrosination/tyrosination of the carboxy-terminal end of most alpha-tubulins has been extensively analysed Back     alignment and domain information
>PF02955 GSH-S_ATP: Prokaryotic glutathione synthetase, ATP-grasp domain; InterPro: IPR004218 Prokaryotic glutathione synthetase 6 Back     alignment and domain information
>PRK05246 glutathione synthetase; Provisional Back     alignment and domain information
>PRK12458 glutathione synthetase; Provisional Back     alignment and domain information
>TIGR01380 glut_syn glutathione synthetase, prokaryotic Back     alignment and domain information
>PF13535 ATP-grasp_4: ATP-grasp domain; PDB: 3VMM_A 3LN6_A 3LN7_B 2PN1_A 4DIM_A Back     alignment and domain information
>COG0189 RimK Glutathione synthase/Ribosomal protein S6 modification enzyme (glutaminyl transferase) [Coenzyme metabolism / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10446 ribosomal protein S6 modification protein; Provisional Back     alignment and domain information
>TIGR00768 rimK_fam alpha-L-glutamate ligases, RimK family Back     alignment and domain information
>TIGR02144 LysX_arch Lysine biosynthesis enzyme LysX Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>PF14403 CP_ATPgrasp_2: Circularly permuted ATP-grasp type 2 Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02291 rimK_rel_E_lig alpha-L-glutamate ligase-related protein Back     alignment and domain information
>PRK02471 bifunctional glutamate--cysteine ligase/glutathione synthetase; Provisional Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK14016 cyanophycin synthetase; Provisional Back     alignment and domain information
>PF02655 ATP-grasp_3: ATP-grasp domain; InterPro: IPR003806 The ATP-grasp fold is one of several distinct ATP-binding folds, and is found in enzymes that catalyze the formation of amide bonds, catalyzing the ATP-dependent ligation of a carboxylate-containing molecule to an amino or thiol group-containing molecule [] Back     alignment and domain information
>COG0439 AccC Biotin carboxylase [Lipid metabolism] Back     alignment and domain information
>KOG2157|consensus Back     alignment and domain information
>PRK01372 ddl D-alanine--D-alanine ligase; Reviewed Back     alignment and domain information
>TIGR01435 glu_cys_lig_rel glutamate--cysteine ligase/gamma-glutamylcysteine synthetase, Streptococcus agalactiae type Back     alignment and domain information
>PF14397 ATPgrasp_ST: Sugar-transfer associated ATP-grasp Back     alignment and domain information
>PRK07206 hypothetical protein; Provisional Back     alignment and domain information
>PRK08462 biotin carboxylase; Validated Back     alignment and domain information
>TIGR01205 D_ala_D_alaTIGR D-alanine--D-alanine ligase Back     alignment and domain information
>PRK08654 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PF15632 ATPgrasp_Ter: ATP-grasp in the biosynthetic pathway with Ter operon Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase Back     alignment and domain information
>PRK08463 acetyl-CoA carboxylase subunit A; Validated Back     alignment and domain information
>TIGR01161 purK phosphoribosylaminoimidazole carboxylase, PurK protein Back     alignment and domain information
>PRK01966 ddl D-alanyl-alanine synthetase A; Reviewed Back     alignment and domain information
>PRK02186 argininosuccinate lyase; Provisional Back     alignment and domain information
>TIGR00514 accC acetyl-CoA carboxylase, biotin carboxylase subunit Back     alignment and domain information
>PRK14571 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK12833 acetyl-CoA carboxylase biotin carboxylase subunit; Provisional Back     alignment and domain information
>TIGR01235 pyruv_carbox pyruvate carboxylase Back     alignment and domain information
>PRK13790 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK12999 pyruvate carboxylase; Reviewed Back     alignment and domain information
>TIGR01142 purT phosphoribosylglycinamide formyltransferase 2 Back     alignment and domain information
>PRK08591 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PRK13277 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase-like protein; Provisional Back     alignment and domain information
>PRK00885 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK07178 pyruvate carboxylase subunit A; Validated Back     alignment and domain information
>PRK14568 vanB D-alanine--D-lactate ligase; Provisional Back     alignment and domain information
>TIGR00877 purD phosphoribosylamine--glycine ligase Back     alignment and domain information
>PRK10507 bifunctional glutathionylspermidine amidase/glutathionylspermidine synthetase; Provisional Back     alignment and domain information
>PRK05586 biotin carboxylase; Validated Back     alignment and domain information
>PRK06395 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK14569 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK13278 purP 5-formaminoimidazole-4-carboxamide-1-(beta)-D-ribofuranosyl 5'-monophosphate synthetase; Provisional Back     alignment and domain information
>PHA02117 glutathionylspermidine synthase domain-containing protein Back     alignment and domain information
>PRK06111 acetyl-CoA carboxylase biotin carboxylase subunit; Validated Back     alignment and domain information
>PRK09288 purT phosphoribosylglycinamide formyltransferase 2; Validated Back     alignment and domain information
>PRK06019 phosphoribosylaminoimidazole carboxylase ATPase subunit; Reviewed Back     alignment and domain information
>PRK12815 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>PRK14572 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG1821 Predicted ATP-utilizing enzyme (ATP-grasp superfamily) [General function prediction only] Back     alignment and domain information
>PF01071 GARS_A: Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain; InterPro: IPR020561 Phosphoribosylglycinamide synthetase (6 Back     alignment and domain information
>PF02786 CPSase_L_D2: Carbamoyl-phosphate synthase L chain, ATP binding domain; InterPro: IPR005479 Carbamoyl phosphate synthase (CPSase) is a heterodimeric enzyme composed of a small and a large subunit (with the exception of CPSase III, see below) Back     alignment and domain information
>PF07478 Dala_Dala_lig_C: D-ala D-ala ligase C-terminus; InterPro: IPR011095 This entry represents the C-terminal, catalytic domain of the D-alanine--D-alanine ligase enzyme 6 Back     alignment and domain information
>PRK14570 D-alanyl-alanine synthetase A; Provisional Back     alignment and domain information
>PRK05784 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>COG2308 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02712 urea_carbox urea carboxylase Back     alignment and domain information
>COG0754 Gsp Glutathionylspermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13789 phosphoribosylamine--glycine ligase; Provisional Back     alignment and domain information
>PRK06524 biotin carboxylase-like protein; Validated Back     alignment and domain information
>PRK05294 carB carbamoyl phosphate synthase large subunit; Reviewed Back     alignment and domain information
>COG4770 Acetyl/propionyl-CoA carboxylase, alpha subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01369 CPSaseII_lrg carbamoyl-phosphate synthase, large subunit Back     alignment and domain information
>PLN02257 phosphoribosylamine--glycine ligase Back     alignment and domain information
>KOG0238|consensus Back     alignment and domain information
>COG1038 PycA Pyruvate carboxylase [Energy production and conversion] Back     alignment and domain information
>COG3919 Predicted ATP-grasp enzyme [General function prediction only] Back     alignment and domain information
>COG2232 Predicted ATP-dependent carboligase related to biotin carboxylase [General function prediction only] Back     alignment and domain information
>PLN02735 carbamoyl-phosphate synthase Back     alignment and domain information
>PF04174 CP_ATPgrasp_1: A circularly permuted ATPgrasp ; InterPro: IPR007302 This is a domain of unknown function Back     alignment and domain information
>KOG0369|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
3tig_A 380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 4e-20
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Length = 380 Back     alignment and structure
 Score = 85.0 bits (210), Expect = 4e-20
 Identities = 39/187 (20%), Positives = 61/187 (32%), Gaps = 45/187 (24%)

Query: 1   MSLHHRVNHFPGMANLESKAILAYHLNRMK------YFFPDEYNIFPKSWSLPRQWKEVI 54
             L   VN++ G   L  KA L   +           +FP+ Y I+P +   P       
Sbjct: 59  PGLVQLVNYYRGADKLCRKASLVKLIKTSPELTETCTWFPESYVIYPTNEKTPAMRARNG 118

Query: 55  SYNREHMNHFPGMANLESKAILAYHLNRMKYFFPDEYNIFPKSWSLPRQWKEVISYNREH 114
             +  +                            DE   F  S++               
Sbjct: 119 LPDLANAP------------------------RTDEREEFRSSFN---------KKKENE 145

Query: 115 ADETLILKPTRGAEGKGIKILNFIPE----HEVMDQDASCQVYLSNVLLIN--GFKFDLR 168
                I K + GA+G+GI I +   E     +   Q    Q YL + LL+     KFD+R
Sbjct: 146 EGNVWIAKSSSGAKGEGILISSDATELLDFIDNQGQVHVIQKYLESPLLLEPGHRKFDIR 205

Query: 169 VYVLMTS 175
            +VL+ +
Sbjct: 206 SWVLVDN 212
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
3tig_A 380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 100.0
3tig_A 380 TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Si 98.65
1i7n_A309 Synapsin II; synapse, phosphorylation, neuropeptid 97.83
1pk8_A422 RAT synapsin I; ATP binding, ATP grAsp, calcium (I 97.7
2q7d_A 346 Inositol-tetrakisphosphate 1-kinase; inositol kina 97.68
1gsa_A316 Glutathione synthetase; ligase; HET: ADP GSH; 2.00 97.64
1z2n_X 324 Inositol 1,3,4-trisphosphate 5/6-kinase; inositol 97.56
2p0a_A 344 Synapsin-3, synapsin III; neurotransmitter release 97.53
3n6x_A474 Putative glutathionylspermidine synthase; domain o 97.36
1iow_A 306 DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen pho 97.13
1uc8_A280 LYSX, lysine biosynthesis enzyme; alpha-aminoadipa 97.06
2pn1_A 331 Carbamoylphosphate synthase large subunit; ZP_0053 97.05
2cqy_A108 Propionyl-COA carboxylase alpha chain, mitochondri 96.91
3ln6_A 750 Glutathione biosynthesis bifunctional protein GSH; 96.9
4dim_A 403 Phosphoribosylglycinamide synthetase; structural g 96.78
3t7a_A 330 Inositol pyrophosphate kinase; ATP-grAsp fold, tra 96.58
2io8_A619 Bifunctional glutathionylspermidine synthetase/ami 96.41
3ln7_A 757 Glutathione biosynthesis bifunctional protein GSH; 96.31
4eg0_A317 D-alanine--D-alanine ligase; structural genomics, 96.2
2i87_A 364 D-alanine-D-alanine ligase; APO; 2.00A {Staphyloco 95.99
3df7_A 305 Putative ATP-grAsp superfamily protein; putative p 95.98
3ax6_A 380 Phosphoribosylaminoimidazole carboxylase, ATPase; 95.91
3ouz_A 446 Biotin carboxylase; structural genomics, center fo 95.84
2ip4_A 417 PURD, phosphoribosylamine--glycine ligase; GAR syn 95.71
1e4e_A 343 Vancomycin/teicoplanin A-type resistance protein; 95.66
4ffl_A 363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 95.54
3r5x_A 307 D-alanine--D-alanine ligase; alpha-beta structure, 95.51
2pbz_A 320 Hypothetical protein; NYSGXRC, PSI-II, IMP biosynt 95.51
4fu0_A 357 D-alanine--D-alanine ligase 7; vancomycin resistan 95.51
2yw2_A 424 Phosphoribosylamine--glycine ligase; glycinamide r 95.5
2dzd_A 461 Pyruvate carboxylase; biotin carboxylase, ligase; 95.48
2r85_A 334 PURP protein PF1517; ATP-grAsp superfamily, unknow 95.46
3orq_A 377 N5-carboxyaminoimidazole ribonucleotide synthetas; 95.31
1ulz_A 451 Pyruvate carboxylase N-terminal domain; biotin car 95.22
2z04_A 365 Phosphoribosylaminoimidazole carboxylase ATPase su 95.16
2vpq_A 451 Acetyl-COA carboxylase; bacteria, ATP-grAsp domain 95.13
3lp8_A 442 Phosphoribosylamine-glycine ligase; ssgcid, NIH, n 95.11
2fb9_A 322 D-alanine:D-alanine ligase; 1.90A {Thermus caldoph 95.08
1kjq_A 391 GART 2, phosphoribosylglycinamide formyltransferas 95.04
2yrx_A 451 Phosphoribosylglycinamide synthetase; glycinamide 94.96
2qk4_A 452 Trifunctional purine biosynthetic protein adenosi; 94.89
2xcl_A 422 Phosphoribosylamine--glycine ligase; GAR-SYN, ATP- 94.88
3k3p_A 383 D-alanine--D-alanine ligase; D-alanyl-alanine synt 94.84
3vmm_A 474 Alanine-anticapsin ligase BACD; ATP-grAsp domain, 94.84
2pvp_A 367 D-alanine-D-alanine ligase; 2.40A {Helicobacter py 94.82
3aw8_A 369 PURK, phosphoribosylaminoimidazole carboxylase, AT 94.78
2w70_A 449 Biotin carboxylase; ligase, ATP-binding, fatty aci 94.77
3k5i_A 403 Phosphoribosyl-aminoimidazole carboxylase; purine 94.59
3se7_A 346 VANA; alpha-beta structure, D-alanine-D-lactate li 94.53
1ehi_A 377 LMDDL2, D-alanine:D-lactate ligase; ATP-binding. g 94.49
2vob_A652 Trypanothione synthetase; ligase; 2.3A {Leishmania 94.46
3mjf_A 431 Phosphoribosylamine--glycine ligase; structural ge 94.4
4e4t_A 419 Phosphoribosylaminoimidazole carboxylase, ATPase; 94.34
3tqt_A 372 D-alanine--D-alanine ligase; cell envelope; 1.88A 94.32
3vot_A 425 L-amino acid ligase, BL00235; ATP-grAsp motif, ATP 94.17
3jrx_A 587 Acetyl-COA carboxylase 2; BC domain, soraphen A, a 94.15
3lwb_A 373 D-alanine--D-alanine ligase; DDL, D-alanyl--D-alan 94.12
2dwc_A 433 PH0318, 433AA long hypothetical phosphoribosylglyc 94.07
3e5n_A 386 D-alanine-D-alanine ligase A; bacterial blight; 2. 93.97
1vkz_A 412 Phosphoribosylamine--glycine ligase; TM1250, struc 93.94
1w96_A 554 ACC, acetyl-coenzyme A carboxylase; ligase, obesit 93.76
3glk_A 540 Acetyl-COA carboxylase 2; ATP binding, alternative 93.73
3q2o_A 389 Phosphoribosylaminoimidazole carboxylase, ATPase; 93.55
3i12_A 364 D-alanine-D-alanine ligase A; D-alanyl-alanine syn 93.33
3u9t_A 675 MCC alpha, methylcrotonyl-COA carboxylase, alpha-s 92.98
3n6r_A 681 Propionyl-COA carboxylase, alpha subunit; protein 92.16
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 91.42
3hbl_A 1150 Pyruvate carboxylase; TIM barrel, ligase; HET: BTI 90.04
1a9x_A 1073 Carbamoyl phosphate synthetase (large chain); amid 89.36
2r7k_A 361 5-formaminoimidazole-4-carboxamide-1-(beta)-D- rib 88.45
3eth_A 355 Phosphoribosylaminoimidazole carboxylase ATPase su 87.12
3va7_A 1236 KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A 87.0
2qf7_A 1165 Pyruvate carboxylase protein; multi-domain, multi- 83.79
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
Probab=100.00  E-value=3.1e-39  Score=268.32  Aligned_cols=164  Identities=23%  Similarity=0.224  Sum_probs=129.4

Q ss_pred             CcchhhhHHHHHHHhhh-hhCCC-ccccCCccccCc--ccchhhhhh-cc-cccccCCCCccccchHhHHHHHHHHHhhC
Q psy3858          14 ANLESKAILAYHLNRMK-YFFPD-EYNIFPKSWSLP--RQWKEVISY-NR-EHMNHFPGMANLESKAILAYHLNRMKYFF   87 (180)
Q Consensus        14 ~~~~~k~~l~~~l~~m~-~~~~~-~~~~~p~~W~~~--~~~~~~~~~-~~-q~vNhfpg~~~l~~K~~l~~~l~~~~~~~   87 (180)
                      ...+..+.+.+.|..+| |..+. +...|+..|...  ..+..+... .. |+||||||+.+||+|+.|+++|++++ .+
T Consensus        12 ~~~svy~~V~~vL~~~g~w~ev~~~~~~~dl~W~~~~~~p~~~l~~~p~~~Q~vNhfPg~~~l~rKd~L~~nl~~~~-~~   90 (380)
T 3tig_A           12 ENSTVYAEVAKILLASGQWKRLKRDNPKFNLMLGERNRLPFGRLGHEPGLVQLVNYYRGADKLCRKASLVKLIKTSP-EL   90 (380)
T ss_dssp             SSCHHHHHHHHHHHHTTSEEECCTTCSCCSEEECCSSSCCGGGSSCSTTCCCEESCCTTTHHHHSHHHHHHHHHHCH-HH
T ss_pred             CCccHHHHHHHHHHhcCCeEEeCCCCCceeEEEecCCCCCHHHhccCCCcceEEeecCCcccccccHHHHHHHHHhh-hc
Confidence            35678899999999999 76654 456788889862  224454443 45 99999999999999999999999954 45


Q ss_pred             CCCCCcccccCCC-cch-----------------------HHHHHHHHH----hCCCceEEEcCCCCCCCCCEEEeCCCC
Q psy3858          88 PDEYNIFPKSWSL-PRQ-----------------------WKEVISYNR----EHADETLILKPTRGAEGKGIKILNFIP  139 (180)
Q Consensus        88 ~~~~~~~P~t~~l-p~e-----------------------~~~f~~~~~----~~~~~~wI~KP~~~~~G~GI~l~~~~~  139 (180)
                      ++.++|+|+||.| |.+                       +++|.++++    .+.+++||+||+++++|+||.++++++
T Consensus        91 ~~~~~f~P~ty~L~P~~~~~p~~~~~~~~~~~~~~~~~~E~~~F~~~~~~~~~~~~~~~wI~KP~~~srG~GI~l~~~~~  170 (380)
T 3tig_A           91 TETCTWFPESYVIYPTNEKTPAMRARNGLPDLANAPRTDEREEFRSSFNKKKENEEGNVWIAKSSSGAKGEGILISSDAT  170 (380)
T ss_dssp             HTTCTTSCCEEECCC------------------------CCHHHHHHHHHHHHTTCCCCEEEEESCC----CCBCCSCSH
T ss_pred             ccccCcCCcceeeCccccccccccccccccccccccchhHHHHHHHHHHHhhhcCCCCeEEEeCCccCCCCCEEEeCCHH
Confidence            7889999999999 764                       456777654    356789999999999999999999976


Q ss_pred             ccc----ccCCceEEeeecCCcccc--CCceeEEEEEEEeeeecCCC
Q psy3858         140 EHE----VMDQDASCQVYLSNVLLI--NGFKFDLRVYVLMTSKPNPT  180 (180)
Q Consensus       140 ~~~----~~~~~~vvQ~YI~~P~Li--~g~KfD~R~yvlvts~~Pl~  180 (180)
                      +..    .....+|||+||++|+||  +|+|||||+||||||  ||+
T Consensus       171 ~i~~~~~~~~~~~VvQkYI~~PlLi~~~grKFDlR~Yvlvts--~l~  215 (380)
T 3tig_A          171 ELLDFIDNQGQVHVIQKYLESPLLLEPGHRKFDIRSWVLVDN--QYN  215 (380)
T ss_dssp             HHHHHHHHHTSCEEEEECCSSBCCBTTTTBCEEEEEEEEECT--TCC
T ss_pred             HHHHHHhccCCcEEEEecccCceeecCCCceeEEEEEEEEcC--CCE
Confidence            542    235689999999999999  999999999999998  775
>3tig_A TTL protein; ATP-grAsp, ligase, tubulin; 2.50A {Silurana} PDB: 3tii_A* 3tin_A* Back     alignment and structure
>1i7n_A Synapsin II; synapse, phosphorylation, neuropeptide; 1.90A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1i7l_A 1auv_A 1aux_A* Back     alignment and structure
>1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Back     alignment and structure
>2q7d_A Inositol-tetrakisphosphate 1-kinase; inositol kinase, ITPK1, inositol 1,3,4-5/6 phosphate, inositol phosphate, inositolphosphate; HET: ANP; 1.60A {Homo sapiens} PDB: 2qb5_A* 2odt_X Back     alignment and structure
>1gsa_A Glutathione synthetase; ligase; HET: ADP GSH; 2.00A {Escherichia coli} SCOP: c.30.1.3 d.142.1.1 PDB: 1gsh_A 2glt_A 1glv_A Back     alignment and structure
>1z2n_X Inositol 1,3,4-trisphosphate 5/6-kinase; inositol phosphate kinase, ATP-grAsp, transferase; HET: ADP; 1.20A {Entamoeba histolytica} PDB: 1z2o_X* 1z2p_X* Back     alignment and structure
>2p0a_A Synapsin-3, synapsin III; neurotransmitter release, schizophrenia, vesicle T structural genomics, structural genomics consortium, SGC, neuropeptide; HET: ANP; 1.90A {Homo sapiens} Back     alignment and structure
>3n6x_A Putative glutathionylspermidine synthase; domain of unknown function (DUF404), structural genomics; 2.35A {Methylobacillus flagellatus} Back     alignment and structure
>1iow_A DD-ligase, DDLB, D-ALA\:D-Ala ligase; glycogen phosphorylase, cell WALL, peptidoglycan synthesis, vancomycin, ADP binding; HET: ADP PHY; 1.90A {Escherichia coli} SCOP: c.30.1.2 d.142.1.1 PDB: 1iov_A* 2dln_A* 3v4z_A* Back     alignment and structure
>1uc8_A LYSX, lysine biosynthesis enzyme; alpha-aminoadipate pathway, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: c.30.1.6 d.142.1.7 PDB: 1uc9_A* Back     alignment and structure
>2pn1_A Carbamoylphosphate synthase large subunit; ZP_00538348.1, ATP-grAsp domain, carbamoylphosphate synthase subunit (split gene in MJ); 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2cqy_A Propionyl-COA carboxylase alpha chain, mitochondrial; PCCA, B domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ln6_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamyl cysteine ligase domain, ATP-grAsp domain, HYB enzyme; 2.95A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>4dim_A Phosphoribosylglycinamide synthetase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ligase; 2.61A {Anaerococcus prevotii} Back     alignment and structure
>3t7a_A Inositol pyrophosphate kinase; ATP-grAsp fold, transferase; HET: ADP; 1.70A {Homo sapiens} PDB: 3t9a_A* 3t9b_A* 3t9c_A* 3t9d_A* 3t9e_A* 3t9f_A* 4gb4_A* 4hn2_A* 3t54_A* 3t99_A* Back     alignment and structure
>2io8_A Bifunctional glutathionylspermidine synthetase/amidase; ligase, hydrolase; HET: ADP; 2.10A {Escherichia coli} SCOP: c.30.1.7 d.3.1.15 d.142.1.8 PDB: 2io7_A* 2io9_A* 2ioa_A* 2iob_A 3o98_A* Back     alignment and structure
>3ln7_A Glutathione biosynthesis bifunctional protein GSH; gamma-glutamylcysteine ligase domain, ATP-grAsp domain, HYBR enzyme, ATP-binding; 3.20A {Pasteurella multocida} Back     alignment and structure
>4eg0_A D-alanine--D-alanine ligase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia ambifaria} PDB: 4egq_A 4egj_A Back     alignment and structure
>2i87_A D-alanine-D-alanine ligase; APO; 2.00A {Staphylococcus aureus subsp} PDB: 2i8c_A* 3n8d_A* 2i80_A* Back     alignment and structure
>3df7_A Putative ATP-grAsp superfamily protein; putative protein, PSI-II, nysgrc., structural genomics, protein structure initiative; 1.87A {Archaeoglobus fulgidus} Back     alignment and structure
>3ax6_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp, ATP binding; HET: ADP; 2.20A {Thermotoga maritima} Back     alignment and structure
>3ouz_A Biotin carboxylase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta fold, cytosol, LIG; HET: MSE ADP SRT TLA; 1.90A {Campylobacter jejuni subsp} PDB: 3ouu_A* Back     alignment and structure
>2ip4_A PURD, phosphoribosylamine--glycine ligase; GAR synthetase, purine nucleotid structural genomics, NPPSFA; 2.80A {Thermus thermophilus} Back     alignment and structure
>1e4e_A Vancomycin/teicoplanin A-type resistance protein; ligase, cell WALL, antibiotic resistance, membrane, peptidog synthesis; HET: ADP PHY; 2.5A {Enterococcus faecium} SCOP: c.30.1.2 d.142.1.1 PDB: 1e4e_B* Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3r5x_A D-alanine--D-alanine ligase; alpha-beta structure, cytosol, structural genomics, for structural genomics of infectious diseases, csgid; HET: MSE ATP; 2.00A {Bacillus anthracis} PDB: 3r23_A* Back     alignment and structure
>2pbz_A Hypothetical protein; NYSGXRC, PSI-II, IMP biosynthesis, ATP binding protein, PURP structural genomics, protein structure initiative; HET: ATP; 2.50A {Thermococcus kodakarensis} SCOP: c.30.1.8 d.142.1.9 Back     alignment and structure
>4fu0_A D-alanine--D-alanine ligase 7; vancomycin resistance, peptidoglycan synthesis, D-Ala:D-Ser ATP-grAsp domain; HET: ADP; 2.35A {Enterococcus faecalis} Back     alignment and structure
>2yw2_A Phosphoribosylamine--glycine ligase; glycinamide ribonucleotide synthetase, GAR synthetase, ATP B purine nucleotide biosynthetic pathway; HET: ATP; 1.80A {Aquifex aeolicus} PDB: 2yya_A Back     alignment and structure
>2dzd_A Pyruvate carboxylase; biotin carboxylase, ligase; 2.40A {Geobacillus thermodenitrificans} Back     alignment and structure
>2r85_A PURP protein PF1517; ATP-grAsp superfamily, unknown function; HET: AMP; 1.70A {Pyrococcus furiosus} SCOP: c.30.1.8 d.142.1.9 PDB: 2r84_A* 2r86_A* 2r87_A* Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>1ulz_A Pyruvate carboxylase N-terminal domain; biotin carboxylase; 2.20A {Aquifex aeolicus} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus} Back     alignment and structure
>3lp8_A Phosphoribosylamine-glycine ligase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2fb9_A D-alanine:D-alanine ligase; 1.90A {Thermus caldophilus} PDB: 2zdh_A* 2yzg_A 2yzn_A* 2yzm_A* 2zdg_A* 2zdq_A* Back     alignment and structure
>1kjq_A GART 2, phosphoribosylglycinamide formyltransferase 2, 5'-; ATP-grAsp, purine biosynthesis, nucleotide; HET: ADP MPO; 1.05A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1kj9_A* 1kji_A* 1kjj_A* 1kj8_A* 1eyz_A* 1ez1_A* Back     alignment and structure
>2yrx_A Phosphoribosylglycinamide synthetase; glycinamide ribonucleotide synthetase, GAR synthetase; HET: AMP; 1.90A {Geobacillus kaustophilus} PDB: 2yrw_A* 2ys6_A* 2ys7_A Back     alignment and structure
>2qk4_A Trifunctional purine biosynthetic protein adenosi; purine synthesis, enzyme, protein-ATP complex, structural GE structural genomics consortium, SGC; HET: ATP; 2.45A {Homo sapiens} Back     alignment and structure
>2xcl_A Phosphoribosylamine--glycine ligase; GAR-SYN, ATP-grAsp, metal binding; HET: ANP; 2.10A {Bacillus subtilis} PDB: 2xd4_A* Back     alignment and structure
>3k3p_A D-alanine--D-alanine ligase; D-alanyl-alanine synthetase, ATP-binding, cell shape, cell W biogenesis/degradation, magnesium, manganese; 2.23A {Streptococcus mutans} Back     alignment and structure
>3vmm_A Alanine-anticapsin ligase BACD; ATP-grAsp domain, amino acid ligase, ATP binding; HET: ADP P0D; 2.50A {Bacillus subtilis} Back     alignment and structure
>2pvp_A D-alanine-D-alanine ligase; 2.40A {Helicobacter pylori} Back     alignment and structure
>3aw8_A PURK, phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, riken structural genomics/proteomics in RSGI, ATP grAsp; HET: AMP; 2.60A {Thermus thermophilus} Back     alignment and structure
>2w70_A Biotin carboxylase; ligase, ATP-binding, fatty acid biosynthesis, nucleotide-BIN lipid synthesis, ATP-grAsp domain, fragment screening; HET: L22; 1.77A {Escherichia coli} PDB: 1bnc_A 2j9g_A* 2v58_A* 2v59_A* 2v5a_A* 2vr1_A* 2w6m_A* 1dv1_A* 2w6o_A* 2w6n_A* 2w6q_A* 2w6z_A* 2w6p_A* 2w71_A* 3jzf_A* 3jzi_A* 3rv3_A* 3rup_A* 1dv2_A* 3rv4_A* ... Back     alignment and structure
>3k5i_A Phosphoribosyl-aminoimidazole carboxylase; purine biosynthesis, ATP-grAsp, lyase; HET: NHE ADP AIR; 2.00A {Aspergillus clavatus} PDB: 3k5h_A* Back     alignment and structure
>3se7_A VANA; alpha-beta structure, D-alanine-D-lactate ligase, ligase; HET: ATP; 3.07A {} Back     alignment and structure
>1ehi_A LMDDL2, D-alanine:D-lactate ligase; ATP-binding. grAsp motif for ATP.; HET: ADP PHY; 2.38A {Leuconostoc mesenteroides} SCOP: c.30.1.2 d.142.1.1 Back     alignment and structure
>2vob_A Trypanothione synthetase; ligase; 2.3A {Leishmania major} PDB: 2vps_A 2vpm_A Back     alignment and structure
>3mjf_A Phosphoribosylamine--glycine ligase; structural genomics, CEN structural genomics of infectious diseases, csgid; HET: MSE PGE; 1.47A {Yersinia pestis} PDB: 1gso_A Back     alignment and structure
>4e4t_A Phosphoribosylaminoimidazole carboxylase, ATPase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.55A {Burkholderia ambifaria} PDB: 3uvz_A Back     alignment and structure
>3tqt_A D-alanine--D-alanine ligase; cell envelope; 1.88A {Coxiella burnetii} Back     alignment and structure
>3vot_A L-amino acid ligase, BL00235; ATP-grAsp motif, ATP-binding; HET: ADP PG4; 1.80A {Bacillus licheniformis} Back     alignment and structure
>3jrx_A Acetyl-COA carboxylase 2; BC domain, soraphen A, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis; HET: S1A; 2.50A {Homo sapiens} PDB: 3jrw_A* Back     alignment and structure
>3lwb_A D-alanine--D-alanine ligase; DDL, D-alanyl--D-alanine ligase RV2981C, structural genomics, TB structural GENO consortium, TBSGC; 2.10A {Mycobacterium tuberculosis} Back     alignment and structure
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide transferase; purine ribonucleotide biosynthesis; HET: ADP; 1.70A {Pyrococcus horikoshii} PDB: 2czg_A* Back     alignment and structure
>3e5n_A D-alanine-D-alanine ligase A; bacterial blight; 2.00A {Xanthomonas oryzae PV} PDB: 3r5f_A* 3rfc_A* Back     alignment and structure
>1vkz_A Phosphoribosylamine--glycine ligase; TM1250, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 Back     alignment and structure
>1w96_A ACC, acetyl-coenzyme A carboxylase; ligase, obesity, diabetes, fatty acid metabolism, structure-based drug design; HET: S1A; 1.8A {Saccharomyces cerevisiae} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1w93_A Back     alignment and structure
>3glk_A Acetyl-COA carboxylase 2; ATP binding, alternative splicing, ATP-binding, biotin, fatty acid biosynthesis, ligase, lipid synthesis, manganese; 2.10A {Homo sapiens} PDB: 3gid_A 2hjw_A 2yl2_A Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3i12_A D-alanine-D-alanine ligase A; D-alanyl-alanine synthetase A, ADP binding protein, csgid, A binding, cell shape; HET: ADP; 2.20A {Salmonella typhimurium} PDB: 3q1k_A* Back     alignment and structure
>3n6r_A Propionyl-COA carboxylase, alpha subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Ruegeria pomeroyi} Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>3hbl_A Pyruvate carboxylase; TIM barrel, ligase; HET: BTI ADP; 2.71A {Staphylococcus aureus subsp} PDB: 3bg5_A* 3ho8_A* 4hnu_A* 4hnt_A* 4hnv_A* 3hb9_A* Back     alignment and structure
>1a9x_A Carbamoyl phosphate synthetase (large chain); amidotransferase, thioester; HET: CYG ADP; 1.80A {Escherichia coli} SCOP: a.92.1.1 c.24.1.1 c.30.1.1 c.30.1.1 d.142.1.2 d.142.1.2 PDB: 1ce8_A* 1m6v_A* 1c30_A* 1bxr_A* 1c3o_A* 1cs0_A* 1jdb_B* 1kee_A* 1t36_A* Back     alignment and structure
>2r7k_A 5-formaminoimidazole-4-carboxamide-1-(beta)-D- ribofuranosyl 5'-monophosphate synthetase...; ATP-grAsp superfamily, ATP-binding; HET: ACP AMZ; 2.10A {Methanocaldococcus jannaschii} SCOP: c.30.1.8 d.142.1.9 PDB: 2r7l_A* 2r7m_A* 2r7n_A* Back     alignment and structure
>3eth_A Phosphoribosylaminoimidazole carboxylase ATPase subunit; ATP-grAsp, purine biosynthesis, antimicrobial, ATP-binding, decarboxylase, lyase; HET: ATP; 1.60A {Escherichia coli} SCOP: b.84.2.1 c.30.1.1 d.142.1.2 PDB: 1b6r_A* 3etj_A* 1b6s_A* Back     alignment and structure
>3va7_A KLLA0E08119P; carboxylase, ligase; HET: BTI; 2.60A {Kluyveromyces lactis} Back     alignment and structure
>2qf7_A Pyruvate carboxylase protein; multi-domain, multi-functional, biotin-dependent, ligase; HET: KCX COA AGS; 2.00A {Rhizobium etli} PDB: 3tw6_A* 3tw7_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d1gsaa2192 Prokaryotic glutathione synthetase, C-domain {Esch 97.95
d1i7na2206 Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116 97.76
d1uc8a2192 Lysine biosynthesis enzyme LysX ATP-binding domain 97.44
d1ulza3214 Biotin carboxylase (BC), domain 2 {Aquifex aeolicu 96.38
d2io8a3297 Glutathionylspermidine synthase, synthetase domain 96.34
d1iowa2210 D-ala-D-ala ligase, C-domain {Escherichia coli, ge 96.29
d2r85a2 235 5-formaminoimidazole-4-carboxamide ribonucleotide 95.59
d1w96a3 267 Acetyl-CoA carboxylase, BC-M subdomain {Baker's ye 95.19
d1vkza3 220 Glycinamide ribonucleotide synthetase (GAR-syn), d 94.91
d2r7ka2 238 5-formaminoimidazole-4-carboxamide ribonucleotide 94.1
d1e4ea2 211 D-alanine:D-lactate ligase VanA, C-domain {Enteroc 93.69
d1gsoa3 224 Glycinamide ribonucleotide synthetase (GAR-syn), d 93.25
d1ehia2 228 D-alanine:D-lactate ligase VanA, C-domain {Leucono 92.81
d1a9xa6 259 Carbamoyl phosphate synthetase (CPS), large subuni 91.74
d1kjqa3206 Glycinamide ribonucleotide transformylase PurT, do 90.38
d1a9xa5 275 Carbamoyl phosphate synthetase (CPS), large subuni 89.58
d2j9ga3216 Biotin carboxylase (BC), domain 2 {Escherichia col 88.83
>d1gsaa2 d.142.1.1 (A:123-314) Prokaryotic glutathione synthetase, C-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATP-grasp
superfamily: Glutathione synthetase ATP-binding domain-like
family: ATP-binding domain of peptide synthetases
domain: Prokaryotic glutathione synthetase, C-domain
species: Escherichia coli [TaxId: 562]

Probab=97.95  E-value=6.7e-06  Score=60.05  Aligned_cols=74  Identities=23%  Similarity=0.267  Sum_probs=50.7

Q ss_pred             CcccccCCCcchHHHHHHHHHhCCCceEEEcCCCCCCCCCEEEeCCCCcc---------cccCCceEEeeecCCccccCC
Q psy3858          92 NIFPKSWSLPRQWKEVISYNREHADETLILKPTRGAEGKGIKILNFIPEH---------EVMDQDASCQVYLSNVLLING  162 (180)
Q Consensus        92 ~~~P~t~~lp~e~~~f~~~~~~~~~~~wI~KP~~~~~G~GI~l~~~~~~~---------~~~~~~~vvQ~YI~~P~Li~g  162 (180)
                      +++|+|++.. +.++..+.+++.  ..+|+||..|+.|+|+.++..-...         ......+++|+|++..     
T Consensus        11 ~~~P~Tlit~-~~~~~~~f~~~~--g~vV~Kpl~gs~G~gv~~~~~~~~~~~~~~~~~~~~~~~~~~~q~~~~~~-----   82 (192)
T d1gsaa2          11 DLTPETLVTR-NKAQLKAFWEKH--SDIILKPLDGMGGASIFRVKEGDPNLGVIAETLTEHGTRYCMAQNYLPAI-----   82 (192)
T ss_dssp             TTSCCEEEES-CHHHHHHHHHHH--SSEEEECSSCCTTTTCEEECTTCTTHHHHHHHHTTTTTSCEEEEECCGGG-----
T ss_pred             ccCCCeEEEC-CHHHHHHHHHHc--CCeEEEEcCCCeEEEEEEeecCchhhhHHHHHHHhcCccccccccccccc-----
Confidence            5799998873 223333333332  3699999999999999999753211         1234467889999742     


Q ss_pred             ceeEEEEEEEe
Q psy3858         163 FKFDLRVYVLM  173 (180)
Q Consensus       163 ~KfD~R~yvlv  173 (180)
                      .+.|+|++|+-
T Consensus        83 ~~~d~Rv~vv~   93 (192)
T d1gsaa2          83 KDGDKRVLVVD   93 (192)
T ss_dssp             GGCEEEEEEET
T ss_pred             cCceeEEEEEC
Confidence            46899999974
>d1i7na2 d.142.1.3 (A:215-420) Synapsin II {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uc8a2 d.142.1.7 (A:89-280) Lysine biosynthesis enzyme LysX ATP-binding domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ulza3 d.142.1.2 (A:115-328) Biotin carboxylase (BC), domain 2 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2io8a3 d.142.1.8 (A:201-378,A:497-615) Glutathionylspermidine synthase, synthetase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iowa2 d.142.1.1 (A:97-306) D-ala-D-ala ligase, C-domain {Escherichia coli, gene ddlB [TaxId: 562]} Back     information, alignment and structure
>d2r85a2 d.142.1.9 (A:100-334) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1w96a3 d.142.1.2 (A:184-450) Acetyl-CoA carboxylase, BC-M subdomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vkza3 d.142.1.2 (A:94-313) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r7ka2 d.142.1.9 (A:124-361) 5-formaminoimidazole-4-carboxamide ribonucleotide synthetase PurP {Methanocaldococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e4ea2 d.142.1.1 (A:132-342) D-alanine:D-lactate ligase VanA, C-domain {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1gsoa3 d.142.1.2 (A:104-327) Glycinamide ribonucleotide synthetase (GAR-syn), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ehia2 d.142.1.1 (A:135-362) D-alanine:D-lactate ligase VanA, C-domain {Leuconostoc mesenteroides, Ddl2 [TaxId: 1245]} Back     information, alignment and structure
>d1a9xa6 d.142.1.2 (A:677-935) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kjqa3 d.142.1.2 (A:113-318) Glycinamide ribonucleotide transformylase PurT, domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a9xa5 d.142.1.2 (A:128-402) Carbamoyl phosphate synthetase (CPS), large subunit ATP-binding domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j9ga3 d.142.1.2 (A:115-330) Biotin carboxylase (BC), domain 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure