Psyllid ID: psy3926


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510--
MTEELNAAKELSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPDVEREESRKQPKNPVFSNIDFSGPRDSDSKNVESSNGSDSDSTPNLFPSANKSSNIFPSADKSSNLFPTADKSSHLFPIADKSSNLFPSADKSSNIFSSSSKPRNVFPSGLFPSANVSSNIFASSDRTLPEPHISWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENERYKGYKVNKSEEEILQQEIDRLRKEGSIRLQEEIKLMTEELNAAKELSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPDVEREESRKQPKNPVFSNIDFSGPR
cHHHHHHHHHHHHHHHcccccccEEEEEEEEcccccccccHHHHHHHHHHHccEEEEEEcccccccEEEEEccHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEEEcccccccccHHHHHHHHHccccccEEEEccccccEEEEEEccHHHHHHHHHHHHcccccccEEEEcccccccccccccccccccccccccccc
cHHHHHHHHHHHcccccccccccEEEEEEEEcccccccccHHHHHHHHHHcccEEEEEEEcccccEEEEEEccHHHHHHHHHHHccccccccEEEEEcccccccccccccccccEEEcEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccEEHHHHHHHHHHHHHHHHcccHHHHHcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHcEEEEEEEccccccccccHHHHHHHHHHHccEEEEEEEcccccEEEEEEccHHHHHHHHHHHcccccccEEEEEccccccccccccccccccccccEEcccc
MTEELNAAKELSELNaklnpenyrlrirwkssstdtdvytRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYelglpncpltlnylnpdvereesrkqpknpvfsnidfsgprdsdsknvessngsdsdstpnlfpsankssnifpsadkssnlfptadksshlfpiadkssnlfpsadkssnifsssskprnvfpsglfpsanvssnifassdrtlpephiswsfpaiplssimadikdldLYGLLELTIDCSEQDIRSAYRKKAlkchpdknpddkkAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENerykgykvnksEEEILQQEIDRLRKEGSIRLQEEIKLMTEELNAAKELSELNaklnpenyrlrirwkssstdtdvytRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYelglpncpltlnylnpdvereesrkqpknpvfsnidfsgpr
MTEELNAAKELSelnaklnpenyrlrirwkssstdtdvytrESLTKifskygkinilvispkKRGSALLEFEHADSARRAKLYelglpncpltLNYLNPDVEreesrkqpknpvfsnidfsgprdsdSKNVEssngsdsdstpnlfPSANKSSNIFPSADKSSNLFPTADKSSHLFPIADKSSNLFPSADKSSNIFSSSSKPRNVFPSGLFPSANVSSNIFASSDRTLPEPHISWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKalkchpdknpddkKAIETFHLLSKAIEVLLDKSARAaydsvirrkeevkirnskldatrkkfkedlerrekeaenerykgykvnkseeeiLQQEIDRLRKEGSIRLQEEIKLMTEELNAAKELSelnaklnpenyrlrirwkssstdtdvytrESLTKifskygkinilvispkKRGSALLEFEHADSARRAKLYelglpncpltLNYLNPDVEreesrkqpknpvfsnidfsgpr
MTEELNAAKELSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPDVEREESRKQPKNPVFSNIDFSGPRDSDSKNVESSNGSDSDSTPNLFPSANKSSNIFPSADKSSNLFPTADKSSHLFPIADKSSNLFPsadkssnifssssKPRNVFPSGLFPSANVSSNIFASSDRTLPEPHISWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENERYKGYKVNKSEEEILQQEIDRLRKEGSIRLQEEIKLMTEELNAAKELSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPDVEREESRKQPKNPVFSNIDFSGPR
**********************YRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLN************************************************************************************************************************************PHISWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALK***********AIETFHLLSKAIEVLLDKSARAAYDSVI*******************************************************************************************NYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLN**************************
*************************RIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLN******************************************************************************H*****************************************V***********************IPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDS************************************************************************************************LRIRWKSSS****VYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLN*****************************
********KELSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPD**********KNPVFSNIDFSG********************PNLFPSANKSSNIFPSADKSSNLFPTADKSSHLFPIADKSSNLFPSADKSSNIFSSSSKPRNVFPSGLFPSANVSSNIFASSDRTLPEPHISWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFK**************YKGYKVNKSEEEILQQEIDRLRKEGSIRLQEEIKLMTEELNAAKELSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPD**********KNPVFSNIDFSGPR
***************AKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPD**************FSNI**SGPRD******************************************************************************NVFPSGLFPSANVSSNIFASSDRTLPEPHISWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENER*******KSEEEILQQEIDRLRKEGSIRLQEEIKLMTEELNAAKELS****KLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNP*************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEELNAAKELSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPDVEREESRKQPKNPVFSNIDFSGPRDSDSKNVESSNGSDSDSTPNLFPSANKSSNIFPSADKSSNLFPTADKSSHLFPIADKSSNLFPSADKSSNIFSSSSKPRNVFPSGLFPSANVSSNIFASSDRTLPEPHISWSFPAIPLSSIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDSVIRRKEEVKIRxxxxxxxxxxxxxxxxxxxxxxxxxxxxGxxxxxxxxxxxxxxxxxxxxxGxxxxxxxxxxxxxxxxxxxxxSELNAKLNPENYRLRIRWKSSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLNYLNPDVEREESRKQPKNPVFSNIDFSGPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query512 2.2.26 [Sep-21-2011]
Q2KI83304 DnaJ homolog subfamily C yes N/A 0.470 0.792 0.392 7e-40
Q91WT4303 DnaJ homolog subfamily C yes N/A 0.443 0.749 0.356 2e-37
Q9NVM6304 DnaJ homolog subfamily C yes N/A 0.443 0.746 0.356 3e-36
Q9P7C6289 Pre-mRNA-splicing factor yes N/A 0.402 0.712 0.336 4e-19
Q5FGQ8 382 Chaperone protein DnaJ OS yes N/A 0.123 0.164 0.571 2e-11
Q5HCG4 382 Chaperone protein DnaJ OS yes N/A 0.123 0.164 0.571 2e-11
C5BQ32 376 Chaperone protein DnaJ OS yes N/A 0.123 0.167 0.571 3e-11
A6QBG7 377 Chaperone protein DnaJ OS yes N/A 0.130 0.177 0.462 5e-11
A6Q486 373 Chaperone protein DnaJ OS yes N/A 0.128 0.176 0.5 5e-10
Q2GI75 380 Chaperone protein DnaJ OS yes N/A 0.123 0.165 0.523 5e-10
>sp|Q2KI83|DJC17_BOVIN DnaJ homolog subfamily C member 17 OS=Bos taurus GN=DNAJC17 PE=2 SV=1 Back     alignment and function desciption
 Score =  165 bits (418), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 97/247 (39%), Positives = 152/247 (61%), Gaps = 6/247 (2%)

Query: 244 SIMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIE 303
           ++  ++  +DLY LL +     +++++ AYR+KAL CHPDKNPD+ +A E FH LS+A+E
Sbjct: 2   AVTKELLQMDLYALLGIEEKAEDKEVKKAYRQKALSCHPDKNPDNPRAAELFHQLSQALE 61

Query: 304 VLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENERYKGYKVNKSE 363
           VL D +ARAAYD V + K++   R  KLD  RKK K DLE RE++A+       +     
Sbjct: 62  VLTDAAARAAYDKVRKAKKQAAERTQKLDERRKKVKLDLEARERQAQA-LGSEEEEESGS 120

Query: 364 EEILQQEIDRLRKEGSIRLQEEIKLMTEELNAAKELSELNAKLNPEN-----YRLRIRWK 418
              L+QEI+RLR+EGS +L+E+ +L+ E++   +E        NPEN      +L+ + K
Sbjct: 121 ARTLEQEIERLREEGSRQLEEQQRLIREQIRQEQEQRLTGMAKNPENKETPKLKLKWKSK 180

Query: 419 SSSTDTDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNC 478
             +     Y+R+ L ++F KYG++  LV+S KK G+A++EF    +A  A   E+GL + 
Sbjct: 181 KEAESQGGYSRDVLLQLFQKYGEVLNLVLSSKKAGTAVVEFATVKAAELAVQNEVGLVDN 240

Query: 479 PLTLNYL 485
           PL +++L
Sbjct: 241 PLKISWL 247





Bos taurus (taxid: 9913)
>sp|Q91WT4|DJC17_MOUSE DnaJ homolog subfamily C member 17 OS=Mus musculus GN=Dnajc17 PE=2 SV=2 Back     alignment and function description
>sp|Q9NVM6|DJC17_HUMAN DnaJ homolog subfamily C member 17 OS=Homo sapiens GN=DNAJC17 PE=1 SV=1 Back     alignment and function description
>sp|Q9P7C6|CWC23_SCHPO Pre-mRNA-splicing factor cwf23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwf23 PE=1 SV=2 Back     alignment and function description
>sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain Arkansas) GN=dnaJ PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
157103359300 hypothetical protein AaeL_AAEL000042 [Ae 0.470 0.803 0.477 3e-57
312378028305 hypothetical protein AND_10507 [Anophele 0.470 0.790 0.504 2e-55
118780738308 AGAP003825-PA [Anopheles gambiae str. PE 0.466 0.775 0.468 7e-54
378466099289 DnaJ-15 [Bombyx mori] 0.457 0.809 0.477 4e-51
357610892293 hypothetical protein KGM_10805 [Danaus p 0.451 0.788 0.477 4e-50
91079022286 PREDICTED: similar to DnaJ (Hsp40) homol 0.455 0.814 0.458 5e-50
170044161305 conserved hypothetical protein [Culex qu 0.470 0.790 0.460 3e-49
242024720294 conserved hypothetical protein [Pediculu 0.447 0.778 0.461 3e-47
340714558291 PREDICTED: dnaJ homolog subfamily C memb 0.441 0.776 0.470 5e-47
194902094299 GG17232 [Drosophila erecta] gi|190652289 0.458 0.785 0.422 2e-46
>gi|157103359|ref|XP_001647945.1| hypothetical protein AaeL_AAEL000042 [Aedes aegypti] gi|108884777|gb|EAT49002.1| AAEL000042-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  229 bits (583), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 169/247 (68%), Gaps = 6/247 (2%)

Query: 246 MADIK---DLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAI 302
           M D+K   ++DLYGLL + I  +E ++R AYRKKAL+CHPDKNPD+ KA E F  LSKA+
Sbjct: 1   MVDVKKFSEIDLYGLLGIEIGATEAEVRKAYRKKALQCHPDKNPDNPKAAELFQELSKAL 60

Query: 303 EVLLDKSARAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENERYKGYKVNKS 362
           E+L+D SARAAYD ++  K+  ++R  +LD+ R+K KEDLE RE++A      GYKV K+
Sbjct: 61  EILIDASARAAYDKLLSAKKAAQLRTQQLDSKRQKLKEDLEERERKAREAAKGGYKVQKT 120

Query: 363 EEEILQQEIDRLRKEGSIRLQEEIKLMTEELNAAKEL-SELNAKLNPENYRLRIRWKSSS 421
            EE+ Q+E +RLRKEGS  ++EE +LM ++L   K +  +  +  +P  +R++I+WK+  
Sbjct: 121 PEELFQEEFERLRKEGSKLIEEEQELMRQQLREEKAMQGKGQSSWDPSKHRIKIKWKAGK 180

Query: 422 TDTD--VYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCP 479
            D +   YT+E L K  SKYG IN+LV+SPKK GSAL+EF+  D+A  A  YE G  + P
Sbjct: 181 DDPENGGYTQEILNKFLSKYGDINVLVMSPKKNGSALVEFKTQDAAEMAVSYEQGRLDNP 240

Query: 480 LTLNYLN 486
            +L ++ 
Sbjct: 241 CSLEWIG 247




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|312378028|gb|EFR24710.1| hypothetical protein AND_10507 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|118780738|ref|XP_310387.5| AGAP003825-PA [Anopheles gambiae str. PEST] gi|116131006|gb|EAA06109.3| AGAP003825-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|378466099|gb|AFC01229.1| DnaJ-15 [Bombyx mori] Back     alignment and taxonomy information
>gi|357610892|gb|EHJ67197.1| hypothetical protein KGM_10805 [Danaus plexippus] Back     alignment and taxonomy information
>gi|91079022|ref|XP_974891.1| PREDICTED: similar to DnaJ (Hsp40) homolog, subfamily C, member 17 [Tribolium castaneum] gi|270003671|gb|EFA00119.1| hypothetical protein TcasGA2_TC002935 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170044161|ref|XP_001849725.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167867422|gb|EDS30805.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|242024720|ref|XP_002432774.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518283|gb|EEB20036.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340714558|ref|XP_003395794.1| PREDICTED: dnaJ homolog subfamily C member 17-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|194902094|ref|XP_001980586.1| GG17232 [Drosophila erecta] gi|190652289|gb|EDV49544.1| GG17232 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query512
FB|FBgn0037882299 CG17187 [Drosophila melanogast 0.476 0.816 0.403 5.4e-47
UNIPROTKB|E2RGH7304 DNAJC17 "Uncharacterized prote 0.468 0.789 0.407 1.2e-44
UNIPROTKB|Q2KI83304 DNAJC17 "DnaJ homolog subfamil 0.470 0.792 0.404 3.9e-44
ZFIN|ZDB-GENE-040426-894307 dnajc17 "DnaJ (Hsp40) homolog, 0.457 0.762 0.414 1.7e-43
UNIPROTKB|F1SST1304 DNAJC17 "Uncharacterized prote 0.496 0.835 0.384 2.2e-43
UNIPROTKB|Q9NVM6304 DNAJC17 "DnaJ homolog subfamil 0.513 0.865 0.372 2.2e-43
UNIPROTKB|E1C0R0304 DNAJC17 "Uncharacterized prote 0.488 0.822 0.399 5.7e-43
MGI|MGI:1916658303 Dnajc17 "DnaJ (Hsp40) homolog, 0.515 0.871 0.373 1.5e-42
RGD|1308015303 Dnajc17 "DnaJ (Hsp40) homolog, 0.515 0.871 0.366 3.2e-42
RGD|1565752303 RGD1565752 "similar to RIKEN c 0.519 0.877 0.349 9.9e-39
FB|FBgn0037882 CG17187 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 492 (178.3 bits), Expect = 5.4e-47, P = 5.4e-47
 Identities = 102/253 (40%), Positives = 163/253 (64%)

Query:   251 DLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSA 310
             D++LY LL ++++  + +IR AYRKKAL+CHPDKNPD+ KA+E FH LSKA+E+L D+SA
Sbjct:     8 DVNLYDLLGISLESDQNEIRKAYRKKALECHPDKNPDNPKAVERFHELSKALEILTDESA 67

Query:   311 RAAYDSVIRRKEEVKIRNSKLDATRKKFKEDLERREKEAENERYKG--YK-VNKSEEEIL 367
             RAAYD V++ K+  ++R+ +LD  R+K K +LE RE+ A ++  K   Y  V KS+EE+L
Sbjct:    68 RAAYDKVLKAKKAAELRSRQLDGKRQKLKLELEERERAALHKLAKSQPYSTVAKSDEEVL 127

Query:   368 QQEIDRLRKEGSIRLQEEIKLMTEEL--NAAKE--LSELNAKLNPENYRLRIRWKSSSTD 423
              ++I+RLR+EGS  L+EE + M E+   N A++  L +   + +   +R++++WK+    
Sbjct:   128 HEQIERLRREGSRLLEEEQRAMQEQFRRNHAEQQKLQQQPVQFDSAQHRIKMKWKAEPGQ 187

Query:   424 TDVYTRESLTKIFSKYGKINILVISPKKRGSALLEFEHADSARRAKLYELGLPNCPLTLN 483
                YT++ L K   KYG +  LV++ K+RG A++E    ++      YE G P  PL   
Sbjct:   188 D--YTQQELLKYLKKYGDVVALVVNSKRRGRAMVELATREACDMVLAYEKGDPAKPLHFE 245

Query:   484 YLNPDVEREESRK 496
             ++ P    +++ K
Sbjct:   246 WVTPPAADKQTTK 258


GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
UNIPROTKB|E2RGH7 DNAJC17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KI83 DNAJC17 "DnaJ homolog subfamily C member 17" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-894 dnajc17 "DnaJ (Hsp40) homolog, subfamily C, member 17" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1SST1 DNAJC17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NVM6 DNAJC17 "DnaJ homolog subfamily C member 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C0R0 DNAJC17 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1916658 Dnajc17 "DnaJ (Hsp40) homolog, subfamily C, member 17" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308015 Dnajc17 "DnaJ (Hsp40) homolog, subfamily C, member 17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1565752 RGD1565752 "similar to RIKEN cDNA 1700025B16" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
pfam0022663 pfam00226, DnaJ, DnaJ domain 5e-20
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 9e-20
cd1242974 cd12429, RRM_DNAJC17, RNA recognition motif in the 9e-20
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 2e-18
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 7e-17
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 2e-15
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 4e-14
TIGR02349354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 2e-13
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 4e-13
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 1e-12
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 5e-12
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 8e-12
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 2e-11
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 2e-11
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 3e-11
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 5e-11
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 1e-10
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 2e-10
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 6e-10
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 1e-09
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 2e-09
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 3e-09
COG2214237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 3e-09
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 5e-09
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 5e-09
PRK14288 369 PRK14288, PRK14288, chaperone protein DnaJ; Provis 6e-09
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 2e-08
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 5e-08
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 8e-08
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-07
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 4e-07
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 4e-07
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-05
pfam1389356 pfam13893, RRM_5, RNA recognition motif 3e-05
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 6e-05
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 8e-05
PRK10266306 PRK10266, PRK10266, curved DNA-binding protein Cbp 8e-05
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 2e-04
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 2e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-04
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 2e-04
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-04
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-04
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 3e-04
smart0036073 smart00360, RRM, RNA recognition motif 3e-04
smart0036073 smart00360, RRM, RNA recognition motif 3e-04
PRK14299291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 3e-04
PHA03102153 PHA03102, PHA03102, Small T antigen; Reviewed 3e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-04
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 4e-04
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-04
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-04
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.001
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.001
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 0.003
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 0.003
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
 Score = 83.3 bits (207), Expect = 5e-20
 Identities = 32/63 (50%), Positives = 41/63 (65%)

Query: 253 DLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARA 312
           D Y +L +  D S+++I+ AYRK ALK HPDKNP D  A E F  +++A EVL D   RA
Sbjct: 1   DYYEILGVPRDASDEEIKKAYRKLALKYHPDKNPGDPAAEEKFKEINEAYEVLSDPEKRA 60

Query: 313 AYD 315
            YD
Sbjct: 61  IYD 63


DnaJ domains (J-domains) are associated with hsp70 heat-shock system and it is thought that this domain mediates the interaction. DnaJ-domain is therefore part of a chaperone (protein folding) system. The T-antigens, although not in Prosite are confirmed as DnaJ containing domains from literature. Length = 63

>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|240875 cd12429, RRM_DNAJC17, RNA recognition motif in the DnaJ homolog subfamily C member 17 Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172776 PRK14288, PRK14288, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|222986 PHA03102, PHA03102, Small T antigen; Reviewed Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 512
KOG0721|consensus230 99.91
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.85
KOG0691|consensus296 99.84
KOG0713|consensus336 99.84
PRK14288 369 chaperone protein DnaJ; Provisional 99.74
PRK14279 392 chaperone protein DnaJ; Provisional 99.72
PRK14296 372 chaperone protein DnaJ; Provisional 99.71
KOG0712|consensus337 99.7
PRK14286 372 chaperone protein DnaJ; Provisional 99.7
KOG0716|consensus279 99.68
KOG0717|consensus 508 99.68
KOG0718|consensus 546 99.67
PRK14294 366 chaperone protein DnaJ; Provisional 99.66
PRK14282 369 chaperone protein DnaJ; Provisional 99.66
PRK14285 365 chaperone protein DnaJ; Provisional 99.66
PRK14295 389 chaperone protein DnaJ; Provisional 99.66
PRK14277 386 chaperone protein DnaJ; Provisional 99.66
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.66
PRK14297 380 chaperone protein DnaJ; Provisional 99.65
PRK14301 373 chaperone protein DnaJ; Provisional 99.65
PRK14287 371 chaperone protein DnaJ; Provisional 99.65
PRK14283 378 chaperone protein DnaJ; Provisional 99.65
PRK14284 391 chaperone protein DnaJ; Provisional 99.64
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.64
PRK14276 380 chaperone protein DnaJ; Provisional 99.64
PRK14299291 chaperone protein DnaJ; Provisional 99.64
PRK10767 371 chaperone protein DnaJ; Provisional 99.63
PRK14278 378 chaperone protein DnaJ; Provisional 99.62
PRK14291 382 chaperone protein DnaJ; Provisional 99.62
PRK14281 397 chaperone protein DnaJ; Provisional 99.62
PRK14298 377 chaperone protein DnaJ; Provisional 99.62
PRK14280 376 chaperone protein DnaJ; Provisional 99.62
PRK14289 386 chaperone protein DnaJ; Provisional 99.61
KOG0715|consensus288 99.59
PRK14290 365 chaperone protein DnaJ; Provisional 99.58
TIGR02349354 DnaJ_bact chaperone protein DnaJ. This model repre 99.57
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.56
PRK14300 372 chaperone protein DnaJ; Provisional 99.55
PRK10266306 curved DNA-binding protein CbpA; Provisional 99.55
KOG0719|consensus264 99.55
PRK14292 371 chaperone protein DnaJ; Provisional 99.55
PRK14293 374 chaperone protein DnaJ; Provisional 99.54
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.53
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.51
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.51
KOG1150|consensus250 99.49
COG2214237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.47
PRK05014171 hscB co-chaperone HscB; Provisional 99.44
PRK03578176 hscB co-chaperone HscB; Provisional 99.4
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.4
PRK00294173 hscB co-chaperone HscB; Provisional 99.38
PRK01356166 hscB co-chaperone HscB; Provisional 99.37
KOG0720|consensus490 99.35
PHA03102153 Small T antigen; Reviewed 99.35
KOG0722|consensus329 99.25
KOG0624|consensus504 99.2
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.2
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.14
KOG0714|consensus306 99.09
KOG0550|consensus486 99.06
PTZ00100116 DnaJ chaperone protein; Provisional 99.03
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 98.99
PRK01773173 hscB co-chaperone HscB; Provisional 98.95
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.95
PHA02624 647 large T antigen; Provisional 98.9
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.8
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 98.71
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.67
KOG0122|consensus270 98.63
KOG0130|consensus170 98.62
COG5269379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.62
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.53
KOG0144|consensus 510 98.45
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.3
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 98.27
KOG0144|consensus 510 98.24
PLN03120 260 nucleic acid binding protein; Provisional 98.22
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 98.21
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 98.21
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 98.09
smart0036071 RRM RNA recognition motif. 98.09
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 98.06
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 98.04
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.02
KOG0114|consensus124 98.01
smart0036272 RRM_2 RNA recognition motif. 98.0
KOG0148|consensus321 97.99
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 97.94
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.93
KOG0146|consensus 371 97.93
KOG4206|consensus 221 97.92
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.92
PLN03121 243 nucleic acid binding protein; Provisional 97.91
KOG1789|consensus 2235 97.9
KOG0117|consensus 506 97.89
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 97.89
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.88
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.87
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.84
KOG0113|consensus 335 97.83
smart0036170 RRM_1 RNA recognition motif. 97.78
KOG0107|consensus195 97.78
smart0036071 RRM RNA recognition motif. 97.77
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 97.72
KOG0132|consensus 894 97.72
KOG4207|consensus 256 97.71
KOG0149|consensus 247 97.7
KOG0145|consensus 360 97.67
smart0036272 RRM_2 RNA recognition motif. 97.67
KOG0121|consensus153 97.66
KOG0568|consensus342 97.65
PLN03213 759 repressor of silencing 3; Provisional 97.65
PF15023166 DUF4523: Protein of unknown function (DUF4523) 97.64
KOG0145|consensus 360 97.62
COG0724306 RNA-binding proteins (RRM domain) [General functio 97.61
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.57
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 97.53
KOG0125|consensus 376 97.44
KOG0111|consensus 298 97.44
PLN03120260 nucleic acid binding protein; Provisional 97.42
KOG0127|consensus 678 97.41
KOG0105|consensus 241 97.4
KOG0153|consensus377 97.38
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 97.32
KOG0415|consensus 479 97.2
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 97.19
PLN03121243 nucleic acid binding protein; Provisional 97.17
KOG0148|consensus 321 97.14
smart0036170 RRM_1 RNA recognition motif. 97.05
KOG0108|consensus 435 96.99
KOG3192|consensus168 96.91
KOG0131|consensus203 96.83
KOG0723|consensus112 96.82
KOG0124|consensus 544 96.76
KOG0107|consensus195 96.69
KOG4206|consensus221 96.69
KOG0123|consensus 369 96.62
KOG0123|consensus 369 96.6
KOG1190|consensus492 96.5
KOG0147|consensus 549 96.47
KOG0130|consensus170 96.42
KOG0127|consensus 678 96.4
KOG4207|consensus256 96.37
KOG0153|consensus377 96.32
KOG0109|consensus 346 96.22
COG0724306 RNA-binding proteins (RRM domain) [General functio 96.13
KOG0131|consensus203 96.12
KOG0149|consensus247 96.09
KOG0110|consensus725 96.09
KOG0122|consensus270 96.06
KOG0117|consensus 506 96.0
KOG4208|consensus214 95.95
KOG0126|consensus219 95.87
KOG0113|consensus335 95.81
KOG1456|consensus 494 95.54
KOG0110|consensus 725 95.49
KOG0114|consensus124 95.46
PF15023166 DUF4523: Protein of unknown function (DUF4523) 95.39
KOG4661|consensus 940 95.28
KOG0124|consensus 544 95.07
KOG1456|consensus 494 95.03
KOG0431|consensus453 94.98
KOG0121|consensus153 94.93
KOG4212|consensus 608 94.9
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 94.81
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.69
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 94.67
KOG4205|consensus 311 94.25
KOG0533|consensus243 94.08
KOG0132|consensus894 94.05
KOG4209|consensus231 93.92
KOG0146|consensus371 93.76
KOG4454|consensus 267 93.66
PLN03213 759 repressor of silencing 3; Provisional 93.36
KOG0109|consensus 346 93.19
KOG1029|consensus 1118 93.15
KOG4660|consensus549 93.07
KOG0125|consensus376 92.93
KOG0151|consensus 877 92.87
KOG0106|consensus 216 92.83
KOG4660|consensus 549 92.69
KOG0105|consensus241 92.6
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 92.41
COG5175 480 MOT2 Transcriptional repressor [Transcription] 92.25
KOG0108|consensus435 92.16
KOG0116|consensus419 91.71
KOG1190|consensus492 91.65
KOG1855|consensus 484 91.3
KOG0147|consensus549 90.99
KOG4205|consensus 311 90.78
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 90.73
KOG2314|consensus 698 90.7
KOG1855|consensus484 88.86
KOG0106|consensus216 88.6
KOG0533|consensus243 88.59
KOG0415|consensus479 87.55
KOG2135|consensus526 87.18
KOG4208|consensus214 86.88
KOG0111|consensus298 86.72
KOG4211|consensus 510 85.85
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 84.57
KOG0126|consensus219 84.5
KOG4212|consensus608 83.85
KOG2314|consensus 698 83.07
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 82.69
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 81.95
KOG2202|consensus260 81.27
KOG0120|consensus500 81.27
KOG1548|consensus382 80.3
>KOG0721|consensus Back     alignment and domain information
Probab=99.91  E-value=1.1e-25  Score=216.09  Aligned_cols=155  Identities=19%  Similarity=0.222  Sum_probs=127.0

Q ss_pred             CCcccccCCCceeeecccccc-ccccccccccccCCCCCCCCCCCCCCCCCCcccccccc------cCCCCCCccccccc
Q psy3926         164 NLFPTADKSSHLFPIADKSSN-LFPSADKSSNIFSSSSKPRNVFPSGLFPSANVSSNIFA------SSDRTLPEPHISWS  236 (512)
Q Consensus       164 ~~f~~~~s~~~f~~~~~~~~~-ll~~~t~~~~p~~~~~~~r~~~~~~~~p~~~~~~~~~~------~s~~~~~~~~~~w~  236 (512)
                      .-|+|||+|+||+||+.++.+ ++.|.|++.+|+...  +......|.|..|..+++.+.      .+.++.+.++++|.
T Consensus         3 ~~~eYDE~g~tf~yflls~~~~i~~P~Ty~~i~~~~~--~~~~~~~c~c~~c~~~r~~~~~~~~k~~~~~~~i~lv~~W~   80 (230)
T KOG0721|consen    3 QDYEYDESGNTFPYFLLSFLAIILLPMTYLLIPRNPE--PPKRKEECQCHGCDKKRRKKAKVSPKSISTKRKVFLVVGWA   80 (230)
T ss_pred             cccccccccCccHHHHHHHHHHHHHHHHHHHhccccc--hhhhhhHHhhhhhhhhhhhhcccCcccchhHHHHHHHHHHH
Confidence            359999999999999999999 999999999995222  222334577877766555333      12355677789999


Q ss_pred             cccchhhh---hcccCCCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHccChhhhhH
Q psy3926         237 FPAIPLSS---IMADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAA  313 (512)
Q Consensus       237 ~~~~~~~~---~~~~~~~~d~YeiLgv~~~As~~eIKkAYRkLa~k~HPDk~~~~~~a~~~F~~I~~AYevLsDp~~R~~  313 (512)
                      +..+++..   ...+....|||+||||+++++..|||+|||+|+++|||||++...+.++.|..|.+||+.|+|+..|.+
T Consensus        81 v~~fL~y~i~~~~~~~~~fDPyEILGl~pgas~~eIKkaYR~LSik~HPDK~~~~~~~e~~~~~I~KAY~aLTD~~sreN  160 (230)
T KOG0721|consen   81 VIAFLIYKIMNSRRERQKFDPYEILGLDPGASEKEIKKAYRRLSIKYHPDKQPPEEGDEEFFEAIAKAYQALTDKKSREN  160 (230)
T ss_pred             HHHHHHHHHhhhhHHhhcCCcHHhhCCCCCCCHHHHHHHHHHhhhhhCCCcCCCcchhHHHHHHHHHHHHHhcchhhHHH
Confidence            99888544   456667899999999999999999999999999999999998645677899999999999999999999


Q ss_pred             HHHHHHH
Q psy3926         314 YDSVIRR  320 (512)
Q Consensus       314 YD~~~~~  320 (512)
                      |..+++.
T Consensus       161 ~ekYG~P  167 (230)
T KOG0721|consen  161 WEKYGNP  167 (230)
T ss_pred             HHHhCCC
Confidence            9999764



>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 6e-09
2ctq_A112 Solution Structure Of J-Domain From Human Dnaj Subf 6e-09
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 9e-09
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 2e-08
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 4e-08
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 5e-08
2ctw_A109 Solution Structure Of J-Domain From Mouse Dnaj Subf 7e-08
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-07
2ej7_A82 Solution Structure Of The Dnaj Domain Of The Human 2e-07
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-07
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 3e-07
3apq_A210 Crystal Structure Of J-Trx1 Fragment Of Erdj5 Lengt 7e-07
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 9e-07
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 9e-06
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 3e-05
2ctp_A78 Solution Structure Of J-Domain From Human Dnaj Subf 4e-05
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 2e-04
2d9o_A100 Solution Structure Of Rna Binding Domain In Hypothe 3e-04
2d9o_A100 Solution Structure Of Rna Binding Domain In Hypothe 3e-04
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 6e-09, Method: Compositional matrix adjust. Identities = 31/70 (44%), Positives = 42/70 (60%), Gaps = 3/70 (4%) Query: 247 ADIKDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLL 306 A +K+ Y +L + D S+ +++ AYRK ALK HPDKNPD E F +S+A EVL Sbjct: 3 AMVKETGYYDVLGVKPDASDNELKKAYRKMALKFHPDKNPD---GAEQFKQISQAYEVLS 59 Query: 307 DKSARAAYDS 316 D+ R YD Sbjct: 60 DEKKRQIYDQ 69
>pdb|2CTQ|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily C Menber 12 Length = 112 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|2CTW|A Chain A, Solution Structure Of J-Domain From Mouse Dnaj Subfamily C Menber 5 Length = 109 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2EJ7|A Chain A, Solution Structure Of The Dnaj Domain Of The Human Protein Hcg3, A Hypothetical Protein Tmp_locus_21 Length = 82 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|3APQ|A Chain A, Crystal Structure Of J-Trx1 Fragment Of Erdj5 Length = 210 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2CTP|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 12 Length = 78 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2D9O|A Chain A, Solution Structure Of Rna Binding Domain In Hypothetical Protein Flj10634 Length = 100 Back     alignment and structure
>pdb|2D9O|A Chain A, Solution Structure Of Rna Binding Domain In Hypothetical Protein Flj10634 Length = 100 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query512
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 2e-19
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 2e-19
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 4e-19
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 1e-18
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 2e-18
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 9e-18
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 3e-17
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 6e-17
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 8e-17
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 1e-16
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 1e-16
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 1e-16
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 1e-16
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 4e-16
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-15
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 6e-15
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 2e-14
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 3e-14
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 3e-14
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 5e-14
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 8e-14
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 9e-14
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 6e-13
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 6e-13
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 8e-13
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 3e-12
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 1e-10
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-10
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 1e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-08
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 9e-08
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 2e-06
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 5e-06
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 6e-06
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 1e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 1e-05
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-05
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 8e-05
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-05
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 3e-05
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-05
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 3e-05
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-04
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-05
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-05
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-05
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 5e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 5e-05
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 1e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-04
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-04
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-04
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-04
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-04
2guz_A71 Mitochondrial import inner membrane translocase su 3e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 6e-04
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 4e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-04
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 6e-04
2krb_A81 Eukaryotic translation initiation factor 3 subunit 7e-04
2krb_A81 Eukaryotic translation initiation factor 3 subunit 7e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 8e-04
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 8e-04
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-04
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-04
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
 Score = 82.5 bits (203), Expect = 2e-19
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 2/87 (2%)

Query: 15 NAKLNPENYRLRIRWKSSSTDTD--VYTRESLTKIFSKYGKINILVISPKKRGSALLEFE 72
          +        +L+++WK    D     Y+++ L ++  KYG++  LV+S KK G+A++EF 
Sbjct: 3  SGSSGQGTPKLKLKWKCKKEDESKGGYSKDVLLRLLQKYGEVLNLVLSSKKPGTAVVEFA 62

Query: 73 HADSARRAKLYELGLPNCPLTLNYLNP 99
             +A  A   E+GL + PL +++L  
Sbjct: 63 TVKAAELAVQNEVGLVDNPLKISWLEG 89


>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Length = 181 Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Length = 207 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.76
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.75
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.74
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.74
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.74
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.74
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.73
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.73
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.73
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.73
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.72
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.71
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.7
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.7
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.69
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.69
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.68
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.67
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.66
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.65
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.64
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.64
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.62
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.59
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.58
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.54
3lz8_A329 Putative chaperone DNAJ; structure genomics, struc 99.54
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.54
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.52
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.51
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.5
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.49
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.49
2guz_A71 Mitochondrial import inner membrane translocase su 99.43
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.41
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.39
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.37
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.36
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.34
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.34
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.33
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.32
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.3
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.29
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.27
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.2
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.18
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.17
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.08
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.08
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.07
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.02
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.02
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.99
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 98.99
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.98
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.96
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.95
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.95
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.95
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.94
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.94
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.93
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.93
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.92
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.91
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.9
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.9
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.89
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.89
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.89
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.89
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.88
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.88
1x5p_A97 Negative elongation factor E; structure genomics, 98.88
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.87
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.86
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.86
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.86
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.86
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.86
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.85
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.85
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.85
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.85
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.84
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.84
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.84
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.84
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.84
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.84
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.84
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.83
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.83
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.83
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.83
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.83
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.82
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.82
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.82
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.81
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.81
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.81
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.81
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.81
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.8
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.8
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.8
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.8
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.79
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 98.79
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.79
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.79
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.78
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.78
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.78
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.78
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.78
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.78
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.78
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.77
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.77
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.77
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.77
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.77
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.76
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.76
2dis_A109 Unnamed protein product; structural genomics, RRM 98.75
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.75
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.75
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.75
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.75
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.75
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.74
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.74
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 98.74
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.74
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.73
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.73
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.73
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.72
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.72
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.72
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.72
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.71
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.71
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.71
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.7
2div_A99 TRNA selenocysteine associated protein; structural 98.7
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.7
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.7
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.7
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.69
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.69
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.69
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.69
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 98.68
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.68
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.68
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.68
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.68
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.67
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.67
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.67
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.67
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 98.67
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.66
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 98.66
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 98.66
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.65
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.64
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.63
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.63
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.63
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.63
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.63
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.63
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.62
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 98.62
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.61
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 98.6
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 98.6
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.6
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.59
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 98.59
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.57
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.56
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 98.55
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.54
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 98.54
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.52
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 98.52
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 98.52
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 98.51
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 98.51
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 98.5
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.49
3n9u_C156 Cleavage and polyadenylation specificity factor S; 98.49
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 98.49
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 98.49
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.49
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 98.49
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.48
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 98.48
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 98.47
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.47
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 98.47
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 98.46
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 98.45
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.45
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.44
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 98.44
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.44
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.44
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 98.44
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.44
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 98.43
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 98.43
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.42
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 98.42
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 98.42
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 97.8
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.42
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 98.42
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 98.42
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 98.42
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 98.41
1x5p_A97 Negative elongation factor E; structure genomics, 98.4
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 98.4
3q2s_C229 Cleavage and polyadenylation specificity factor S; 98.39
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.39
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 98.39
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 98.39
2dnl_A114 Cytoplasmic polyadenylation element binding protei 98.39
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 98.38
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.38
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.38
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 98.37
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 98.36
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 98.36
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 98.36
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.36
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 98.36
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 98.36
2guz_B65 Mitochondrial import inner membrane translocase su 98.36
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.35
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 98.35
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 98.35
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 98.33
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 98.33
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 98.33
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 98.33
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 98.32
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 98.32
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.31
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 98.31
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 98.31
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.31
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 98.3
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 98.3
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 98.3
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 98.3
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 98.3
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 98.3
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 98.29
2i2y_A150 Fusion protein consists of immunoglobin G- binding 98.29
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 98.29
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 98.29
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 98.29
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.29
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.28
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 98.28
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 98.28
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 98.28
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 98.28
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 98.28
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 98.27
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.27
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 98.27
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 98.27
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 98.26
2cpj_A99 Non-POU domain-containing octamer-binding protein; 98.26
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 98.26
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.26
2kt5_A124 RNA and export factor-binding protein 2; chaperone 98.25
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 98.25
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 98.25
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.24
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 98.24
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 98.23
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 98.23
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.23
2dis_A109 Unnamed protein product; structural genomics, RRM 98.23
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.23
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 98.22
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.22
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.22
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 98.21
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 98.21
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 98.2
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.2
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 98.2
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 98.2
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.2
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 98.19
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 98.19
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 98.19
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 98.19
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 98.19
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.18
2la6_A99 RNA-binding protein FUS; structural genomics, nort 98.18
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.18
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 98.18
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 98.17
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 98.17
2div_A99 TRNA selenocysteine associated protein; structural 98.17
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 98.17
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 98.16
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 98.16
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 98.15
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 98.15
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 98.15
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 98.15
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 98.15
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.15
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 98.14
2krb_A81 Eukaryotic translation initiation factor 3 subunit 98.14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 98.14
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 98.14
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 98.14
1x5o_A114 RNA binding motif, single-stranded interacting pro 98.12
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 98.12
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 98.12
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.11
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 98.11
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.11
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.1
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 98.1
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 98.09
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 98.09
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 98.09
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.09
2dit_A112 HIV TAT specific factor 1 variant; structural geno 98.09
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 98.09
3p5t_L90 Cleavage and polyadenylation specificity factor S; 98.08
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 98.08
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.07
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 98.07
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.05
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.05
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 98.05
2f3j_A177 RNA and export factor binding protein 2; RRM domai 98.05
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 98.04
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 98.04
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.01
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 98.0
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 98.0
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 97.97
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 97.96
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 97.96
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 97.95
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 97.95
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 97.94
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.92
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 97.91
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 97.91
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 97.91
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.91
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 97.9
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 97.89
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 97.86
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.86
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 97.85
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.85
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 97.83
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 97.83
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 97.81
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.8
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 97.79
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 97.78
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 97.77
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 96.95
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 97.75
3n9u_C156 Cleavage and polyadenylation specificity factor S; 97.74
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 97.74
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 97.74
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 97.72
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 97.66
3q2s_C229 Cleavage and polyadenylation specificity factor S; 97.66
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 97.65
2dnl_A114 Cytoplasmic polyadenylation element binding protei 97.64
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 97.59
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.52
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 97.51
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 97.51
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 97.49
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 97.46
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 97.41
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 97.34
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.32
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.32
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.31
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 97.21
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 97.2
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 97.19
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.17
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.16
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.13
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 96.97
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 96.68
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 96.67
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 96.38
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 96.32
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 94.27
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 94.19
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 93.93
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 93.86
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 92.45
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 91.43
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 91.21
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 86.23
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 84.62
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 81.84
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 81.26
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 80.76
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.76  E-value=4.9e-19  Score=145.26  Aligned_cols=70  Identities=40%  Similarity=0.561  Sum_probs=65.9

Q ss_pred             CCCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHccChhhhhHHHHHHH
Q psy3926         250 KDLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDSVIR  319 (512)
Q Consensus       250 ~~~d~YeiLgv~~~As~~eIKkAYRkLa~k~HPDk~~~~~~a~~~F~~I~~AYevLsDp~~R~~YD~~~~  319 (512)
                      ...|||+||||+++++..+||+|||+|+++||||++++++.+.+.|+.|++||++|+||.+|..||.++.
T Consensus         5 ~~~~~y~iLgv~~~a~~~~Ik~ayr~l~~~~HPD~~~~~~~a~~~f~~i~~Ay~~L~d~~~R~~YD~~g~   74 (79)
T 2dn9_A            5 SSGDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDDPKAKEKFSQLAEAYEVLSDEVKRKQYDAYGS   74 (79)
T ss_dssp             CCSCHHHHHTCCTTCCHHHHHHHHHHHHHHTCTTTCSSCTTHHHHHHHHHHHHHHHHSHHHHHHHHHSCC
T ss_pred             CCCCHHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCHHHHHHHHHHHHHHHHHCCHHHHHHHHhccC
Confidence            4569999999999999999999999999999999998778899999999999999999999999998753



>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 512
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 8e-13
d1hdja_77 a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9 1e-10
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 2e-10
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 3e-10
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 4e-10
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 5e-09
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 8e-09
d1gh6a_114 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 9e-06
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
 Score = 61.6 bits (149), Expect = 8e-13
 Identities = 28/63 (44%), Positives = 40/63 (63%)

Query: 253 DLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARA 312
           D Y +L ++    E++IR AY++ A+K HPD+N  DK+A   F  + +A EVL D   RA
Sbjct: 4   DYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRA 63

Query: 313 AYD 315
           AYD
Sbjct: 64  AYD 66


>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query512
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.82
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.73
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.65
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.6
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.53
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.51
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.48
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.18
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.11
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.06
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.04
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.01
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.99
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.97
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.97
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.96
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.95
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.95
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.95
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.95
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.94
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.94
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.94
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.93
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.93
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.92
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.91
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.9
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.9
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.9
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.9
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.89
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.89
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.89
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.89
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 98.88
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.88
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.88
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.87
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.87
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.86
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.86
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.85
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.85
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.84
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.84
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.84
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.82
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.81
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.8
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.8
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.79
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.78
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.77
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.76
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.74
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.74
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 98.74
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.73
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.73
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.73
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.72
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.72
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.71
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.71
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 98.67
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.66
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.65
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 98.65
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.64
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 98.63
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 98.63
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 98.63
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.63
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 98.63
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.62
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 98.61
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.6
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.6
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 98.59
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.54
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 98.53
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.49
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 98.49
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.49
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 98.47
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 98.44
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 98.44
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.44
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.42
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 98.42
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.42
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.41
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 98.4
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 98.4
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 98.39
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.38
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.38
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.37
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.34
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.34
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.32
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.31
d2cpja186 Non-POU domain-containing octamer-binding protein, 98.29
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.29
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 98.29
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.27
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 98.26
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 98.25
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.25
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 98.25
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.24
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.22
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.22
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.21
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.21
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.21
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 98.2
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.2
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.2
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.18
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 98.18
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.17
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 98.16
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.16
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.16
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.15
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.15
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.13
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.12
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 98.12
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.11
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.11
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.1
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 98.09
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 98.09
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 98.09
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 98.09
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.08
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 98.08
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 98.05
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 98.01
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 98.0
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 98.0
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.99
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 97.97
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.95
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 97.94
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 97.92
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.9
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 97.88
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 97.88
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 97.88
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 97.85
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.83
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.82
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.81
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 97.8
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.8
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 97.79
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 97.79
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 97.76
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.75
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 97.72
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 97.71
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.69
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.62
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 97.57
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 97.55
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.55
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.46
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.34
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 97.32
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.13
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 97.09
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.08
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 90.19
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 89.66
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 86.67
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]
Probab=99.82  E-value=7e-21  Score=153.86  Aligned_cols=69  Identities=41%  Similarity=0.639  Sum_probs=65.8

Q ss_pred             CCCcccccCCCCCCCHHHHHHHHHHHHHHhCCCCCCCChHHHHHHHHHHHHHHHccChhhhhHHHHHHH
Q psy3926         251 DLDLYGLLELTIDCSEQDIRSAYRKKALKCHPDKNPDDKKAIETFHLLSKAIEVLLDKSARAAYDSVIR  319 (512)
Q Consensus       251 ~~d~YeiLgv~~~As~~eIKkAYRkLa~k~HPDk~~~~~~a~~~F~~I~~AYevLsDp~~R~~YD~~~~  319 (512)
                      ..|||+||||+++||.++||+|||+|+++||||++++++.+.+.|..|++||+||+||.+|..||.+|.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~g~   70 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGH   70 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHHTT
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCChHHHHHHHHHHHHHHhcCCHHHHHHHHHhCc
Confidence            359999999999999999999999999999999998888889999999999999999999999999875



>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure