Psyllid ID: psy4014

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MPQYPRDFGKVGQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITLKRKKTKKKKKKKKKKILSQD
cccccccccccccccccccEEEEEEcccccccccccccHHHHHccccEEEEEEcccccccccccccccccccccccccccccccc
cccccccccccccccccccEEEEEEcccccccccccccccEEEEcccEEEEEEEEEEEEEEEEEccccccHHHHHHHcHHEEccc
mpqyprdfgkvgqplqkypVLIYIHgesfewnsgnpydgrilaSYADFVVITLNYRLGVLVDITLKRKKTKKKKKKKKKKILSQD
mpqyprdfgkvgqplqKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYrlgvlvditlkrkktkkkkkkkkkkilsqd
MPQYPRDFGKVGQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITLkrkktkkkkkkkkkkILSQD
**********VGQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITL********************
MPQYPRDFGKVGQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITLKRKKTKKKKKKKKKKILSQ*
MPQYPRDFGKVGQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITLKR******************
****PRDFGKVGQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITLKRKKTKKKKKK*********
ooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPQYPRDFGKVGQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITxxxxxxxxxxxxxxxxxxxxx
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query85 2.2.26 [Sep-21-2011]
Q8N2Q7 840 Neuroligin-1 OS=Homo sapi yes N/A 0.494 0.05 0.619 2e-09
Q99K10 843 Neuroligin-1 OS=Mus muscu yes N/A 0.494 0.049 0.619 2e-09
Q62765 843 Neuroligin-1 OS=Rattus no yes N/A 0.494 0.049 0.619 2e-09
Q8N0W4 816 Neuroligin-4, X-linked OS no N/A 0.517 0.053 0.590 7e-09
Q8NFZ3 816 Neuroligin-4, Y-linked OS no N/A 0.517 0.053 0.590 7e-09
Q9NZ94 848 Neuroligin-3 OS=Homo sapi no N/A 0.494 0.049 0.619 1e-08
B0F2B4 945 Neuroligin 4-like OS=Mus no N/A 0.517 0.046 0.545 1e-08
Q8BYM5 825 Neuroligin-3 OS=Mus muscu no N/A 0.494 0.050 0.595 1e-08
Q69ZK9 836 Neuroligin-2 OS=Mus muscu no N/A 0.517 0.052 0.522 2e-08
Q62889 848 Neuroligin-3 OS=Rattus no no N/A 0.494 0.049 0.595 2e-08
>sp|Q8N2Q7|NLGN1_HUMAN Neuroligin-1 OS=Homo sapiens GN=NLGN1 PE=1 SV=2 Back     alignment and function desciption
 Score = 61.2 bits (147), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 26/42 (61%), Positives = 34/42 (80%)

Query: 19  PVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVL 60
           PV++YIHG S+   +GN YDG +LASY + +VIT+NYRLGVL
Sbjct: 191 PVMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVL 232
Neuronal cell surface protein thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. Seems to play role in formation or maintenance of synaptic junctions. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses.
Homo sapiens (taxid: 9606)
>sp|Q99K10|NLGN1_MOUSE Neuroligin-1 OS=Mus musculus GN=Nlgn1 PE=1 SV=2 Back     alignment and function description
>sp|Q62765|NLGN1_RAT Neuroligin-1 OS=Rattus norvegicus GN=Nlgn1 PE=1 SV=1 Back     alignment and function description
>sp|Q8N0W4|NLGNX_HUMAN Neuroligin-4, X-linked OS=Homo sapiens GN=NLGN4X PE=1 SV=1 Back     alignment and function description
>sp|Q8NFZ3|NLGNY_HUMAN Neuroligin-4, Y-linked OS=Homo sapiens GN=NLGN4Y PE=2 SV=1 Back     alignment and function description
>sp|Q9NZ94|NLGN3_HUMAN Neuroligin-3 OS=Homo sapiens GN=NLGN3 PE=1 SV=2 Back     alignment and function description
>sp|B0F2B4|NLGN4_MOUSE Neuroligin 4-like OS=Mus musculus GN=Nlgn4l PE=1 SV=1 Back     alignment and function description
>sp|Q8BYM5|NLGN3_MOUSE Neuroligin-3 OS=Mus musculus GN=Nlgn3 PE=1 SV=2 Back     alignment and function description
>sp|Q69ZK9|NLGN2_MOUSE Neuroligin-2 OS=Mus musculus GN=Nlgn2 PE=1 SV=2 Back     alignment and function description
>sp|Q62889|NLGN3_RAT Neuroligin-3 OS=Rattus norvegicus GN=Nlgn3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
242008356 943 Neuroligin-3 precursor, putative [Pedicu 0.541 0.048 0.760 1e-15
270007392 892 hypothetical protein TcasGA2_TC013956 [T 0.517 0.049 0.75 3e-15
328702033 806 PREDICTED: hypothetical protein LOC10016 0.623 0.065 0.685 4e-15
91082043 948 PREDICTED: similar to CG34139 CG34139-PA 0.517 0.046 0.75 5e-15
347969281 1001 AGAP003115-PA [Anopheles gambiae str. PE 0.670 0.056 0.631 7e-15
347970144 1381 AGAP003570-PA [Anopheles gambiae str. PE 0.552 0.034 0.723 9e-15
357603022 985 hypothetical protein KGM_05370 [Danaus p 0.6 0.051 0.75 1e-14
312384539 303 hypothetical protein AND_01985 [Anophele 0.552 0.155 0.723 1e-14
328781399 1423 PREDICTED: hypothetical protein LOC72435 0.541 0.032 0.695 2e-14
242010064 1372 conserved hypothetical protein [Pediculu 0.529 0.032 0.711 2e-14
>gi|242008356|ref|XP_002424972.1| Neuroligin-3 precursor, putative [Pediculus humanus corporis] gi|212508601|gb|EEB12234.1| Neuroligin-3 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 87.0 bits (214), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 35/46 (76%), Positives = 43/46 (93%)

Query: 15  LQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVL 60
           L K+PVL++IHGES++WNSGNPYDG +LASYAD VV+TLNYRLG+L
Sbjct: 200 LTKHPVLVFIHGESYDWNSGNPYDGSVLASYADLVVVTLNYRLGIL 245

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270007392|gb|EFA03840.1| hypothetical protein TcasGA2_TC013956 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328702033|ref|XP_001947161.2| PREDICTED: hypothetical protein LOC100165743 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91082043|ref|XP_971088.1| PREDICTED: similar to CG34139 CG34139-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|347969281|ref|XP_312799.5| AGAP003115-PA [Anopheles gambiae str. PEST] gi|333468451|gb|EAA44773.5| AGAP003115-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347970144|ref|XP_313317.5| AGAP003570-PA [Anopheles gambiae str. PEST] gi|333468798|gb|EAA08899.5| AGAP003570-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|357603022|gb|EHJ63595.1| hypothetical protein KGM_05370 [Danaus plexippus] Back     alignment and taxonomy information
>gi|312384539|gb|EFR29244.1| hypothetical protein AND_01985 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|328781399|ref|XP_001120179.2| PREDICTED: hypothetical protein LOC724358 [Apis mellifera] Back     alignment and taxonomy information
>gi|242010064|ref|XP_002425796.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509729|gb|EEB13058.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
FB|FBgn0083963 1159 CG34127 [Drosophila melanogast 0.564 0.041 0.693 9.8e-15
FB|FBgn0083975 1281 CG34139 [Drosophila melanogast 0.529 0.035 0.711 8e-14
FB|FBgn0051146 1354 Nlg1 "Neuroligin 1" [Drosophil 0.529 0.033 0.688 1.1e-13
FB|FBgn0031866 1248 neuroligin "neuroligin" [Droso 0.564 0.038 0.520 9.5e-11
UNIPROTKB|F1NGC1 609 NLGN4X "Uncharacterized protei 0.623 0.087 0.528 3.9e-09
UNIPROTKB|A6NMU8 873 NLGN4Y "Neuroligin 4, Y-linked 0.576 0.056 0.571 3.9e-09
UNIPROTKB|F1NFN0 840 F1NFN0 "Uncharacterized protei 0.494 0.05 0.619 7.8e-09
UNIPROTKB|Q8N2Q7 840 NLGN1 "Neuroligin-1" [Homo sap 0.494 0.05 0.619 7.8e-09
MGI|MGI:2179435 843 Nlgn1 "neuroligin 1" [Mus musc 0.494 0.049 0.619 7.9e-09
RGD|621117 843 Nlgn1 "neuroligin 1" [Rattus n 0.494 0.049 0.619 7.9e-09
FB|FBgn0083963 CG34127 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 201 (75.8 bits), Expect = 9.8e-15, P = 9.8e-15
 Identities = 34/49 (69%), Positives = 42/49 (85%)

Query:    12 GQPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVL 60
             G P  KYPVL+++HGES+EWNSGNPYDG +LASY   +V+T+NYRLGVL
Sbjct:   311 GSPA-KYPVLVFVHGESYEWNSGNPYDGSVLASYGQILVVTINYRLGVL 358
GO:0004091 "carboxylesterase activity" evidence=IKR;NAS
GO:0042043 "neurexin family protein binding" evidence=ISS;IBA
GO:0006911 "phagocytosis, engulfment" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
GO:0009986 "cell surface" evidence=IBA
GO:0045202 "synapse" evidence=IBA
GO:0005887 "integral to plasma membrane" evidence=IBA
GO:0007416 "synapse assembly" evidence=IBA
GO:0004872 "receptor activity" evidence=IBA
FB|FBgn0083975 CG34139 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051146 Nlg1 "Neuroligin 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031866 neuroligin "neuroligin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGC1 NLGN4X "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6NMU8 NLGN4Y "Neuroligin 4, Y-linked, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NFN0 F1NFN0 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N2Q7 NLGN1 "Neuroligin-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2179435 Nlgn1 "neuroligin 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|621117 Nlgn1 "neuroligin 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q62765NLGN1_RATNo assigned EC number0.61900.49410.0498yesN/A
Q99K10NLGN1_MOUSENo assigned EC number0.61900.49410.0498yesN/A
Q8N2Q7NLGN1_HUMANNo assigned EC number0.61900.49410.05yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
pfam00135 510 pfam00135, COesterase, Carboxylesterase family 5e-14
COG2272 491 COG2272, PnbA, Carboxylesterase type B [Lipid meta 1e-11
cd00312 493 cd00312, Esterase_lipase, Esterases and lipases (i 2e-09
COG0657 312 COG0657, Aes, Esterase/lipase [Lipid metabolism] 2e-06
>gnl|CDD|215741 pfam00135, COesterase, Carboxylesterase family Back     alignment and domain information 
 Score = 65.0 bits (159), Expect = 5e-14
 Identities = 23/46 (50%), Positives = 31/46 (67%), Gaps = 2/46 (4%)

Query: 17  KYPVLIYIHGESFEWNSG--NPYDGRILASYADFVVITLNYRLGVL 60
           K PV+++IHG  F+  S   + YDG  LA+  D VV+T+NYRLG L
Sbjct: 99  KLPVMVWIHGGGFQSGSASLDDYDGPDLAASEDVVVVTINYRLGAL 144

Length = 510
>gnl|CDD|225181 COG2272, PnbA, Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|238191 cd00312, Esterase_lipase, Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>gnl|CDD|223730 COG0657, Aes, Esterase/lipase [Lipid metabolism] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 85
PF00135 535 COesterase: Carboxylesterase family The prints ent 99.78
COG2272 491 PnbA Carboxylesterase type B [Lipid metabolism] 99.78
cd00312 493 Esterase_lipase Esterases and lipases (includes fu 99.64
KOG1516|consensus 545 99.62
KOG4389|consensus 601 99.56
KOG1515|consensus 336 99.54
COG0657 312 Aes Esterase/lipase [Lipid metabolism] 99.24
PRK10162 318 acetyl esterase; Provisional 99.14
PF07859 211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 98.95
KOG4627|consensus 270 98.27
KOG4388|consensus 880 97.66
TIGR01840 212 esterase_phb esterase, PHB depolymerase family. Th 97.56
PF10340 374 DUF2424: Protein of unknown function (DUF2424); In 97.51
COG1506 620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 97.38
TIGR02821 275 fghA_ester_D S-formylglutathione hydrolase. This m 96.78
PLN00021 313 chlorophyllase 96.67
PF10503 220 Esterase_phd: Esterase PHB depolymerase 96.57
PLN02442 283 S-formylglutathione hydrolase 96.42
PF03403 379 PAF-AH_p_II: Platelet-activating factor acetylhydr 96.36
PRK10115 686 protease 2; Provisional 96.26
PRK10566 249 esterase; Provisional 96.25
KOG3847|consensus 399 95.74
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 94.15
TIGR00976 550 /NonD putative hydrolase, CocE/NonD family. This m 93.84
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 93.53
PLN02298 330 hydrolase, alpha/beta fold family protein 93.5
COG3509 312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 93.47
PLN02385 349 hydrolase; alpha/beta fold family protein 93.39
COG4099 387 Predicted peptidase [General function prediction o 93.08
PF039918 Prion_octapep: Copper binding octapeptide repeat; 93.02
PF05448 320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 92.84
PHA02857 276 monoglyceride lipase; Provisional 92.69
PRK10673 255 acyl-CoA esterase; Provisional 90.99
TIGR03611 257 RutD pyrimidine utilization protein D. This protei 90.73
PF12740 259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 90.64
PRK10985 324 putative hydrolase; Provisional 90.64
PLN02652 395 hydrolase; alpha/beta fold family protein 90.39
PF02129 272 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 fam 89.91
TIGR01250 288 pro_imino_pep_2 proline-specific peptidases, Bacil 88.58
PRK10439 411 enterobactin/ferric enterobactin esterase; Provisi 88.52
TIGR03101 266 hydr2_PEP hydrolase, ortholog 2, exosortase system 88.31
KOG2100|consensus 755 88.23
TIGR02427 251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 88.11
TIGR01738 245 bioH putative pimeloyl-BioC--CoA transferase BioH. 87.53
TIGR03100 274 hydr1_PEP hydrolase, ortholog 1, exosortase system 87.46
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 87.29
PF00756 251 Esterase: Putative esterase; InterPro: IPR000801 T 86.55
KOG2281|consensus 867 86.29
PLN02211 273 methyl indole-3-acetate methyltransferase 86.14
PF12697 228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 84.57
TIGR03695 251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 84.5
PRK05077 414 frsA fermentation/respiration switch protein; Revi 83.86
TIGR03056 278 bchO_mg_che_rel putative magnesium chelatase acces 83.51
PRK11126 242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 82.9
PLN02511 388 hydrolase 82.64
PF07224 307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 82.17
PRK10349 256 carboxylesterase BioH; Provisional 80.95
KOG1455|consensus 313 80.68
COG0400 207 Predicted esterase [General function prediction on 80.53
COG4188 365 Predicted dienelactone hydrolase [General function 80.43
>PF00135 COesterase: Carboxylesterase family The prints entry is specific to acetylcholinesterase; InterPro: IPR002018 Higher eukaryotes have many distinct esterases Back     alignment and domain information 
Probab=99.78  E-value=1.5e-20  Score=138.95  Aligned_cols=69  Identities=36%  Similarity=0.652  Sum_probs=50.9

Q ss_pred             CCCceeeCCCCCCC-CccEEEEEeCCCccCCCC--CCCChHHHhhCCCeEEEEeCCCCCCcccCCCCchhhh
Q psy4014           3 QYPRDFGKVGQPLQ-KYPVLIYIHGESFEWNSG--NPYDGRILASYADFVVITLNYRLGVLVDITLKRKKTK   71 (85)
Q Consensus         3 ~~~~i~~p~~~~~~-~~PVvv~iHGGg~~~g~~--~~~~~~~la~~~~~ivVsv~YRlap~Gfl~~~~~~~~   71 (85)
                      .|+|||+|...... ++|||||||||||..|+.  ..+....++.+.++|||++||||++||||++++....
T Consensus       109 L~LnI~~P~~~~~~~~lPV~v~ihGG~f~~G~~~~~~~~~~~~~~~~~vivVt~nYRlg~~Gfl~~~~~~~~  180 (535)
T PF00135_consen  109 LYLNIYTPSNASSNSKLPVMVWIHGGGFMFGSGSFPPYDGASLAASKDVIVVTINYRLGAFGFLSLGDLDAP  180 (535)
T ss_dssp             -EEEEEEETSSSSTTSEEEEEEE--STTTSSCTTSGGGHTHHHHHHHTSEEEEE----HHHHH-BSSSTTSH
T ss_pred             HHHhhhhccccccccccceEEEeecccccCCCcccccccccccccCCCEEEEEecccccccccccccccccC
Confidence            47999999964444 799999999999999998  3455666666679999999999999999999877654

Among the different types are those which act on carboxylic esters (3.1.1 from EC). Carboxyl-esterases have been classified into three categories (A, B and C) on the basis of differential patterns of inhibition by organophosphates. The sequence of a number of type-B carboxylesterases indicates [, , ] that the majority are evolutionary related. As is the case for lipases and serine proteases, the catalytic apparatus of esterases involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.; PDB: 3B3Q_A 1CLE_B 1GQS_A 2VJD_A 1HBJ_A 2C5G_A 1U65_A 2WG1_A 1FSS_A 3M3D_A ....
>COG2272 PnbA Carboxylesterase type B [Lipid metabolism] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>KOG1516|consensus Back     alignment and domain information
>KOG4389|consensus Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>KOG4388|consensus Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>KOG3847|consensus Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>COG4099 Predicted peptidase [General function prediction only] Back     alignment and domain information
>PF03991 Prion_octapep: Copper binding octapeptide repeat; InterPro: IPR020949 Prion protein (PrP-c) [, , ] is a small glycoprotein found in high quantity in the brain of animals infected with certain degenerative neurological diseases, such as sheep scrapie and bovine spongiform encephalopathy (BSE), and the human dementias Creutzfeldt-Jacob disease (CJD) and Gerstmann-Straussler syndrome (GSS) Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PF02129 Peptidase_S15: X-Pro dipeptidyl-peptidase (S15 family); InterPro: IPR000383 This entry represents a domain found peptidases Xaa-Pro dipeptidyl-peptidase and glutaryl-7-aminocephalosporanic-acid acylase, which belong to MEROPS peptidase families S15 and S45 respectively [] Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>KOG2100|consensus Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>KOG2281|consensus Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>COG4188 Predicted dienelactone hydrolase [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
3vkf_A 585 Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COM 1e-09
3biw_A 574 Crystal Structure Of The Neuroligin-1NEUREXIN-1beta 1e-09
3b3q_A 577 Crystal Structure Of A Synaptic Adhesion Complex Le 1e-09
3be8_A 588 Crystal Structure Of The Synaptic Protein Neuroligi 2e-09
3bl8_A 580 Crystal Structure Of The Extracellular Domain Of Ne 6e-09
1c7j_A 489 Pnb Esterase 56c8 Length = 489 1e-06
1qe3_A 489 Pnb Esterase Length = 489 1e-06
1c7i_A 489 Thermophylic Pnb Esterase Length = 489 2e-06
2ogt_A 498 Crystal Structure Of The Geobacillus Stearothermoph 3e-06
2ogs_A 498 Crystal Structure Of The Geobacillus Stearothermoph 4e-06
1k4y_A 534 Crystal Structure Of Rabbit Liver Carboxylesterase 4e-05
1ya4_A 532 Crystal Structure Of Human Liver Carboxylesterase 1 4e-05
1mx1_A 548 Crystal Structure Of Human Liver Carboxylesterase I 4e-05
3k9b_A 529 Crystal Structure Of Human Liver Carboxylesterase 1 4e-05
2dqy_A 542 Crystal Structure Of Human Carboxylesterase In Comp 4e-05
>pdb|3VKF|A Chain A, Crystal Structure Of Neurexin 1betaNEUROLIGIN 1 COMPLEX Length = 585 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 26/42 (61%), Positives = 34/42 (80%)
Query: 19  PVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVL 60
           PV++YIHG S+   +GN YDG +LASY + +VIT+NYRLGVL
Sbjct: 150 PVMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVL 191
>pdb|3BIW|A Chain A, Crystal Structure Of The Neuroligin-1NEUREXIN-1beta Synaptic Adhesion Complex Length = 574 Back     alignment and structure
>pdb|3B3Q|A Chain A, Crystal Structure Of A Synaptic Adhesion Complex Length = 577 Back     alignment and structure
>pdb|3BE8|A Chain A, Crystal Structure Of The Synaptic Protein Neuroligin 4 Length = 588 Back     alignment and structure
>pdb|3BL8|A Chain A, Crystal Structure Of The Extracellular Domain Of Neuroligin 2a From Mouse Length = 580 Back     alignment and structure
>pdb|1C7J|A Chain A, Pnb Esterase 56c8 Length = 489 Back     alignment and structure
>pdb|1QE3|A Chain A, Pnb Esterase Length = 489 Back     alignment and structure
>pdb|1C7I|A Chain A, Thermophylic Pnb Esterase Length = 489 Back     alignment and structure
>pdb|2OGT|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.8 Length = 498 Back     alignment and structure
>pdb|2OGS|A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2 Length = 498 Back     alignment and structure
>pdb|1K4Y|A Chain A, Crystal Structure Of Rabbit Liver Carboxylesterase In Complex With 4- Piperidino-Piperidine Length = 534 Back     alignment and structure
>pdb|1YA4|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 In Complex With Tamoxifen Length = 532 Back     alignment and structure
>pdb|1MX1|A Chain A, Crystal Structure Of Human Liver Carboxylesterase In Complex With Tacrine Length = 548 Back     alignment and structure
>pdb|3K9B|A Chain A, Crystal Structure Of Human Liver Carboxylesterase 1 (Hce1) In Covalent Complex With The Nerve Agent Cyclosarin (Gf) Length = 529 Back     alignment and structure
>pdb|2DQY|A Chain A, Crystal Structure Of Human Carboxylesterase In Complex With Cholate And Palmitate Length = 542 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 2e-18
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 3e-18
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 7e-18
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 9e-18
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 2e-17
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 3e-17
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 8e-16
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 9e-15
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 1e-14
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 7e-14
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 1e-12
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 2e-12
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 5e-11
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 8e-07
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 9e-07
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 2e-06
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 1e-05
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 1e-05
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 2e-05
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 3e-05
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 4e-05
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 5e-05
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 6e-05
3h04_A 275 Uncharacterized protein; protein with unknown func 7e-05
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 7e-05
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 1e-04
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 1e-04
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 1e-04
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 2e-04
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 3e-04
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 3e-04
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 9e-04
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Length = 585 Back     alignment and structure
 Score = 76.8 bits (189), Expect = 2e-18
 Identities = 14/46 (30%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 17  KYPVLIYIHGESFEWNSGN--PYDGRILASYADFVVITLNYRLGVL 60
             P+LI+I+G  F   S     Y+  I+A+  + +V +  YR+G  
Sbjct: 140 GLPILIWIYGGGFMTGSATLDIYNADIMAAVGNVIVASFQYRVGAF 185
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Length = 542 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Length = 574 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Length = 543 Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Length = 529 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Length = 537 Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Length = 579 Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Length = 489 Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Length = 498 Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Length = 522 Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Length = 544 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Length = 534 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Length = 551 Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Length = 365 Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Length = 338 Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Length = 351 Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Length = 274 Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Length = 322 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Length = 322 Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Length = 303 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Length = 311 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Length = 310 Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Length = 275 Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Length = 326 Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Length = 323 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Length = 311 Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Length = 317 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Length = 326 Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Length = 273 Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Length = 323 Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Length = 346 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
3bix_A 574 Neuroligin-1, neuroligin I; esterase domain, alpha 99.65
2ogt_A 498 Thermostable carboxylesterase EST50; alpha/beta hy 99.61
1p0i_A 529 Cholinesterase; serine hydrolase, butyrate, hydrol 99.61
1ukc_A 522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 99.61
1ea5_A 537 ACHE, acetylcholinesterase; hydrolase, serine hydr 99.61
1dx4_A 585 ACHE, acetylcholinesterase; hydrolase, serine este 99.6
2ha2_A 543 ACHE, acetylcholinesterase; hydrolase fold, serine 99.6
1llf_A 534 Lipase 3; candida cylindracea cholesterol esterase 99.59
2h7c_A 542 Liver carboxylesterase 1; enzyme, cholesteryl este 99.58
2bce_A 579 Cholesterol esterase; hydrolase, serine esterase, 99.58
1thg_A 544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 99.54
2fj0_A 551 JuvenIle hormone esterase; manduca sexta, alpha-be 99.52
1qe3_A 489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 99.47
2qru_A 274 Uncharacterized protein; alpha/beta-hydrolase, str 99.22
3qh4_A 317 Esterase LIPW; structural genomics, ssgcid, seattl 99.08
3ebl_A 365 Gibberellin receptor GID1; alpha/beta hydrolase, l 99.04
3ga7_A 326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 98.98
3ain_A 323 303AA long hypothetical esterase; carboxylesterase 98.95
3fak_A 322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.91
2zsh_A 351 Probable gibberellin receptor GID1L1; plant hormon 98.88
4e15_A 303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.86
1jkm_A 361 Brefeldin A esterase; serine hydrolase, degradatio 98.84
2hm7_A 310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.82
1lzl_A 323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.81
2o7r_A 338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.74
2wir_A 313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.74
1jji_A 311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.64
2c7b_A 311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.64
3k6k_A 322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.57
1vkh_A 273 Putative serine hydrolase; structural genomics, jo 98.54
2pbl_A 262 Putative esterase/lipase/thioesterase; alpha/beta- 98.54
3bxp_A 277 Putative lipase/esterase; putative carboxylesteras 98.53
3d7r_A 326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.41
3hxk_A 276 Sugar hydrolase; alpha-beta protein., structural g 98.32
3bjr_A 283 Putative carboxylesterase; structural genomics, jo 98.28
3h04_A 275 Uncharacterized protein; protein with unknown func 98.14
3fcx_A 282 FGH, esterase D, S-formylglutathione hydrolase; re 97.75
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.61
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.58
4a5s_A 740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.51
4b6g_A 283 Putative esterase; hydrolase, formaldehyde detoxif 97.5
2uz0_A 263 Esterase, tributyrin esterase; alpha/beta hydrolas 97.49
3e4d_A 278 Esterase D; S-formylglutathione hydrolase, hydrola 97.47
1xfd_A 723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.46
1jjf_A 268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.46
3doh_A 380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.45
1vlq_A 337 Acetyl xylan esterase; TM0077, structural genomics 97.41
3i6y_A 280 Esterase APC40077; lipase, structural genomics, PS 97.4
1l7a_A 318 Cephalosporin C deacetylase; structural genomics, 97.4
3fcy_A 346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.37
3ls2_A 280 S-formylglutathione hydrolase; psychrophilic organ 97.36
2fuk_A 220 XC6422 protein; A/B hydrolase, structural genomics 97.34
1z68_A 719 Fibroblast activation protein, alpha subunit; sepr 97.33
4ao6_A 259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 97.31
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.31
4hvt_A 711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.23
3c8d_A 403 Enterochelin esterase; alpha-beta-alpha sandwich, 97.18
2fx5_A 258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 97.17
1jfr_A 262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 97.13
3d0k_A 304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.11
2hdw_A 367 Hypothetical protein PA2218; alpha/beta hydrolase 97.07
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 97.05
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.03
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 96.92
2xe4_A 751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 96.9
3d59_A 383 Platelet-activating factor acetylhydrolase; secret 96.89
3h2g_A 397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 96.85
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 96.83
1gkl_A 297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 96.77
2qm0_A 275 BES; alpha-beta structure, structural genomics, PS 96.76
3nuz_A 398 Putative acetyl xylan esterase; structural genomic 96.72
3g8y_A 391 SUSD/RAGB-associated esterase-like protein; struct 96.7
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.7
3trd_A 208 Alpha/beta hydrolase; cellular processes; 1.50A {C 96.69
3vis_A 306 Esterase; alpha/beta-hydrolase fold, polyethylene 96.57
3k2i_A 422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 96.26
3ksr_A 290 Putative serine hydrolase; catalytic triad, struct 96.12
3f67_A 241 Putative dienelactone hydrolase; alpha-beta-alpha 96.09
3hlk_A 446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 96.07
2i3d_A 249 AGR_C_3351P, hypothetical protein ATU1826; structu 96.02
3pfb_A 270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.92
2jbw_A 386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 95.89
3hju_A 342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 95.68
4ezi_A 377 Uncharacterized protein; alpha-beta hydrolases fol 95.64
2o2g_A 223 Dienelactone hydrolase; YP_324580.1, structural ge 95.6
3pe6_A 303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 95.58
1zi8_A 236 Carboxymethylenebutenolidase; alpha and beta prote 95.53
1auo_A 218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 95.5
4f0j_A 315 Probable hydrolytic enzyme; alpha/beta hydrolase f 95.36
3bdi_A 207 Uncharacterized protein TA0194; NP_393672.1, predi 95.17
1imj_A 210 CIB, CCG1-interacting factor B; alpha/beta hydrola 95.11
1sfr_A 304 Antigen 85-A; alpha/beta hydrolase, structural gen 95.1
3llc_A 270 Putative hydrolase; structural genomics, joint cen 94.99
3mve_A 415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 94.96
1fj2_A 232 Protein (acyl protein thioesterase 1); alpha/beta 94.76
1qlw_A 328 Esterase; anisotropic refinement, atomic resolutio 94.75
1ufo_A 238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.73
2qjw_A 176 Uncharacterized protein XCC1541; putative hydrolas 94.71
1uxo_A 192 YDEN protein; hydrolase, A/B hydrolase, esterase, 94.67
2h1i_A 226 Carboxylesterase; structural genomics, PSI-2, prot 94.64
3cn9_A 226 Carboxylesterase; alpha/beta hydrolase fold super- 94.63
2qs9_A 194 Retinoblastoma-binding protein 9; B5T overexpresse 94.62
3e0x_A 245 Lipase-esterase related protein; APC60309, clostri 94.59
2gzs_A 278 IROE protein; enterobactin, salmochelin, DFP, hydr 94.55
3dkr_A 251 Esterase D; alpha beta hydrolase, mechanism, catal 94.26
3iii_A 560 COCE/NOND family hydrolase; structural genomics, c 94.14
3rm3_A 270 MGLP, thermostable monoacylglycerol lipase; alpha/ 94.13
3b5e_A 223 MLL8374 protein; NP_108484.1, carboxylesterase, st 94.07
3fla_A 267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 94.05
3i2k_A 587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 93.93
3sty_A 267 Methylketone synthase 1; alpha/beta hydrolase, dec 93.88
1r88_A 280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 93.8
3qit_A 286 CURM TE, polyketide synthase; thioesterase, alpha/ 93.73
2wtm_A 251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 93.53
4dnp_A 269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 93.33
3og9_A 209 Protein YAHD A copper inducible hydrolase; alpha/b 92.98
3qvm_A 282 OLEI00960; structural genomics, PSI-biology, midwe 92.93
3dqz_A 258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 92.9
2b9v_A 652 Alpha-amino acid ester hydrolase; catalytic triad, 92.84
3hss_A 293 Putative bromoperoxidase; alpha beta hydrolase, ox 92.66
2y6u_A 398 Peroxisomal membrane protein LPX1; hydrolase, puta 92.52
3qmv_A 280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 92.35
3v48_A 268 Aminohydrolase, putative aminoacrylate hydrolase R 92.34
2r11_A 306 Carboxylesterase NP; 2632844, putative hydrolase, 92.3
1tht_A 305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 92.28
3u1t_A 309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 91.53
3r0v_A 262 Alpha/beta hydrolase fold protein; structural geno 91.51
3oos_A 278 Alpha/beta hydrolase family protein; APC67239.0, p 91.36
1k8q_A 377 Triacylglycerol lipase, gastric; APHA beta hydrola 91.33
3ibt_A 264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 91.32
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 91.25
1tca_A 317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 91.06
4g9e_A 279 AHL-lactonase, alpha/beta hydrolase fold protein; 90.96
3g9x_A 299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 90.9
3fnb_A 405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 90.79
3c5v_A 316 PME-1, protein phosphatase methylesterase 1; demet 90.74
1a8s_A 273 Chloroperoxidase F; haloperoxidase, oxidoreductase 90.73
3l80_A 292 Putative uncharacterized protein SMU.1393C; alpha/ 90.66
2r8b_A 251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 90.63
3r40_A 306 Fluoroacetate dehalogenase; FACD, defluorinase, al 90.55
3fsg_A 272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 90.43
4fol_A 299 FGH, S-formylglutathione hydrolase; D-type esteras 90.4
3u0v_A 239 Lysophospholipase-like protein 1; alpha, beta hydr 90.31
2e3j_A 356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 90.3
3fob_A 281 Bromoperoxidase; structural genomics, IDP00046, ba 90.09
1zoi_A 276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 89.94
1mpx_A 615 Alpha-amino acid ester hydrolase; alpha/beta hydro 89.84
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 89.61
4fbl_A 281 LIPS lipolytic enzyme; thermostable, structural ge 89.6
1r3d_A 264 Conserved hypothetical protein VC1974; structural 89.55
3kxp_A 314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 89.34
1pja_A 302 Palmitoyl-protein thioesterase 2 precursor; hydrol 89.23
1a88_A 275 Chloroperoxidase L; haloperoxidase, oxidoreductase 88.99
4h0c_A 210 Phospholipase/carboxylesterase; PSI-biology, midwe 88.95
3kda_A 301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 88.9
1j1i_A 296 META cleavage compound hydrolase; carbazole degrad 88.85
1q0r_A 298 RDMC, aclacinomycin methylesterase; anthracycline, 88.8
3bf7_A 255 Esterase YBFF; thioesterase, helical CAP, hydrolas 88.79
2qvb_A 297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 88.41
3ia2_A 271 Arylesterase; alpha-beta hydrolase fold, transitio 88.36
1a8q_A 274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 88.23
1hkh_A 279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 88.04
1isp_A 181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 87.68
2b61_A 377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 87.6
1tqh_A 247 Carboxylesterase precursor; tetrahedral intermedia 87.0
1wm1_A 317 Proline iminopeptidase; complex with inhibitor, hy 86.76
1mtz_A 293 Proline iminopeptidase; alpha-beta hydrolase, CAP 86.65
2yys_A 286 Proline iminopeptidase-related protein; TTHA1809, 86.65
2wfl_A 264 Polyneuridine-aldehyde esterase; alkaloid metaboli 86.57
1mj5_A 302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 86.5
1c4x_A 285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 86.49
1brt_A 277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 86.43
1azw_A 313 Proline iminopeptidase; aminopeptidase, serine pro 86.3
2d81_A318 PHB depolymerase; alpha/beta hydrolase fold, circu 86.17
2pl5_A 366 Homoserine O-acetyltransferase; alpha/beta hydrola 85.73
2cjp_A 328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 85.5
1u2e_A 289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 85.31
2xt0_A 297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 85.27
2rau_A 354 Putative esterase; NP_343859.1, putative lipase, s 85.08
3afi_E 316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 85.07
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 84.66
1wom_A 271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 84.62
3om8_A 266 Probable hydrolase; structural genomics, PSI-2, pr 84.02
2puj_A 286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 83.95
1m33_A 258 BIOH protein; alpha-betta-alpha sandwich, structur 83.75
4fle_A 202 Esterase; structural genomics, PSI-biology, northe 83.7
2wue_A 291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 83.6
2ocg_A 254 Valacyclovir hydrolase; alpha beta hydrolase fold; 83.55
3b12_A 304 Fluoroacetate dehalogenase; dehalogease, hydrolase 84.0
1b6g_A 310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 83.38
3bwx_A 285 Alpha/beta hydrolase; YP_496220.1, joint center fo 83.2
1xkl_A 273 SABP2, salicylic acid-binding protein 2; alpha-bet 82.93
1dqz_A 280 85C, protein (antigen 85-C); fibronectin, structur 82.91
3i1i_A 377 Homoserine O-acetyltransferase; structural genomic 82.69
2xua_A 266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 82.68
3c6x_A 257 Hydroxynitrilase; atomic resolution, hydroxynitril 82.38
3nwo_A 330 PIP, proline iminopeptidase; structural genomics, 82.31
1iup_A 282 META-cleavage product hydrolase; aromatic compound 82.05
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 82.03
2wj6_A 276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 81.99
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 81.88
1ycd_A 243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 81.82
2xmz_A 269 Hydrolase, alpha/beta hydrolase fold family; menaq 81.36
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 81.18
3ils_A 265 PKS, aflatoxin biosynthesis polyketide synthase; A 81.08
2psd_A 318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 80.63
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
Probab=99.65  E-value=2.1e-17  Score=124.75  Aligned_cols=66  Identities=41%  Similarity=0.662  Sum_probs=55.6

Q ss_pred             CCCceeeCCCC----CCCCccEEEEEeCCCccCCCCCCCChHHHhhCCCeEEEEeCCCCCCcccCCCCch
Q psy4014           3 QYPRDFGKVGQ----PLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITLKRK   68 (85)
Q Consensus         3 ~~~~i~~p~~~----~~~~~PVvv~iHGGg~~~g~~~~~~~~~la~~~~~ivVsv~YRlap~Gfl~~~~~   68 (85)
                      .++|||+|...    ...++|||||||||||..|+...++...++...+++||++||||+||||+++++.
T Consensus       112 L~l~v~~P~~~~~~~~~~~~Pv~v~iHGGg~~~g~~~~~~~~~la~~~~~vvv~~~YRl~~~Gfl~~~~~  181 (574)
T 3bix_A          112 LYLNIYVPTEDDIRDSGGPKPVMVYIHGGSYMEGTGNLYDGSVLASYGNVIVITVNYRLGVLGFLSTGDQ  181 (574)
T ss_dssp             CEEEEEEEC--------CCEEEEEECCCSSSSSCCGGGSCCHHHHHHHTCEEEEECCCCHHHHHCCCSSS
T ss_pred             CEEEEEECCCCCcCCCCCCCcEEEEECCCcccCCCCCccCchhhhccCCEEEEEeCCcCcccccCcCCCC
Confidence            47899999743    2356899999999999999988777788888778999999999999999998753
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2d81_A PHB depolymerase; alpha/beta hydrolase fold, circular permutation, hydrolase; HET: NAG RB3; 1.66A {Penicillium funiculosum} SCOP: c.69.1.37 PDB: 2d80_A* Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 85
d2bcea_ 579 c.69.1.1 (A:) Bile-salt activated lipase (choleste 3e-08
d1dx4a_ 571 c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Dro 2e-05
d1llfa_ 534 c.69.1.17 (A:) Type-B carboxylesterase/lipase {Can 3e-05
d1vkha_ 263 c.69.1.32 (A:) Putative serine hydrolase Ydr428c { 2e-04
d1jjia_ 311 c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeogl 5e-04
d2ha2a1 542 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mu 5e-04
d1xfda2 258 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-li 0.004
d2bgra2 258 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26 0.004
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Length = 579 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Bile-salt activated lipase (cholesterol esterase)
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 46.6 bits (109), Expect = 3e-08
 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 8/52 (15%)

Query: 16  QKYPVLIYIHGESFEWNSGNP--------YDGRILASYADFVVITLNYRLGV 59
              PV+I+I+G +F   +           YDG  +A+  + +V+T NYR+G 
Sbjct: 96  HDLPVMIWIYGGAFLMGASQGANFLSNYLYDGEEIATRGNVIVVTFNYRVGP 147
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 571 Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Length = 534 Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 263 Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 311 Back     information, alignment and structure
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Length = 542 Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Length = 258 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
d2h7ca1 532 Mammalian carboxylesterase (liver carboxylesterase 99.79
d2ha2a1 542 Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 99.78
d1thga_ 544 Type-B carboxylesterase/lipase {Fungus (Geotrichum 99.76
d1dx4a_ 571 Acetylcholinesterase {Fruit fly (Drosophila melano 99.76
d1llfa_ 534 Type-B carboxylesterase/lipase {Candida cylindrace 99.76
d1qe3a_ 483 Thermophilic para-nitrobenzyl esterase (PNB estera 99.76
d1ukca_ 517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 99.76
d2bcea_ 579 Bile-salt activated lipase (cholesterol esterase) 99.75
d1ea5a_ 532 Acetylcholinesterase {Pacific electric ray (Torped 99.75
d1p0ia_ 526 Butyryl cholinesterase {Human (Homo sapiens) [TaxI 99.75
d1lzla_ 317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 99.43
d1u4na_ 308 Carboxylesterase {Alicyclobacillus acidocaldarius 99.33
d1jjia_ 311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 99.32
d2pbla1 261 Uncharacterized protein TM1040_2492 {Silicibacter 99.32
d1jkma_ 358 Carboxylesterase {Bacillus subtilis, brefeldin A e 99.28
d1vkha_ 263 Putative serine hydrolase Ydr428c {Baker's yeast ( 99.15
d2bgra2 258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 98.66
d1xfda2 258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 98.57
d2hu7a2 260 Acylamino-acid-releasing enzyme, C-terminal donain 98.51
d1qfma2 280 Prolyl oligopeptidase, C-terminal domain {Pig (Sus 98.11
d1jfra_ 260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.76
d1vlqa_ 322 Acetyl xylan esterase TM0077 {Thermotoga maritima 97.56
d1l7aa_ 318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 97.27
d2gzsa1 265 Enterobactin and salmochelin hydrolase IroE {Esche 97.21
d1wb4a1 273 Feruloyl esterase domain of the cellulosomal xylan 96.9
d1ju3a2 347 Bacterial cocaine esterase N-terminal domain {Rhod 96.67
d1qlwa_ 318 A novel bacterial esterase {Alcaligenes sp. [TaxId 96.66
d3c8da2 246 Enterochelin esterase, catalytic domain {Shigella 96.26
d2h1ia1 202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 96.26
d1r3da_ 264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 96.09
d1thta_ 302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 96.05
d1sfra_ 288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 95.99
d1ufoa_ 238 Hypothetical protein TT1662 {Thermus thermophilus 95.92
d1tqha_ 242 Carboxylesterase Est {Bacillus stearothermophilus 95.72
d2jbwa1 360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 95.68
d1jjfa_ 255 Feruloyl esterase domain of the cellulosomal xylan 95.42
d1mtza_ 290 Tricorn interacting factor F1 {Archaeon Thermoplas 95.23
d2fuka1 218 XC6422 protein {Xanthomonas campestris [TaxId: 339 94.99
d2i3da1 218 Hypothetical protein Atu1826 {Agrobacterium tumefa 94.91
d1imja_ 208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 94.7
d1xkla_ 258 Salicylic acid-binding protein 2 (SABP2) {Common t 93.61
d1va4a_ 271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 93.5
d1wm1a_ 313 Proline aminopeptidase {Serratia marcescens [TaxId 93.42
d3b5ea1 209 Uncharacterized protein Mll8374 {Mesorhizobium lot 93.24
d1q0ra_ 297 Aclacinomycin methylesterase RdmC {Streptomyces pu 93.13
d2b9va2 385 Alpha-amino acid ester hydrolase {Acetobacter past 93.1
d1a88a_ 275 Chloroperoxidase L {Streptomyces lividans [TaxId: 92.67
d1m33a_ 256 Biotin biosynthesis protein BioH {Escherichia coli 92.22
d1mpxa2 381 Alpha-amino acid ester hydrolase {Xanthomonas citr 92.0
d1zd3a2 322 Mammalian epoxide hydrolase, C-terminal domain {Hu 91.66
d1a8qa_ 274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 91.16
d1dina_ 233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 91.0
d1brta_ 277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 90.84
d1bn7a_ 291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 90.72
d1c4xa_ 281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 90.67
d1azwa_ 313 Proline iminopeptidase {Xanthomonas campestris, pv 90.63
d1a8sa_ 273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 90.46
d1k8qa_ 377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 90.39
d1pv1a_ 299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 90.24
d1b6ga_ 310 Haloalkane dehalogenase {Xanthobacter autotrophicu 90.12
d1ehya_ 293 Bacterial epoxide hydrolase {Agrobacterium radioba 89.82
d2r8ba1 203 Uncharacterized protein Atu2452 {Agrobacterium tum 89.71
d1uk8a_ 271 Meta-cleavage product hydrolase CumD {Pseudomonas 89.03
d2rhwa1 283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 88.99
d1j1ia_ 268 Meta cleavage compound hydrolase CarC {Janthinobac 88.66
d1hkha_ 279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 88.57
d1mj5a_ 298 Haloalkane dehalogenase {Sphingomonas paucimobilis 87.96
d1xkta_ 286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 87.76
d3c70a1 256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 87.28
d1ex9a_ 285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 83.47
d1jmkc_ 230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 81.42
d1tcaa_ 317 Triacylglycerol lipase {Yeast (Candida antarctica) 81.08
d1uxoa_ 186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 80.88
>d2h7ca1 c.69.1.1 (A:1021-1553) Mammalian carboxylesterase (liver carboxylesterase I) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Acetylcholinesterase-like
domain: Mammalian carboxylesterase (liver carboxylesterase I)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.1e-20  Score=136.99  Aligned_cols=67  Identities=27%  Similarity=0.504  Sum_probs=58.3

Q ss_pred             CCCceeeCCC-CCCCCccEEEEEeCCCccCCCCCCCChHHHhhCCCeEEEEeCCCCCCcccCCCCchh
Q psy4014           3 QYPRDFGKVG-QPLQKYPVLIYIHGESFEWNSGNPYDGRILASYADFVVITLNYRLGVLVDITLKRKK   69 (85)
Q Consensus         3 ~~~~i~~p~~-~~~~~~PVvv~iHGGg~~~g~~~~~~~~~la~~~~~ivVsv~YRlap~Gfl~~~~~~   69 (85)
                      .|||||+|+. ....++|||||||||+|..|+...++...++...++|||++||||++||||++++..
T Consensus        97 L~LnI~~P~~~~~~~~lPV~v~ihGG~~~~gs~~~~~~~~~~~~~~vIvVt~nYRLg~~GFl~~~~~~  164 (532)
T d2h7ca1          97 LYLNIYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEH  164 (532)
T ss_dssp             CEEEEEECSCTTSCCCEEEEEEECCSTTTSCCSTTSCCHHHHHHHTCEEEEECCCCHHHHHCCCSSTT
T ss_pred             CEEEEEECCCCCCCCCcEEEEEEeCCcccccccccCCchhhhhcCceEEEEEeeccCCCccccccccc
Confidence            4799999974 456679999999999999999988877777666799999999999999999988654
>d2ha2a1 c.69.1.1 (A:1-542) Acetylcholinesterase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1thga_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Fungus (Geotrichum candidum), ATCC 34614 [TaxId: 27317]} Back     information, alignment and structure
>d1dx4a_ c.69.1.1 (A:) Acetylcholinesterase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2bcea_ c.69.1.1 (A:) Bile-salt activated lipase (cholesterol esterase) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ea5a_ c.69.1.1 (A:) Acetylcholinesterase {Pacific electric ray (Torpedo californica) [TaxId: 7787]} Back     information, alignment and structure
>d1p0ia_ c.69.1.1 (A:) Butyryl cholinesterase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1qfma2 c.69.1.4 (A:431-710) Prolyl oligopeptidase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure