Psyllid ID: psy4127


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-----
MQLEKIRGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEMP
ccccccccccccEEEEccccccHHHHHHHHHHHHcccEEEEEEccccccccccHHHHHHHHcccccccccccccc
ccHHccccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEEccHHHHcccccHHHHHHccccccccccccccc
mqlekirgrhfdaidldpfgnptrFLDAAVSSLRDGGLLLVTCTDmavlcgntpetcYVKYNAVSLKTAACHEMP
mqlekirgrhfdaidldpfgnPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEMP
MQLEKIRGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEMP
*********HFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAAC****
************AIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHE*P
MQLEKIRGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEMP
*****IRGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAAC****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQLEKIRGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEMP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query75 2.2.26 [Sep-21-2011]
Q9VK89 578 Probable tRNA (guanine(26 yes N/A 0.88 0.114 0.666 1e-21
Q9NXH9 659 tRNA (guanine(26)-N(2))-d yes N/A 0.96 0.109 0.630 3e-21
Q3TX08 663 tRNA (guanine(26)-N(2))-d yes N/A 0.866 0.098 0.692 5e-21
Q23270 526 tRNA (guanine(26)-N(2))-d yes N/A 0.986 0.140 0.552 4e-20
Q9SRU7 589 Probable tRNA (guanine(26 yes N/A 0.88 0.112 0.560 2e-18
Q9LFU5 593 Probable tRNA (guanine(26 no N/A 0.88 0.111 0.590 4e-18
Q9P804 548 tRNA (guanine(26)-N(2))-d yes N/A 0.853 0.116 0.553 4e-15
P81554 381 tRNA (guanine(26)-N(2))-d yes N/A 0.906 0.178 0.514 7e-14
O59493 381 tRNA (guanine(26)-N(2))-d yes N/A 0.906 0.178 0.529 8e-14
Q9V1P3 379 tRNA (guanine(26)-N(2))-d yes N/A 0.906 0.179 0.5 1e-13
>sp|Q9VK89|TRM1_DROME Probable tRNA (guanine(26)-N(2))-dimethyltransferase OS=Drosophila melanogaster GN=CG6388 PE=2 SV=1 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 44/66 (66%), Positives = 50/66 (75%)

Query: 9   RHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKT 68
           + FDA+DLDP+G P RFLD A+  L DGGLLLVT TDMAVL GN PE CYVKY +V L+ 
Sbjct: 172 KRFDAVDLDPYGCPNRFLDGAMQCLVDGGLLLVTATDMAVLAGNAPEACYVKYGSVPLRM 231

Query: 69  AACHEM 74
             CHEM
Sbjct: 232 KCCHEM 237




Dimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 1EC: 6
>sp|Q9NXH9|TRM1_HUMAN tRNA (guanine(26)-N(2))-dimethyltransferase OS=Homo sapiens GN=TRMT1 PE=1 SV=1 Back     alignment and function description
>sp|Q3TX08|TRM1_MOUSE tRNA (guanine(26)-N(2))-dimethyltransferase OS=Mus musculus GN=Trmt1 PE=1 SV=2 Back     alignment and function description
>sp|Q23270|TRM1_CAEEL tRNA (guanine(26)-N(2))-dimethyltransferase OS=Caenorhabditis elegans GN=trm-1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SRU7|TRM2_ARATH Probable tRNA (guanine(26)-N(2))-dimethyltransferase 2 OS=Arabidopsis thaliana GN=At3g02320 PE=2 SV=3 Back     alignment and function description
>sp|Q9LFU5|TRM1_ARATH Probable tRNA (guanine(26)-N(2))-dimethyltransferase 1 OS=Arabidopsis thaliana GN=At5g15810 PE=2 SV=3 Back     alignment and function description
>sp|Q9P804|TRM1_SCHPO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trm1 PE=1 SV=1 Back     alignment and function description
>sp|P81554|TRM1_PYRFU tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=trm1 PE=1 SV=1 Back     alignment and function description
>sp|O59493|TRM1_PYRHO tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=trm1 PE=1 SV=1 Back     alignment and function description
>sp|Q9V1P3|TRM1_PYRAB tRNA (guanine(26)-N(2))-dimethyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=trm1 PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
158298627 506 AGAP009740-PA [Anopheles gambiae str. PE 0.88 0.130 0.742 4e-23
170041673 557 N(2),N(2)-dimethylguanosine tRNA methylt 0.88 0.118 0.727 6e-23
157125947 571 tRNA (guanine-N2-)-methyltransferase, pu 0.88 0.115 0.727 6e-23
380024541 510 PREDICTED: probable tRNA (guanine(26)-N( 0.906 0.133 0.691 9e-23
328780361 839 PREDICTED: probable N(2),N(2)-dimethylgu 0.906 0.081 0.691 1e-22
312373612 356 hypothetical protein AND_17213 [Anophele 0.88 0.185 0.727 5e-22
357624400 547 putative tRNA (guanine-N2-)-methyltransf 0.986 0.135 0.662 6e-22
156552980 529 PREDICTED: probable N(2),N(2)-dimethylgu 0.986 0.139 0.648 7e-22
270012196 479 hypothetical protein TcasGA2_TC006307 [T 0.906 0.141 0.676 3e-21
189240047 930 PREDICTED: similar to Probable N(2),N(2) 0.906 0.073 0.676 3e-21
>gi|158298627|ref|XP_318825.4| AGAP009740-PA [Anopheles gambiae str. PEST] gi|157013975|gb|EAA14208.5| AGAP009740-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  111 bits (278), Expect = 4e-23,   Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 55/66 (83%)

Query: 9   RHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKT 68
           + F AIDLDP+G+PTRFLD AV S+ DGGLLL+T TDMAVL GNTPE CYVKY +V LKT
Sbjct: 157 QRFTAIDLDPYGHPTRFLDGAVQSIEDGGLLLITATDMAVLAGNTPEACYVKYGSVPLKT 216

Query: 69  AACHEM 74
            ACHEM
Sbjct: 217 KACHEM 222




Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170041673|ref|XP_001848579.1| N(2),N(2)-dimethylguanosine tRNA methyltransferase [Culex quinquefasciatus] gi|167865239|gb|EDS28622.1| N(2),N(2)-dimethylguanosine tRNA methyltransferase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157125947|ref|XP_001654461.1| tRNA (guanine-N2-)-methyltransferase, putative [Aedes aegypti] gi|108873471|gb|EAT37696.1| AAEL010349-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|380024541|ref|XP_003696053.1| PREDICTED: probable tRNA (guanine(26)-N(2))-dimethyltransferase-like [Apis florea] Back     alignment and taxonomy information
>gi|328780361|ref|XP_003249791.1| PREDICTED: probable N(2),N(2)-dimethylguanosine tRNA methyltransferase-like [Apis mellifera] Back     alignment and taxonomy information
>gi|312373612|gb|EFR21322.1| hypothetical protein AND_17213 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|357624400|gb|EHJ75185.1| putative tRNA (guanine-N2-)-methyltransferase [Danaus plexippus] Back     alignment and taxonomy information
>gi|156552980|ref|XP_001603751.1| PREDICTED: probable N(2),N(2)-dimethylguanosine tRNA methyltransferase-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270012196|gb|EFA08644.1| hypothetical protein TcasGA2_TC006307 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240047|ref|XP_966393.2| PREDICTED: similar to Probable N(2),N(2)-dimethylguanosine tRNA methyltransferase (tRNA(guanine-26,N(2)-N(2)) methyltransferase) (tRNA 2,2-dimethylguanosine-26 methyltransferase) (tRNA(m(2,2)G26)dimethyltransferase) [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query75
UNIPROTKB|K7EJX9 191 TRMT1 "tRNA (guanine(26)-N(2)) 0.96 0.376 0.630 6.3e-21
UNIPROTKB|F1MAP8 625 Trmt1 "Protein Trmt1" [Rattus 0.96 0.115 0.657 3.3e-20
UNIPROTKB|J9P9R4 637 TRMT1 "Uncharacterized protein 0.96 0.113 0.643 3.5e-20
UNIPROTKB|E2QUE2 694 TRMT1 "Uncharacterized protein 0.96 0.103 0.643 4.1e-20
MGI|MGI:1289155 663 Trmt1 "tRNA methyltransferase 0.853 0.096 0.703 4.9e-20
UNIPROTKB|Q9NXH9 659 TRMT1 "tRNA (guanine(26)-N(2)) 0.96 0.109 0.630 6.1e-20
UNIPROTKB|F1SD98 542 TRMT1 "Uncharacterized protein 0.96 0.132 0.643 6.5e-20
UNIPROTKB|I3LQ55 577 I3LQ55 "Uncharacterized protei 0.96 0.124 0.643 7.6e-20
UNIPROTKB|F6R277 662 TRMT1 "Uncharacterized protein 0.96 0.108 0.643 7.9e-20
FB|FBgn0032430 578 CG6388 [Drosophila melanogaste 0.88 0.114 0.666 1.6e-19
UNIPROTKB|K7EJX9 TRMT1 "tRNA (guanine(26)-N(2))-dimethyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 246 (91.7 bits), Expect = 6.3e-21, P = 6.3e-21
 Identities = 46/73 (63%), Positives = 58/73 (79%)

Query:     2 QLEKIRGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKY 61
             Q +++  R FD IDLDP+G+P  FLDAAV ++ +GGLL VTCTDMAVL GN+ ETCY KY
Sbjct:     5 QHQRVSER-FDVIDLDPYGSPATFLDAAVQAVSEGGLLCVTCTDMAVLAGNSGETCYSKY 63

Query:    62 NAVSLKTAACHEM 74
              A++LK+ ACHEM
Sbjct:    64 GAMALKSRACHEM 76




GO:0003723 "RNA binding" evidence=IEA
GO:0004809 "tRNA (guanine-N2-)-methyltransferase activity" evidence=IEA
UNIPROTKB|F1MAP8 Trmt1 "Protein Trmt1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P9R4 TRMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUE2 TRMT1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1289155 Trmt1 "tRNA methyltransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NXH9 TRMT1 "tRNA (guanine(26)-N(2))-dimethyltransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SD98 TRMT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LQ55 I3LQ55 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F6R277 TRMT1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0032430 CG6388 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A3CW75TRM1_METMJ2, ., 1, ., 1, ., 2, 1, 60.56520.58660.1185yesN/A
A9A871TRM1_METM62, ., 1, ., 1, ., 2, 1, 60.55170.760.1528yesN/A
O59493TRM1_PYRHO2, ., 1, ., 1, ., 2, 1, 60.52940.90660.1784yesN/A
Q9SRU7TRM2_ARATH2, ., 1, ., 1, ., 2, 1, 60.56060.880.1120yesN/A
A5UM08TRM1_METS32, ., 1, ., 1, ., 2, 1, 60.50680.960.1855yesN/A
Q3TX08TRM1_MOUSE2, ., 1, ., 1, ., 2, 1, 60.69230.86660.0980yesN/A
C5A6N2TRM1_THEGJ2, ., 1, ., 1, ., 2, 1, 60.50760.86660.1719yesN/A
Q9NXH9TRM1_HUMAN2, ., 1, ., 1, ., 2, 1, 60.63010.960.1092yesN/A
Q5JIB3TRM1_PYRKO2, ., 1, ., 1, ., 2, 1, 60.50760.86660.1728yesN/A
Q9VK89TRM1_DROME2, ., 1, ., 1, ., 2, 1, 60.66660.880.1141yesN/A
Q23270TRM1_CAEEL2, ., 1, ., 1, ., 2, 1, 60.55260.98660.1406yesN/A
A6VIL5TRM1_METM72, ., 1, ., 1, ., 2, 1, 60.55170.760.1528yesN/A
Q9P804TRM1_SCHPO2, ., 1, ., 1, ., 2, 1, 60.55380.85330.1167yesN/A
P81554TRM1_PYRFU2, ., 1, ., 1, ., 2, 1, 60.51470.90660.1784yesN/A
A4FZY5TRM1_METM52, ., 1, ., 1, ., 2, 1, 60.55170.760.1528yesN/A
P0CW64TRM1_METMI2, ., 1, ., 1, ., 2, 1, 60.56890.760.1528yesN/A
P0CW65TRM1_METMP2, ., 1, ., 1, ., 2, 1, 60.56890.760.1528yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
pfam02005 375 pfam02005, TRM, N2,N2-dimethylguanosine tRNA methy 3e-34
COG1867 380 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyl 3e-28
PRK04338 382 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tR 7e-26
TIGR00308 374 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltran 5e-24
>gnl|CDD|216840 pfam02005, TRM, N2,N2-dimethylguanosine tRNA methyltransferase Back     alignment and domain information
 Score =  119 bits (300), Expect = 3e-34
 Identities = 41/68 (60%), Positives = 47/68 (69%)

Query: 7   RGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSL 66
             R FD IDLDPFG+P  FLD+AV S++ GGLL VT TD AVLCG  PE C  KY AV L
Sbjct: 117 NHRRFDVIDLDPFGSPAPFLDSAVQSVKRGGLLCVTATDTAVLCGAYPEACLRKYGAVPL 176

Query: 67  KTAACHEM 74
           +   CHE+
Sbjct: 177 RGEFCHEV 184


This enzyme EC:2.1.1.32 used S-AdoMet to methylate tRNA. The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs. The enzyme is found in both eukaryotes and archaebacteria. Length = 375

>gnl|CDD|224780 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235286 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|232913 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 75
PF02005 377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 100.0
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 100.0
KOG1253|consensus 525 99.98
TIGR00308 374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 99.95
PRK04338 382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.87
PRK04457262 spermidine synthase; Provisional 89.55
PRK14901434 16S rRNA methyltransferase B; Provisional 88.16
TIGR00640132 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal 85.33
PLN02366308 spermidine synthase 85.16
PRK00811283 spermidine synthase; Provisional 84.71
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 84.24
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 84.03
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 83.18
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 82.98
PRK00536262 speE spermidine synthase; Provisional 82.51
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 82.46
PRK03612521 spermidine synthase; Provisional 81.14
PLN02823336 spermine synthase 80.86
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
Probab=100.00  E-value=4.9e-35  Score=222.24  Aligned_cols=73  Identities=59%  Similarity=1.018  Sum_probs=58.7

Q ss_pred             ccccccCCCCceeeeCCCCCchhhHHHHHHhcccCcEEEEEecCcccccCCChhHHHHHhcCcccCCCCccCCC
Q psy4127           2 QLEKIRGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEMP   75 (75)
Q Consensus         2 ~m~~~~~~~fD~IDlDPfGSp~pfldsA~~av~~gGll~vTaTD~a~L~G~~~~~~~r~Yg~~~~~~~~~~E~~   75 (75)
                      +|+. .+++||+|||||||||+||||+|+|++++||+|+|||||+++|||++|++|+||||++|++++++||++
T Consensus       114 ll~~-~~~~fD~IDlDPfGSp~pfldsA~~~v~~gGll~vTaTD~a~L~G~~~~~~~r~Yg~~~~~~~~~~E~g  186 (377)
T PF02005_consen  114 LLYS-RQERFDVIDLDPFGSPAPFLDSALQAVKDGGLLCVTATDTAVLCGSYPEKCFRKYGAVPRKTPYCHEMG  186 (377)
T ss_dssp             HHCH-STT-EEEEEE--SS--HHHHHHHHHHEEEEEEEEEEE--HHHHTTSSHHHHHHHHSSB---STTHHHHH
T ss_pred             Hhhh-ccccCCEEEeCCCCCccHhHHHHHHHhhcCCEEEEeccccccccCCChhHHHHhcCCcccCCCcccHHH
Confidence            4542 467899999999999999999999999999999999999999999999999999999999999999974



1.1.32 from EC uses S-adenosyl-L-methionine to methylate tRNA: S-AdoMet + tRNA = S-adenosyl-L-homocysteine + tRNA containing N2-methylguanine The TRM1 gene of Saccharomyces cerevisiae is necessary for the N2,N2-dimethylguanosine modification of both mitochondrial and cytoplasmic tRNAs []. The enzyme is found in both eukaryotes and archaea [].; GO: 0003723 RNA binding, 0004809 tRNA (guanine-N2-)-methyltransferase activity, 0008033 tRNA processing; PDB: 2YTZ_B 2DUL_A 2EJU_A 2EJT_A 3AXT_A 3AXS_A.

>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1253|consensus Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
2dul_A 378 Crystal Structure Of Trna G26 Methyltransferase Trm 7e-15
3axs_A 392 Complex Structure Of Trna Methyltransferase Trm1 Fr 1e-11
>pdb|2DUL|A Chain A, Crystal Structure Of Trna G26 Methyltransferase Trm1 In Apo Form From Pyrococcus Horikoshii Length = 378 Back     alignment and structure

Iteration: 1

Score = 75.5 bits (184), Expect = 7e-15, Method: Composition-based stats. Identities = 36/68 (52%), Positives = 43/68 (63%) Query: 7 RGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSL 66 R R+F IDLDPFG+P FLD A+ S + G+L VT TD A LCG P C KY AV L Sbjct: 128 RHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLCGAHPRACLRKYLAVPL 187 Query: 67 KTAACHEM 74 + CHE+ Sbjct: 188 RGELCHEV 195
>pdb|3AXS|A Chain A, Complex Structure Of Trna Methyltransferase Trm1 From Aquifex Aeolicus With Sinefungin Length = 392 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query75
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 2e-21
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 4e-18
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Length = 378 Back     alignment and structure
 Score = 84.5 bits (208), Expect = 2e-21
 Identities = 36/69 (52%), Positives = 43/69 (62%)

Query: 7   RGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSL 66
           R R+F  IDLDPFG+P  FLD A+ S +  G+L VT TD A LCG  P  C  KY AV L
Sbjct: 128 RHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLCGAHPRACLRKYLAVPL 187

Query: 67  KTAACHEMP 75
           +   CHE+ 
Sbjct: 188 RGELCHEVG 196


>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Length = 392 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.68
2dul_A 378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.68
3k6r_A278 Putative transferase PH0793; structural genomics, 95.13
2frn_A278 Hypothetical protein PH0793; structural genomics, 92.92
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 92.67
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 91.96
1ws6_A171 Methyltransferase; structural genomics, riken stru 89.49
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 88.04
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 87.52
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 86.82
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 86.46
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 85.24
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 85.2
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 85.11
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 85.02
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 84.87
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 84.23
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 83.87
2avd_A229 Catechol-O-methyltransferase; structural genomics, 83.73
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 83.18
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 83.16
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 82.58
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 82.3
3gjy_A317 Spermidine synthase; APC62791, structural genomics 82.27
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 82.1
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 82.0
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 81.95
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 81.13
3duw_A223 OMT, O-methyltransferase, putative; alternating of 80.95
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 80.85
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 80.8
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 80.29
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 80.28
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 80.19
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 80.06
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
Probab=99.68  E-value=9.4e-18  Score=126.58  Aligned_cols=67  Identities=43%  Similarity=0.784  Sum_probs=64.3

Q ss_pred             CCCCceeeeCCCCCchhhHHHHHHhcccCcEEEEEecCcccccCCChhHHHHHhcCcccCCCCccCC
Q psy4127           8 GRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEM   74 (75)
Q Consensus         8 ~~~fD~IDlDPfGSp~pfldsA~~av~~gGll~vTaTD~a~L~G~~~~~~~r~Yg~~~~~~~~~~E~   74 (75)
                      .+.||+|++||||++.+|+++|++.+++||+|++|+||+++|+|+.+..|+|+||..|.+.+++||+
T Consensus       123 ~~~fD~V~lDP~g~~~~~l~~a~~~Lk~gGll~~t~t~~~~l~g~~~~~~~rkYg~~p~r~~~~~e~  189 (392)
T 3axs_A          123 GFGFDYVDLDPFGTPVPFIESVALSMKRGGILSLTATDTAPLSGTYPKTCMRRYMARPLRNEFKHEV  189 (392)
T ss_dssp             SSCEEEEEECCSSCCHHHHHHHHHHEEEEEEEEEEECCHHHHTTSSHHHHHHHHSSBCCCSTTHHHH
T ss_pred             CCCCcEEEECCCcCHHHHHHHHHHHhCCCCEEEEEecchhhhccccHHHHHHHhCCcccccccccch
Confidence            3479999999999999999999999999999999999999999999999999999999999999985



>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 75
d2dula1 375 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tR 5e-22
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Length = 375 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: TRM1-like
domain: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1
species: Pyrococcus horikoshii [TaxId: 53953]
 Score = 84.7 bits (209), Expect = 5e-22
 Identities = 36/69 (52%), Positives = 43/69 (62%)

Query: 7   RGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSL 66
           R R+F  IDLDPFG+P  FLD A+ S +  G+L VT TD A LCG  P  C  KY AV L
Sbjct: 126 RHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLCGAHPRACLRKYLAVPL 185

Query: 67  KTAACHEMP 75
           +   CHE+ 
Sbjct: 186 RGELCHEVG 194


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query75
d2dula1 375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 99.97
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 93.93
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 90.09
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 89.28
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 88.45
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 88.15
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 86.75
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 84.14
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 81.96
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 81.75
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 81.38
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 81.22
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: TRM1-like
domain: N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=99.97  E-value=4.4e-33  Score=207.70  Aligned_cols=69  Identities=52%  Similarity=0.867  Sum_probs=66.4

Q ss_pred             cCCCCceeeeCCCCCchhhHHHHHHhcccCcEEEEEecCcccccCCChhHHHHHhcCcccCCCCccCCC
Q psy4127           7 RGRHFDAIDLDPFGNPTRFLDAAVSSLRDGGLLLVTCTDMAVLCGNTPETCYVKYNAVSLKTAACHEMP   75 (75)
Q Consensus         7 ~~~~fD~IDlDPfGSp~pfldsA~~av~~gGll~vTaTD~a~L~G~~~~~~~r~Yg~~~~~~~~~~E~~   75 (75)
                      ++++||+|||||||||+||||+|++++++||+|+|||||+++|||++|++|+||||+.+++++++||++
T Consensus       126 ~~~~fDvIDiDPfGs~~pfldsAi~a~~~~Gll~vTaTD~a~L~G~~~~~~~r~Yg~~~~~~~~~~E~g  194 (375)
T d2dula1         126 RHRYFHFIDLDPFGSPMEFLDTALRSAKRRGILGVTATDGAPLCGAHPRACLRKYLAVPLRGELCHEVG  194 (375)
T ss_dssp             STTCEEEEEECCSSCCHHHHHHHHHHEEEEEEEEEEECCHHHHTTSSHHHHHHHHSSBCCCSTTHHHHH
T ss_pred             hcCcCCcccCCCCCCcHHHHHHHHHHhccCCEEEEEecCchhhcCCCcHHHHHHhCCeecCCcccchHH
Confidence            356799999999999999999999999999999999999999999999999999999999999999974



>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure