Psyllid ID: psy4141


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350---
MKKISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVSSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIS
cEEEccccHHHHHHHHHHccEEEcccccccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEccccccEEEccccHHHHHHHHHccEEEEcccccccccEEEccccHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccEEEEccccccccHHHHHHHcccccccccccHHHHccccccc
cccccccccEHHHHHHccccEEEccccccccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccEEEEEEEcEEEEEEEEcccccHHHHHHHccccEEEccccccccEEEEcccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHHHcccccccccccHHHHHEEEcc
mkkisrsgckIKALRAKTntyiktpvrgeepvfvvTGRKEDVARAKREILSAADHFSALRAsrksgalsplspptgvpghvtieVRVPYKVVGLvvgpkgatiKRIQHQtntyivtpsrdkepvfevtgapdsVEIARQEIESHIIrrtgscvtpaeavlngddNSADLLASLCNSGLGSLGTILnyvngtsgpasdsygagpgefnfnmplsssqmnhhvfsgssgcssasssssssacaphsstqldlgsiwsgmssldkdeglgdspsfdaspvnpssiwsyppvsstspsgsisgsrqcylcndrevthalipcghnffcsecaertcdfdrtcpmcrvpvnqamriis
mkkisrsgckikalraktntyiktpvrgeepvfvvtgrkedVARAKREILSAADHFSALRASRksgalsplspptgvpghvTIEVRVPYKVVGLVVgpkgatikriqhqtntyivtpsrdkepvfevtgapdsveIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVSSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFdrtcpmcrvpvnqamriis
MKKISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFsgssgcssasssssssacaphssTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWsyppvsstspsgsisgsRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIS
*********KIKALRAKTNTYIKTPVRGEEPVFVVTGRKE*V**********************************VPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPS****PVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSLGTILNYVNG***************************************************************************************************************QCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQA*****
MKKISRSGCKIKALRAKTNTYIKTP*RG*E***VVTGRKEDVARAKREI**********************************EVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVT***********TGAPDSVEIARQEIESHII**********EAVLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVSSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIS
MKKISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHH**************************QLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSY***************RQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIS
*****RSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASR************GVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFSGSSG************************************************************************SRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFSGSSGCSSASSSSSSSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVSSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRIIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query353 2.2.26 [Sep-21-2011]
Q05A36652 RNA-binding E3 ubiquitin- yes N/A 0.779 0.421 0.496 4e-61
Q5U5Q3659 RNA-binding E3 ubiquitin- yes N/A 0.787 0.421 0.482 5e-61
A1L3F4507 RNA-binding protein MEX3B N/A N/A 0.589 0.410 0.585 1e-60
Q6ZN04 569 RNA-binding protein MEX3B no N/A 0.470 0.291 0.695 9e-59
A1L020520 RNA-binding protein MEX3A no N/A 0.447 0.303 0.686 3e-58
Q69Z36 601 RNA-binding protein MEX3B no N/A 0.458 0.269 0.706 9e-58
Q86XN8 651 RNA-binding protein MEX3D no N/A 0.478 0.259 0.660 6e-57
Q3UE17 643 RNA-binding protein MEX3D no N/A 0.475 0.261 0.666 2e-56
Q8JHV9401 Baculoviral IAP repeat-co N/A N/A 0.184 0.162 0.333 8e-06
A9ULZ2345 Baculoviral IAP repeat-co N/A N/A 0.178 0.182 0.328 1e-05
>sp|Q05A36|MEX3C_MOUSE RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Mus musculus GN=Mex3c PE=2 SV=2 Back     alignment and function desciption
 Score =  235 bits (599), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 155/312 (49%), Positives = 198/312 (63%), Gaps = 37/312 (11%)

Query: 4   ISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASR 63
           + R GCKIKALRAKTNTYIKTPVRGEEP+FVVTGRKEDVA AKREILSAA+HFS +RASR
Sbjct: 241 VGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASR 300

Query: 64  -KSG-ALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDK 121
            K+G AL  LS    +PG  T++VRVPY+VVGLVVGPKGATIKRIQ QT+TYIVTPSRDK
Sbjct: 301 NKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 360

Query: 122 EPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNSGLGSL 181
           EPVFEVTG P++V+ AR+EIE HI  RTG+ +      LN +++                
Sbjct: 361 EPVFEVTGMPENVDRAREEIEMHIAMRTGNYIE-----LNEEND------------FHYN 403

Query: 182 GTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFSGSSGCSSASSSS--SSSA 239
           GT +++  GT G A  S    P       P  +  M+++    SS   S S+ S   S+ 
Sbjct: 404 GTDVSFEGGTLGSAWLSSNPVP-------PSRARMMSNYRNDSSSSLGSGSTDSYFGSNR 456

Query: 240 CAPHSSTQ-LDLGSIWSG--MSSLDKDEGLGDSPSFDASPVNPSSIWS-YPPVSSTS--- 292
            A  S T     G+ W G  + S+  ++   DSP+FD+ P +  +IW+ + PV+  S   
Sbjct: 457 LADFSPTSPFSTGNFWFGDTLPSVGSEDLTVDSPAFDSLPTSAQTIWTPFEPVNPLSGFG 516

Query: 293 --PSGSISGSRQ 302
             PSG++   R+
Sbjct: 517 SDPSGNMKTQRR 528




RNA-binding protein. May be involved in post-transcriptional regulatory mechanisms.
Mus musculus (taxid: 10090)
>sp|Q5U5Q3|MEX3C_HUMAN RNA-binding E3 ubiquitin-protein ligase MEX3C OS=Homo sapiens GN=MEX3C PE=1 SV=3 Back     alignment and function description
>sp|A1L3F4|MEX3B_XENLA RNA-binding protein MEX3B OS=Xenopus laevis GN=mex3b PE=2 SV=1 Back     alignment and function description
>sp|Q6ZN04|MEX3B_HUMAN RNA-binding protein MEX3B OS=Homo sapiens GN=MEX3B PE=1 SV=1 Back     alignment and function description
>sp|A1L020|MEX3A_HUMAN RNA-binding protein MEX3A OS=Homo sapiens GN=MEX3A PE=1 SV=1 Back     alignment and function description
>sp|Q69Z36|MEX3B_MOUSE RNA-binding protein MEX3B OS=Mus musculus GN=Mex3b PE=2 SV=2 Back     alignment and function description
>sp|Q86XN8|MEX3D_HUMAN RNA-binding protein MEX3D OS=Homo sapiens GN=MEX3D PE=1 SV=3 Back     alignment and function description
>sp|Q3UE17|MEX3D_MOUSE RNA-binding protein MEX3D OS=Mus musculus GN=Mex3d PE=2 SV=2 Back     alignment and function description
>sp|Q8JHV9|BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis GN=birc7-a PE=1 SV=1 Back     alignment and function description
>sp|A9ULZ2|BIR7B_XENLA Baculoviral IAP repeat-containing protein 7-B OS=Xenopus laevis GN=birc7-b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
219522040428 mex-3 protein [Tribolium castaneum] gi|2 0.872 0.719 0.582 2e-96
270002843410 hypothetical protein TcasGA2_TC001207 [T 0.872 0.751 0.582 4e-96
345483953444 PREDICTED: RNA-binding protein MEX3B-lik 0.883 0.702 0.525 3e-85
332022800422 RNA-binding protein MEX3A [Acromyrmex ec 0.841 0.703 0.533 7e-85
383860805418 PREDICTED: RNA-binding protein MEX3B-lik 0.895 0.755 0.530 5e-83
322797035326 hypothetical protein SINV_16493 [Solenop 0.869 0.941 0.524 3e-82
242017160389 conserved hypothetical protein [Pediculu 0.920 0.835 0.497 4e-82
66510891425 PREDICTED: RNA-binding protein MEX3B-lik 0.869 0.722 0.521 8e-82
340715365425 PREDICTED: RNA-binding protein MEX3B-lik 0.869 0.722 0.521 1e-81
350414446425 PREDICTED: RNA-binding protein MEX3B-lik 0.869 0.722 0.518 1e-81
>gi|219522040|ref|NP_001137201.1| mex-3 protein [Tribolium castaneum] gi|218464687|emb|CAM28380.2| KH domain protein [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  358 bits (920), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 212/364 (58%), Positives = 251/364 (68%), Gaps = 56/364 (15%)

Query: 4   ISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASR 63
           + R GCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVA+AKREILSAA+HFS +RASR
Sbjct: 104 VGRQGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVAKAKREILSAAEHFSQIRASR 163

Query: 64  K-------SGALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVT 116
           K       SGA +P  PP  +PGHVTI+VRVPY+VVGLVVGPKGATIKRIQHQT+TYIVT
Sbjct: 164 KNNLAGLGSGASTPPGPPANIPGHVTIQVRVPYRVVGLVVGPKGATIKRIQHQTHTYIVT 223

Query: 117 PSRDKEPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAVLNGDDNSADLLASLCNS 176
           PSRDKEPVFEVTG P+SVE AR+EIE+HI  RTG+      ++  G  +  DL +SL  S
Sbjct: 224 PSRDKEPVFEVTGLPESVESARREIEAHIAMRTGN----GASMGLGGLDDGDLFSSLYKS 279

Query: 177 GLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFSGSSGCSSASSSSS 236
           GL S   ILNY+              P +F    P++               SS  SSS 
Sbjct: 280 GLSS---ILNYIE-------------PEQF----PMTG--------------SSTFSSSG 305

Query: 237 SSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPSSIWSYPPVS------S 290
           S + +  SS   DLG+IW   SS ++DEGLGDSPSFD+S    SSIWSYPPV+      S
Sbjct: 306 SCSSSSSSSGGRDLGAIW---SSSERDEGLGDSPSFDSS-TALSSIWSYPPVAPSRPSNS 361

Query: 291 TSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCD-FDRTCPMCRVPVNQAM 349
           TSP+ S+ GS +C +C + +VTHAL+PCGHNFFC ECA R CD  +  CP+C +P  QA+
Sbjct: 362 TSPADSLLGSAKCLVCGEAKVTHALVPCGHNFFCMECANRVCDGTEAQCPVCSLPAIQAI 421

Query: 350 RIIS 353
           RI S
Sbjct: 422 RIYS 425




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270002843|gb|EEZ99290.1| hypothetical protein TcasGA2_TC001207 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345483953|ref|XP_001604798.2| PREDICTED: RNA-binding protein MEX3B-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332022800|gb|EGI63073.1| RNA-binding protein MEX3A [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383860805|ref|XP_003705879.1| PREDICTED: RNA-binding protein MEX3B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322797035|gb|EFZ19349.1| hypothetical protein SINV_16493 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|242017160|ref|XP_002429060.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212513915|gb|EEB16322.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|66510891|ref|XP_623265.1| PREDICTED: RNA-binding protein MEX3B-like isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|340715365|ref|XP_003396185.1| PREDICTED: RNA-binding protein MEX3B-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350414446|ref|XP_003490320.1| PREDICTED: RNA-binding protein MEX3B-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query353
UNIPROTKB|F1N0W7516 MEX3C "Uncharacterized protein 0.597 0.408 0.600 2.4e-75
MGI|MGI:2652843652 Mex3c "mex3 homolog C (C. eleg 0.424 0.230 0.756 3e-75
RGD|1309023511 Mex3c "mex-3 homolog C (C. ele 0.424 0.293 0.756 3e-75
UNIPROTKB|D4A2R5464 Mex3c "Protein Mex3c" [Rattus 0.424 0.323 0.756 3e-75
MGI|MGI:1918252 601 Mex3b "mex3 homolog B (C. eleg 0.492 0.289 0.687 7.9e-75
UNIPROTKB|F1PM07 567 MEX3B "Uncharacterized protein 0.504 0.313 0.677 1e-74
UNIPROTKB|J9JHU9 580 MEX3B "Uncharacterized protein 0.504 0.306 0.677 1e-74
RGD|1306790 601 Mex3b "mex3 homolog B (C. eleg 0.492 0.289 0.687 2.1e-74
UNIPROTKB|E1BM86 468 E1BM86 "Uncharacterized protei 0.492 0.371 0.687 2.6e-74
UNIPROTKB|I3LE70387 MEX3C "Uncharacterized protein 0.586 0.534 0.607 3.3e-74
UNIPROTKB|F1N0W7 MEX3C "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 577 (208.2 bits), Expect = 2.4e-75, Sum P(3) = 2.4e-75
 Identities = 137/228 (60%), Positives = 162/228 (71%)

Query:     4 ISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASR 63
             + R GCKIKALRAKTNTYIKTPVRGEEP+FVVTGRKEDVA AKREILSAA+HFS +RASR
Sbjct:   105 VGRQGCKIKALRAKTNTYIKTPVRGEEPIFVVTGRKEDVAMAKREILSAAEHFSMIRASR 164

Query:    64 -KSG-ALSPLSPPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDK 121
              K+G AL  LS    +PG  T++VRVPY+VVGLVVGPKGATIKRIQ QT+TYIVTPSRDK
Sbjct:   165 NKNGPALGGLSCSPNLPGQTTVQVRVPYRVVGLVVGPKGATIKRIQQQTHTYIVTPSRDK 224

Query:   122 EPVFEVTGAPDSVEIARQEIESHIIRRTGSCVTPAEAV---LNGDDNSAD--LLAS--LC 174
             EPVFEVTG P++V+ AR+EIE HI  RTG+ +   E      NG D S +   L S  L 
Sbjct:   225 EPVFEVTGMPENVDRAREEIEMHIAMRTGNYIELNEENDFHYNGTDVSFEGGTLGSAWLS 284

Query:   175 NSGL--GSLGTILNYVNGTS---GPAS-DSY-GAGP-GEFNFNMPLSS 214
             ++ +       I NY N +S   G  S DSY G+    +F+   P S+
Sbjct:   285 SNPVPPSRARMISNYRNDSSSSLGSGSTDSYFGSNRLADFSPTSPFST 332


GO:0043231 "intracellular membrane-bounded organelle" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
MGI|MGI:2652843 Mex3c "mex3 homolog C (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309023 Mex3c "mex-3 homolog C (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A2R5 Mex3c "Protein Mex3c" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1918252 Mex3b "mex3 homolog B (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PM07 MEX3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHU9 MEX3B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1306790 Mex3b "mex3 homolog B (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1BM86 E1BM86 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LE70 MEX3C "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
smart0032268 smart00322, KH, K homology RNA-binding domain 9e-16
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 9e-15
pfam0001359 pfam00013, KH_1, KH domain 3e-14
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 2e-11
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 9e-11
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 4e-07
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 5e-07
smart0032268 smart00322, KH, K homology RNA-binding domain 4e-06
pfam0001359 pfam00013, KH_1, KH domain 1e-05
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 2e-05
cd0239462 cd02394, vigilin_like_KH, K homology RNA-binding d 3e-05
cd0016245 cd00162, RING, RING-finger (Really Interesting New 4e-05
pfam1301442 pfam13014, KH_3, KH domain 4e-05
cd0239665 cd02396, PCBP_like_KH, K homology RNA-binding doma 3e-04
cd0240968 cd02409, KH-II, KH-II (K homology RNA-binding doma 0.001
smart0018440 smart00184, RING, Ring finger 0.002
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
 Score = 70.8 bits (174), Expect = 9e-16
 Identities = 27/66 (40%), Positives = 41/66 (62%), Gaps = 1/66 (1%)

Query: 81  VTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYI-VTPSRDKEPVFEVTGAPDSVEIARQ 139
           VTIEV +P   VGL++G  G+TIK+I+ +T   I +     +E V E+TG P++VE A +
Sbjct: 3   VTIEVLIPADKVGLIIGKGGSTIKKIEEETGVKIDIPGPGSEERVVEITGPPENVEKAAE 62

Query: 140 EIESHI 145
            I   +
Sbjct: 63  LILEIL 68


Length = 68

>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|239087 cd02394, vigilin_like_KH, K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|239089 cd02396, PCBP_like_KH, K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>gnl|CDD|239092 cd02409, KH-II, KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 353
KOG2113|consensus394 99.96
KOG2191|consensus402 99.83
KOG1676|consensus600 99.82
KOG1676|consensus600 99.78
KOG2190|consensus485 99.69
KOG2193|consensus584 99.68
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 99.67
KOG2192|consensus390 99.63
KOG2193|consensus584 99.61
PRK13763180 putative RNA-processing protein; Provisional 99.61
KOG2192|consensus390 99.61
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 99.37
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 99.37
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 99.36
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.36
KOG2113|consensus394 99.29
KOG2190|consensus485 99.27
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 99.26
KOG4172|consensus62 99.2
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.17
smart0032269 KH K homology RNA-binding domain. 99.07
KOG4265|consensus349 99.0
PF1301443 KH_3: KH domain 98.89
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.83
KOG2191|consensus402 98.81
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 98.78
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 98.77
KOG0317|consensus293 98.77
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 98.75
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.7
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 98.7
PHA02929238 N1R/p28-like protein; Provisional 98.69
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 98.66
KOG0823|consensus 230 98.65
KOG0320|consensus187 98.64
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 98.63
COG1094194 Predicted RNA-binding protein (contains KH domains 98.63
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.6
PRK13763180 putative RNA-processing protein; Provisional 98.56
KOG2279|consensus 608 98.56
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.55
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.53
KOG4275|consensus350 98.51
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.49
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 98.47
KOG1571|consensus355 98.42
KOG2208|consensus753 98.42
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.42
PF1301443 KH_3: KH domain 98.41
KOG0287|consensus 442 98.41
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.4
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.4
PHA02926242 zinc finger-like protein; Provisional 98.39
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.35
PF1463444 zf-RING_5: zinc-RING finger domain 98.33
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.3
smart0032269 KH K homology RNA-binding domain. 98.28
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 98.25
KOG2164|consensus 513 98.16
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.15
KOG2177|consensus 386 98.13
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 98.12
KOG0119|consensus 554 98.08
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.03
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.02
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.01
KOG0978|consensus698 97.98
KOG2208|consensus 753 97.97
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 97.94
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.87
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 97.85
KOG1100|consensus207 97.85
KOG0336|consensus 629 97.76
KOG1588|consensus259 97.74
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 97.72
KOG1785|consensus 563 97.7
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 97.66
KOG4628|consensus348 97.65
KOG0802|consensus 543 97.61
KOG4159|consensus 398 97.5
PRK08406140 transcription elongation factor NusA-like protein; 97.48
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.4
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.39
KOG4692|consensus489 97.38
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 97.36
KOG2814|consensus345 97.36
KOG2279|consensus608 97.33
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 97.17
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 97.17
PRK12704520 phosphodiesterase; Provisional 97.12
PRK00106535 hypothetical protein; Provisional 97.12
KOG0311|consensus 381 97.09
KOG2879|consensus298 97.05
COG5152259 Uncharacterized conserved protein, contains RING a 97.04
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 96.86
COG1094194 Predicted RNA-binding protein (contains KH domains 96.84
COG5176269 MSL5 Splicing factor (branch point binding protein 96.83
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 96.8
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 96.77
KOG1039|consensus 344 96.72
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 96.72
KOG1067|consensus760 96.62
KOG0828|consensus636 96.59
COG0195190 NusA Transcription elongation factor [Transcriptio 96.42
KOG2660|consensus 331 96.36
KOG1813|consensus313 96.27
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 96.23
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.22
KOG0297|consensus 391 96.19
PRK12705508 hypothetical protein; Provisional 96.18
KOG2814|consensus345 96.08
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 96.0
KOG1002|consensus 791 95.97
KOG0804|consensus 493 95.93
PRK0046875 hypothetical protein; Provisional 95.78
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 95.77
KOG0336|consensus 629 95.67
PRK0282177 hypothetical protein; Provisional 95.66
COG183776 Predicted RNA-binding protein (contains KH domain) 95.48
KOG0825|consensus 1134 95.42
KOG1734|consensus328 95.38
PRK12328374 nusA transcription elongation factor NusA; Provisi 95.37
KOG0119|consensus554 95.26
KOG0826|consensus357 95.26
TIGR01953341 NusA transcription termination factor NusA. This m 95.24
PRK12327362 nusA transcription elongation factor NusA; Provisi 95.04
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 94.77
PRK0106478 hypothetical protein; Provisional 94.67
KOG1001|consensus 674 94.53
PRK12329449 nusA transcription elongation factor NusA; Provisi 94.52
PRK09202470 nusA transcription elongation factor NusA; Validat 94.49
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 94.32
COG5222427 Uncharacterized conserved protein, contains RING Z 94.13
KOG3273|consensus252 94.1
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.08
KOG3002|consensus 299 94.07
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 94.0
KOG0824|consensus 324 93.85
TIGR03319514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 93.63
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 93.61
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 93.59
PRK12704520 phosphodiesterase; Provisional 93.55
KOG3039|consensus303 93.52
PRK00106535 hypothetical protein; Provisional 93.47
COG5175 480 MOT2 Transcriptional repressor [Transcription] 93.4
cd02410145 archeal_CPSF_KH The archaeal cleavage and polyaden 93.28
PF1308373 KH_4: KH domain; PDB: 3GKU_B. 93.19
PLN00207891 polyribonucleotide nucleotidyltransferase; Provisi 93.09
COG52191525 Uncharacterized conserved protein, contains RING Z 93.0
KOG4369|consensus 2131 92.96
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 92.7
KOG2874|consensus356 92.63
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 92.59
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 92.53
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 92.14
KOG1814|consensus 445 92.01
KOG1588|consensus259 92.0
PRK08406140 transcription elongation factor NusA-like protein; 91.98
KOG1493|consensus84 91.98
PF14611210 SLS: Mitochondrial inner-membrane-bound regulator 91.97
COG1855604 ATPase (PilT family) [General function prediction 91.95
KOG2932|consensus 389 91.57
PF04641260 Rtf2: Rtf2 RING-finger 91.24
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 90.37
cd0241477 jag_KH jag_K homology RNA-binding domain. The KH d 90.35
PHA02825162 LAP/PHD finger-like protein; Provisional 90.13
COG5166657 Uncharacterized conserved protein [Function unknow 90.09
COG1782 637 Predicted metal-dependent RNase, consists of a met 89.51
PF0765078 KH_2: KH domain syndrome, contains KH motifs.; Int 89.45
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 89.39
KOG2874|consensus356 89.25
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 89.13
PRK13764602 ATPase; Provisional 89.06
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 88.71
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 88.7
KOG3273|consensus252 87.67
KOG1941|consensus518 87.59
KOG4362|consensus 684 87.39
TIGR01952141 nusA_arch NusA family KH domain protein, archaeal. 87.3
KOG1428|consensus 3738 86.47
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 86.16
TIGR03802562 Asp_Ala_antiprt aspartate-alanine antiporter. All 86.16
PRK12705508 hypothetical protein; Provisional 85.99
COG5176269 MSL5 Splicing factor (branch point binding protein 85.73
cd0241381 40S_S3_KH K homology RNA-binding (KH) domain of th 85.4
PHA02862156 5L protein; Provisional 85.03
KOG2930|consensus114 84.68
PRK0046875 hypothetical protein; Provisional 84.21
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 84.14
PF10272358 Tmpp129: Putative transmembrane protein precursor; 84.08
PF04710416 Pellino: Pellino; InterPro: IPR006800 Pellino is i 83.91
KOG3579|consensus352 83.83
KOG3842|consensus429 83.56
PRK0282177 hypothetical protein; Provisional 83.5
KOG4445|consensus 368 83.31
COG183776 Predicted RNA-binding protein (contains KH domain) 83.13
PHA03096284 p28-like protein; Provisional 82.76
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 82.44
KOG0827|consensus 465 82.18
PRK03818552 putative transporter; Validated 81.67
cd02412109 30S_S3_KH K homology RNA-binding (KH) domain of th 80.83
KOG0825|consensus 1134 80.24
>KOG2113|consensus Back     alignment and domain information
Probab=99.96  E-value=6.7e-30  Score=236.98  Aligned_cols=317  Identities=35%  Similarity=0.404  Sum_probs=232.3

Q ss_pred             eeecCCCchHHHHHHHcCceEEecCCCCcCeEEEecCHHHHHHHHHHHHHHHhhhhhhhhccCCCCCCCCCCCCCCCcce
Q psy4141           2 KKISRSGCKIKALRAKTNTYIKTPVRGEEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPTGVPGHV   81 (353)
Q Consensus         2 ~IIGk~G~~Ik~I~~~Tga~I~ip~~~e~~vv~I~G~~e~v~~Ak~~I~~i~~~~~~~~~~~~~g~~~~~~~~~~~~~~~   81 (353)
                      -|+|++|++||.|+.||+++|+.|.++++++|.++|.+++|++|+++|....+|+..+++.+.+....+.   ...+++.
T Consensus        39 ~ivg~qg~kikalr~KTqtyi~tPsr~eePiF~vTg~~edv~~aRrei~saaeH~~l~~~s~s~Sgg~~~---~s~s~qt  115 (394)
T KOG2113|consen   39 EIVGRQGCKIKALRAKTQTYIKTPSRGEEPIFPVTGRHEDVRRARREIPSAAEHFGLIRASRSFSGGTNG---ASASGQT  115 (394)
T ss_pred             eecccCccccchhhhhhcceeccCCCCCCCcceeccCchhHHHHhhcCccccceeeeeeecccccCCCcc---ccccCCC
Confidence            3789999999999999999999999999999999999999999999999999999887777765433222   1245678


Q ss_pred             EEEEEecCCCccceeccCChHHHHHHHHhCceEEcCCCCCCCeEEEEcCHHH-HHHHH-HHHHHHHHhhhCCCCc-cCcc
Q psy4141          82 TIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPDS-VEIAR-QEIESHIIRRTGSCVT-PAEA  158 (353)
Q Consensus        82 t~~v~VP~~~vG~IIGkgG~tIk~Iq~~Tga~I~ip~~~~e~~v~I~G~~e~-V~~A~-~~I~~~i~~r~g~~~~-~~d~  158 (353)
                      +.++.+|.+++|.|+|.+|++|++||+.++.+|..+.+..++++.++|.+++ +++|. .+|++.+..|.+...+ .+||
T Consensus       116 ~sy~svP~rvvglvv~~~~~ti~~iqq~tnt~I~T~v~~~~~Vf~Vtg~~~nC~kra~s~eie~ta~~ra~~i~d~dndf  195 (394)
T KOG2113|consen  116 TSYVSVPLRVVGLVVGPKGATIKRIQQFTNTYIATPVRCGEPVFCVTGAPKNCVKRARSCEIEQTAVTRAGQIHDTDNDF  195 (394)
T ss_pred             ceeeeccceeeeeccccccCccchheecccceEeeeccCCCceEEEecCCcchhhhccccchhhhhhhhhhccccCCccc
Confidence            9999999999999999999999999999999999999999999999999998 88898 8999999999999888 4799


Q ss_pred             ccCCCCccchHHHhhhhCCCCCccccccccCCCCCCCCCCCCCCCCCcccCCCCCccccCccccc--CCCCCCCCCCCCC
Q psy4141         159 VLNGDDNSADLLASLCNSGLGSLGTILNYVNGTSGPASDSYGAGPGEFNFNMPLSSSQMNHHVFS--GSSGCSSASSSSS  236 (353)
Q Consensus       159 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~  236 (353)
                      +.+..+++.+++.+.-..      ..++...+    .+..|.                   .+|.  ....|+.++|+++
T Consensus       196 ~~~la~v~l~v~~~~~a~------~~~~~~~~----~s~f~~-------------------~~~~n~~~~~~~~~sss~~  246 (394)
T KOG2113|consen  196 AGQLAGVSLMVQKQQQAQ------QQMQEAQQ----QSMFYR-------------------RAFGNSNPFNQKEMSSSPF  246 (394)
T ss_pred             cccccccchhhhhHHHHH------HHHhhcCc----cchHHH-------------------hcccCCCccchhhccCCCc
Confidence            999999988765421000      00111111    122221                   1222  1123455555555


Q ss_pred             CCCCCCCCCCcccccccccCCCCCCCCCCCCCCCCCCCCCCCCC------CCCCCCCC----------------------
Q psy4141         237 SSACAPHSSTQLDLGSIWSGMSSLDKDEGLGDSPSFDASPVNPS------SIWSYPPV----------------------  288 (353)
Q Consensus       237 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~~~~~~~~------~~~~~p~~----------------------  288 (353)
                      +..+.....+.......|...+..+.+++.|.+++....+...-      --|+..+.                      
T Consensus       247 ~~~s~~~~~~~~~~~~~~~ss~t~~~~~g~g~s~~~~~~~~~~~~~~~~~~~~~~~~s~~~i~~~e~~s~~~~~~~a~~~  326 (394)
T KOG2113|consen  247 GMESSLGLDALLRSFPSMRSSLTPESLSGTGLSRPSLGGGQSAKQDLPTYDYWGTNNSLNDIMENEILSRKYDALSAWSS  326 (394)
T ss_pred             ccccccccccchhhhhhhhccCCcccccccCCCccccCCccccccCCCcCCccccCcchhhhhhhhhhhhhcchhhcccc
Confidence            44443333344555667776555556677777766555433211      11111100                      


Q ss_pred             -----CCCCCCCCCCCCcccccccccccccEEeCCCCHhhhHHhHHHHhccCCCCCCcccccccceecc
Q psy4141         289 -----SSTSPSGSISGSRQCYLCNDREVTHALIPCGHNFFCSECAERTCDFDRTCPMCRVPVNQAMRII  352 (353)
Q Consensus       289 -----~~~~~~~~~~~~~~C~IC~~~~~~~~llpCgH~~fC~~C~~~~~~~~~~CP~Cr~~i~~~~ri~  352 (353)
                           --.++...+...++|.+|-+.....++.+|+|++||++|+..  .-...||+|......+++|.
T Consensus       327 ~~l~~~~~~~~~~~~s~~~~~~~~~~~~st~~~~~~~n~~~~~~a~~--s~~~~~~~c~~~~~~~~~i~  393 (394)
T KOG2113|consen  327 MGLEKREESPTNGLMSSLKGTSAGFGLLSTIWSGGNMNLSPGSLASA--SASPTSSTCDHNDHTLVPIN  393 (394)
T ss_pred             ccchhccccccccchhhcccccccCceeeeEeecCCcccChhhhhhc--ccCCccccccccceeeeecC
Confidence                 011233344557999999999999999999999999999983  23789999999888888774



>KOG2191|consensus Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG2208|consensus Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>KOG2279|consensus Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>COG0195 NusA Transcription elongation factor [Transcription] Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>PRK12328 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>TIGR01953 NusA transcription termination factor NusA Back     alignment and domain information
>PRK12327 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>PRK01064 hypothetical protein; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK12329 nusA transcription elongation factor NusA; Provisional Back     alignment and domain information
>PRK09202 nusA transcription elongation factor NusA; Validated Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>cd02410 archeal_CPSF_KH The archaeal cleavage and polyadenylation specificity factor (CPSF) contains an N-terminal K homology RNA-binding domain (KH) Back     alignment and domain information
>PF13083 KH_4: KH domain; PDB: 3GKU_B Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information
>KOG2874|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>PF14611 SLS: Mitochondrial inner-membrane-bound regulator Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd02414 jag_KH jag_K homology RNA-binding domain Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5166 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>PF07650 KH_2: KH domain syndrome, contains KH motifs Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2874|consensus Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>KOG3273|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>TIGR01952 nusA_arch NusA family KH domain protein, archaeal Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03802 Asp_Ala_antiprt aspartate-alanine antiporter Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>cd02413 40S_S3_KH K homology RNA-binding (KH) domain of the eukaryotic 40S small ribosomal subunit protein S3 Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>PRK00468 hypothetical protein; Provisional Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF04710 Pellino: Pellino; InterPro: IPR006800 Pellino is involved in Toll-like signalling pathways, and associates with the kinase domain of the Pelle Ser/Thr kinase [, , ] Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>KOG3842|consensus Back     alignment and domain information
>PRK02821 hypothetical protein; Provisional Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>COG1837 Predicted RNA-binding protein (contains KH domain) [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PRK03818 putative transporter; Validated Back     alignment and domain information
>cd02412 30S_S3_KH K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3 Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
2dgr_A83 Solution Structure Of The Second Kh Domain In Ring 3e-24
3t6p_A345 Iap Antagonist-Induced Conformational Change In Cia 2e-05
3eb5_A74 Structure Of The Ciap2 Ring Domain Length = 74 1e-04
2ecg_A75 Solution Structure Of The Ring Domain Of The Baculo 4e-04
4ic3_A74 Crystal Structure Of The F495l Mutant Xiap Ring Dom 5e-04
4ic2_A74 Crystal Structure Of The Xiap Ring Domain Length = 8e-04
2opu_A89 Solution Nmr Structure Of The First Domain Of Ksrp 8e-04
>pdb|2DGR|A Chain A, Solution Structure Of The Second Kh Domain In Ring Finger And Kh Domain Containing Protein 1 Length = 83 Back     alignment and structure

Iteration: 1

Score = 109 bits (272), Expect = 3e-24, Method: Compositional matrix adjust. Identities = 52/69 (75%), Positives = 62/69 (89%) Query: 82 TIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPDSVEIARQEI 141 TI+VRVPY+VVGLVVGPKGATIKRIQ +T+TYIVTP RDKEPVF VTG P++V+ AR+EI Sbjct: 11 TIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPENVDRAREEI 70 Query: 142 ESHIIRRTG 150 E+HI R+G Sbjct: 71 EAHITLRSG 79
>pdb|3T6P|A Chain A, Iap Antagonist-Induced Conformational Change In Ciap1 Promotes E3 Ligase Activation Via Dimerization Length = 345 Back     alignment and structure
>pdb|3EB5|A Chain A, Structure Of The Ciap2 Ring Domain Length = 74 Back     alignment and structure
>pdb|2ECG|A Chain A, Solution Structure Of The Ring Domain Of The Baculoviral Iap Repeat-Containing Protein 4 From Homo Sapiens Length = 75 Back     alignment and structure
>pdb|4IC3|A Chain A, Crystal Structure Of The F495l Mutant Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|4IC2|A Chain A, Crystal Structure Of The Xiap Ring Domain Length = 74 Back     alignment and structure
>pdb|2OPU|A Chain A, Solution Nmr Structure Of The First Domain Of Ksrp Length = 89 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query353
2dgr_A83 Ring finger and KH domain-containing protein 1; st 2e-34
2dgr_A83 Ring finger and KH domain-containing protein 1; st 3e-12
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 3e-29
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 2e-12
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-27
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-11
1j4w_A174 FUSE binding protein; single-stranded DNA binding 1e-25
1j4w_A174 FUSE binding protein; single-stranded DNA binding 4e-12
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 5e-25
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 9e-13
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 3e-18
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 1e-10
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 3e-17
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 2e-07
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 5e-17
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 2e-08
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 1e-16
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 3e-04
1x4m_A94 FAR upstream element binding protein 1; KH domain, 3e-16
1x4m_A94 FAR upstream element binding protein 1; KH domain, 4e-04
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 7e-16
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 1e-08
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 4e-15
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 3e-06
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 2e-14
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 3e-04
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 6e-14
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 9e-08
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 4e-13
1x4n_A92 FAR upstream element binding protein 1; KH domain, 5e-13
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 4e-12
2ea5_A68 Cell growth regulator with ring finger domain prot 8e-12
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 1e-11
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 1e-11
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 1e-11
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 2e-11
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 3e-11
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 6e-11
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 8e-11
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 8e-11
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-10
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 2e-10
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 8e-09
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 2e-10
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 3e-10
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 6e-10
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 4e-09
1we8_A104 Tudor and KH domain containing protein; structural 2e-08
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-08
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 3e-08
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 4e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 8e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-07
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-07
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-07
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 4e-07
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 6e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 3e-06
1tua_A191 Hypothetical protein APE0754; structural genomics, 4e-06
1tua_A191 Hypothetical protein APE0754; structural genomics, 5e-04
3n89_A376 Defective in GERM LINE development protein 3, ISO; 4e-06
3n89_A376 Defective in GERM LINE development protein 3, ISO; 4e-05
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 1e-05
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 2e-05
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 4e-05
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 6e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-04
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 2e-04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 2e-04
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-04
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-04
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 3e-04
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 3e-04
2ecw_A85 Tripartite motif-containing protein 30; metal bind 4e-04
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 6e-04
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 7e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 9e-04
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
 Score =  120 bits (302), Expect = 2e-34
 Identities = 53/80 (66%), Positives = 63/80 (78%)

Query: 73  PPTGVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRDKEPVFEVTGAPD 132
                 G  TI+VRVPY+VVGLVVGPKGATIKRIQ +T+TYIVTP RDKEPVF VTG P+
Sbjct: 2   SSGSSGGQTTIQVRVPYRVVGLVVGPKGATIKRIQQRTHTYIVTPGRDKEPVFAVTGMPE 61

Query: 133 SVEIARQEIESHIIRRTGSC 152
           +V+ AR+EIE+HI  R+G  
Sbjct: 62  NVDRAREEIEAHITLRSGPS 81


>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 97 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A Length = 345 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Length = 63 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Length = 144 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Length = 64 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 102 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Length = 191 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Length = 376 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.9
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.9
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.89
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.89
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.89
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.74
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 99.74
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.74
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 99.62
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.58
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.54
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.53
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.53
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.53
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.52
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 99.52
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.51
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.51
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.51
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.51
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.5
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.49
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.48
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.48
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.48
1we8_A104 Tudor and KH domain containing protein; structural 99.47
1tua_A191 Hypothetical protein APE0754; structural genomics, 99.47
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.46
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.42
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.36
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.34
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.34
2ea5_A68 Cell growth regulator with ring finger domain prot 99.31
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 99.23
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 99.22
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.21
1j4w_A174 FUSE binding protein; single-stranded DNA binding 99.21
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.19
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.16
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.16
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 99.16
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.14
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.13
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.13
2dgr_A83 Ring finger and KH domain-containing protein 1; st 99.12
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.12
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.09
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.08
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.08
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.07
3n89_A376 Defective in GERM LINE development protein 3, ISO; 99.07
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.07
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.04
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.04
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.04
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.03
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.03
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.03
2ect_A78 Ring finger protein 126; metal binding protein, st 99.01
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.01
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.0
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.0
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.0
2cpq_A91 FragIle X mental retardation syndrome related prot 99.0
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.99
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 98.99
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 98.99
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 98.98
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.97
2ysj_A63 Tripartite motif-containing protein 31; ring-type 98.96
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 98.94
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 98.94
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 98.93
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 98.92
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 98.91
2ecm_A55 Ring finger and CHY zinc finger domain- containing 98.91
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 98.91
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.9
1x4n_A92 FAR upstream element binding protein 1; KH domain, 98.9
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 98.89
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.89
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 98.89
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.89
1x4m_A94 FAR upstream element binding protein 1; KH domain, 98.89
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.89
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 98.88
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.88
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 98.88
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 98.88
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 98.88
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 98.87
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 98.87
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 98.86
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.86
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.85
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.85
1we8_A104 Tudor and KH domain containing protein; structural 98.85
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.84
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.84
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 98.83
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.81
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.81
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.78
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.77
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.76
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 98.76
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 98.74
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.74
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.71
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 98.7
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.7
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.68
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.67
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.65
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.59
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.56
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.56
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 98.56
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 98.54
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.53
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 98.5
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.48
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.48
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.46
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 98.36
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.21
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.19
1tua_A191 Hypothetical protein APE0754; structural genomics, 98.16
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.15
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 98.13
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 98.09
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.07
2cpq_A91 FragIle X mental retardation syndrome related prot 98.03
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 97.98
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 97.89
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 97.76
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.55
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.41
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.32
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 97.25
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 97.03
2cxc_A144 NUSA; transcription termination, RNA binding prote 97.01
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 96.85
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 96.72
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 96.7
2asb_A251 Transcription elongation protein NUSA; protein-RNA 95.69
1k0r_A366 NUSA; two component arrangement, S1 domain, two K- 95.62
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 95.27
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.53
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.17
1hh2_P344 NUSA, N utilization substance protein A; transcrip 93.09
3nw0_A238 Non-structural maintenance of chromosomes element 92.02
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 89.41
2cxc_A144 NUSA; transcription termination, RNA binding prote 88.79
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 85.03
3gku_A225 Probable RNA-binding protein; APC21302, clostridiu 84.63
2pt7_G152 HP1451, hypothetical protein; ATPase, protein-prot 81.06
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
Probab=99.90  E-value=3.2e-24  Score=189.54  Aligned_cols=146  Identities=21%  Similarity=0.291  Sum_probs=113.8

Q ss_pred             eeecCCCchHHHHHHHcCceEEecCCC------CcCeEEEecCHHHHHHHHHHHHHHHhhhhhhhhccCCCCCCCCCCCC
Q psy4141           2 KKISRSGCKIKALRAKTNTYIKTPVRG------EEPVFVVTGRKEDVARAKREILSAADHFSALRASRKSGALSPLSPPT   75 (353)
Q Consensus         2 ~IIGk~G~~Ik~I~~~Tga~I~ip~~~------e~~vv~I~G~~e~v~~Ak~~I~~i~~~~~~~~~~~~~g~~~~~~~~~   75 (353)
                      .||||+|++||+|+++|||+|+++..+      .+++++|+|++++|.+|+.+|.+++.+...-.+........++....
T Consensus        19 ~iIGkgG~~Ik~i~~~tg~~I~i~~~~~~~~~~~er~v~I~G~~~~v~~A~~~I~~~~~~~~~~~~~~~~~~~~~~~~~~   98 (178)
T 2anr_A           19 SIIGKGGQTIVQLQKETGATIKLSKSKDFYPGTTERVCLIQGTIEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTV   98 (178)
T ss_dssp             HHHCGGGHHHHHHHHHHCCEEEECCTTCBCTTSSEEEEEEEECHHHHHHHHHHHHHHHTCCCCC----------------
T ss_pred             eeECCCcHHHHHHHHHhCCeEEEecCCCCCCCCCCceEEEEeCHHHHHHHHHHHHHHHhccCCccccCCcccccCCccCC
Confidence            479999999999999999999998643      35899999999999999999999988653210000000000010011


Q ss_pred             CCCcceEEEEEecCCCccceeccCChHHHHHHHHhCceEEcCCCC-----CCCeEEEEcCHHHHHHHHHHHHHHHHh
Q psy4141          76 GVPGHVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRD-----KEPVFEVTGAPDSVEIARQEIESHIIR  147 (353)
Q Consensus        76 ~~~~~~t~~v~VP~~~vG~IIGkgG~tIk~Iq~~Tga~I~ip~~~-----~e~~v~I~G~~e~V~~A~~~I~~~i~~  147 (353)
                      +.....+.+|.||.+++|+||||+|++||+|+++|||+|.++...     .++.|+|+|++++|++|+++|.++|.+
T Consensus        99 ~~~~~~~~~i~Vp~~~vg~iIGkgG~~Ik~i~~~tga~I~i~~~~~~~~~~~~~v~I~G~~~~v~~A~~~I~~~i~e  175 (178)
T 2anr_A           99 NPDRANQVKIIVPNSTAGLIIGKGGATVKAIMEQSGAWVQLSQKPDGINLQNRVVTVSGEPEQNRKAVELIIQKIQE  175 (178)
T ss_dssp             -CGGGGEEEEEEEHHHHHHHHCGGGHHHHHHHHHSSCEEEECCCC----CCEEEEEEESSHHHHHHHHHHHHHHHHS
T ss_pred             CCCCceEEEEEEchhheeeeECCCcHHHHHHHHHHCCEEEEeCCCCCCCCCceEEEEEcCHHHHHHHHHHHHHHHHh
Confidence            112347899999999999999999999999999999999998753     357999999999999999999999876



>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>2asb_A Transcription elongation protein NUSA; protein-RNA complex, transcription/RNA complex; 1.50A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 PDB: 2atw_A Back     alignment and structure
>1k0r_A NUSA; two component arrangement, S1 domain, two K-homology domains., structural genomics, PSI, protein structure initiative; 1.70A {Mycobacterium tuberculosis} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1hh2_P NUSA, N utilization substance protein A; transcription regulation, termination; 2.1A {Thermotoga maritima} SCOP: b.40.4.5 d.52.3.1 d.52.3.1 d.202.1.1 PDB: 1l2f_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>3gku_A Probable RNA-binding protein; APC21302, clostridium symbiosum ATCC 14 structural genomics, PSI-2, protein structure initiative; 2.95A {Clostridium symbiosum atcc 14940} Back     alignment and structure
>2pt7_G HP1451, hypothetical protein; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 353
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 8e-17
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 7e-09
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 7e-16
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 6e-15
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-05
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 6e-15
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 6e-06
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 8e-15
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 3e-07
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 1e-14
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 2e-04
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 9e-14
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 3e-06
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 1e-13
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 0.002
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 1e-13
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 8e-04
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 3e-13
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 2e-04
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 7e-13
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-12
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 2e-04
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 1e-12
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 2e-05
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 2e-12
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 4e-12
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 2e-04
d2ctja182 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [T 1e-11
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 3e-11
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 0.002
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 2e-10
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 6e-04
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-09
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 3e-08
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 3e-08
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 2e-07
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 8e-07
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 1e-06
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 1e-06
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 7e-06
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 1e-05
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 4e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-04
d2bl5a1134 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {Afric 5e-04
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 6e-04
d1k1ga_122 d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo s 7e-04
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 0.002
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: Vigilin
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 72.0 bits (177), Expect = 8e-17
 Identities = 16/64 (25%), Positives = 30/64 (46%), Gaps = 1/64 (1%)

Query: 81  VTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSR-DKEPVFEVTGAPDSVEIARQ 139
            +  V +P +    V+G  G  ++ ++ +T T I  P   D     ++TG  + +E AR 
Sbjct: 10  ASATVAIPKEHHRFVIGKNGEKLQDLELKTATKIQIPRPDDPSNQIKITGTKEGIEKARH 69

Query: 140 EIES 143
           E+  
Sbjct: 70  EVLL 73


>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 134 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query353
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.6
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.59
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.59
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 99.58
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.58
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.56
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.56
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.55
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.53
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.51
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.49
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.46
d2cpqa178 Fragile X mental retardation syndrome related prot 99.35
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.34
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.15
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 99.11
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.1
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.07
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.02
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 99.02
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.01
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.0
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.0
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 99.0
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 99.0
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 98.98
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 98.97
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.96
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 98.96
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 98.94
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 98.94
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.94
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 98.91
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 98.91
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.9
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.88
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 98.88
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.85
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 98.84
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.84
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 98.83
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.81
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.81
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 98.77
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.59
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 98.59
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.57
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.52
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.51
d2cpqa178 Fragile X mental retardation syndrome related prot 98.45
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 98.43
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.32
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.28
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 98.19
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 98.1
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 98.07
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.02
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 97.55
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 97.26
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 97.02
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 96.34
d1hh2p368 Transcription factor NusA, C-terminal domains {The 94.91
d2asba367 Transcription factor NusA, C-terminal domains {Myc 94.54
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 88.27
d1wh9a_92 Ribosomal protein S3 N-terminal domain {Mouse (Mus 85.37
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 84.26
d1egaa2113 GTPase Era C-terminal domain {Escherichia coli [Ta 82.64
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: HnRNP K, KH3
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=9.5e-16  Score=114.69  Aligned_cols=69  Identities=22%  Similarity=0.441  Sum_probs=63.1

Q ss_pred             ceEEEEEecCCCccceeccCChHHHHHHHHhCceEEcCCCC---CCCeEEEEcCHHHHHHHHHHHHHHHHhh
Q psy4141          80 HVTIEVRVPYKVVGLVVGPKGATIKRIQHQTNTYIVTPSRD---KEPVFEVTGAPDSVEIARQEIESHIIRR  148 (353)
Q Consensus        80 ~~t~~v~VP~~~vG~IIGkgG~tIk~Iq~~Tga~I~ip~~~---~e~~v~I~G~~e~V~~A~~~I~~~i~~r  148 (353)
                      .++.+|.||.+++|+|||++|++|++|+++|||+|.++...   .++.|+|+|++++|++|+++|.++|++.
T Consensus         3 ~~t~~i~VP~~~vg~iIG~~G~~I~~I~~~sga~I~i~~~~~~~~~r~i~I~G~~~~v~~A~~~I~~~i~e~   74 (75)
T d1zzka1           3 IITTQVTIPKDLAGSIIGKGGQRIKQIRHESGASIKIDEPLEGSEDRIITITGTQDQIQNAQYLLQNSVKQY   74 (75)
T ss_dssp             CEEEEEEEETTTGGGGTCGGGHHHHHHHHHHCCEEEECCTTSCSSEEEEEEEECHHHHHHHHHHHHHHHHHH
T ss_pred             cEEEEEEEChHhcCeeECCCCchHHHHHhhcCCeEEEccCCCCCCceEEEEEeCHHHHHHHHHHHHHHHHhc
Confidence            37899999999999999999999999999999999987542   3578999999999999999999999875



>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1hh2p3 d.52.3.1 (P:277-344) Transcription factor NusA, C-terminal domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2asba3 d.52.3.1 (A:263-329) Transcription factor NusA, C-terminal domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh9a_ d.52.3.1 (A:) Ribosomal protein S3 N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1egaa2 d.52.3.1 (A:183-295) GTPase Era C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure