Psyllid ID: psy4181


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYYQ
cEEEEEccccccEEEEEccccccHHHHHHHHHHHHcccccEEEEEEEcEEccccEEEcccEEEccEEEEEEEc
cEEEEEEcccccEEEEEccccccHHHHHHHHHHHHcccccEEEEEcccccccccEEEcccEEccccEEEEEEc
mieitcndrlgkkvrvkcnpddtiGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYeihdgmnlelyyq
mieitcndrlgkkvrvkcnpddtigdLKKLiaaqtgtrwekivlKKWYTIFKDHIRIMDYEIHDGMNLELYYQ
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYYQ
****TCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYY*
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYYQ
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYYQ
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYYQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYYQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
Q9V99873 Ubiquitin-like protein 5 yes N/A 1.0 1.0 0.931 3e-33
Q791B073 Ubiquitin-like protein 5 N/A N/A 1.0 1.0 0.890 9e-33
Q9EPV873 Ubiquitin-like protein 5 yes N/A 1.0 1.0 0.890 9e-33
Q6EGX773 Ubiquitin-like protein 5 N/A N/A 1.0 1.0 0.890 9e-33
Q9BZL173 Ubiquitin-like protein 5 yes N/A 1.0 1.0 0.890 9e-33
Q3T0Z373 Ubiquitin-like protein 5 yes N/A 1.0 1.0 0.890 9e-33
P9130273 Ubiquitin-like protein 5 yes N/A 1.0 1.0 0.876 2e-32
Q7SXF273 Ubiquitin-like protein 5 yes N/A 0.986 0.986 0.875 6e-32
Q9FGZ973 Ubiquitin-like protein 5 yes N/A 1.0 1.0 0.780 2e-27
O9465073 Ubiquitin-like modifier h yes N/A 1.0 1.0 0.726 5e-27
>sp|Q9V998|UBL5_DROME Ubiquitin-like protein 5 OS=Drosophila melanogaster GN=ubl PE=3 SV=1 Back     alignment and function desciption
 Score =  140 bits (352), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 68/73 (93%), Positives = 70/73 (95%)

Query: 1  MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDY 60
          MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGT+ EKIVLKKWYTIFKD IR+ DY
Sbjct: 1  MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDY 60

Query: 61 EIHDGMNLELYYQ 73
          EIHDGMNLELYYQ
Sbjct: 61 EIHDGMNLELYYQ 73





Drosophila melanogaster (taxid: 7227)
>sp|Q791B0|UBL5_PSAOB Ubiquitin-like protein 5 OS=Psammomys obesus GN=UBL5 PE=3 SV=1 Back     alignment and function description
>sp|Q9EPV8|UBL5_MOUSE Ubiquitin-like protein 5 OS=Mus musculus GN=Ubl5 PE=1 SV=1 Back     alignment and function description
>sp|Q6EGX7|UBL5_MESAU Ubiquitin-like protein 5 OS=Mesocricetus auratus GN=UBL5 PE=3 SV=1 Back     alignment and function description
>sp|Q9BZL1|UBL5_HUMAN Ubiquitin-like protein 5 OS=Homo sapiens GN=UBL5 PE=1 SV=1 Back     alignment and function description
>sp|Q3T0Z3|UBL5_BOVIN Ubiquitin-like protein 5 OS=Bos taurus GN=UBL5 PE=3 SV=1 Back     alignment and function description
>sp|P91302|UBL5_CAEEL Ubiquitin-like protein 5 OS=Caenorhabditis elegans GN=ubl-5 PE=3 SV=1 Back     alignment and function description
>sp|Q7SXF2|UBL5_DANRE Ubiquitin-like protein 5 OS=Danio rerio GN=ubl5 PE=3 SV=1 Back     alignment and function description
>sp|Q9FGZ9|UBL5_ARATH Ubiquitin-like protein 5 OS=Arabidopsis thaliana GN=UBL5 PE=1 SV=1 Back     alignment and function description
>sp|O94650|HUB1_SCHPO Ubiquitin-like modifier hub1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hub1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
32147790773 hypothetical protein DAPPUDRAFT_95804 [D 1.0 1.0 0.945 4e-33
24200922273 conserved hypothetical protein [Pediculu 1.0 1.0 0.917 4e-33
34071147173 PREDICTED: ubiquitin-like protein 5-like 1.0 1.0 0.931 6e-33
30721016173 Ubiquitin-like protein 5 [Harpegnathos s 1.0 1.0 0.904 9e-33
34037483273 PREDICTED: ubiquitin-like protein 5-like 1.0 1.0 0.931 9e-33
11075500473 PREDICTED: ubiquitin like [Apis mellifer 1.0 1.0 0.917 2e-32
15654280173 PREDICTED: ubiquitin-like protein 5-like 1.0 1.0 0.917 2e-32
34647026173 hypothetical protein [Amblyomma maculatu 1.0 1.0 0.917 2e-32
9107821873 PREDICTED: similar to predicted protein 1.0 1.0 0.904 2e-32
35762211373 hypothetical protein KGM_17710 [Danaus p 1.0 1.0 0.876 3e-32
>gi|321477907|gb|EFX88865.1| hypothetical protein DAPPUDRAFT_95804 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  145 bits (365), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 69/73 (94%), Positives = 72/73 (98%)

Query: 1  MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDY 60
          MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTI+KDHI++ DY
Sbjct: 1  MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIYKDHIKLEDY 60

Query: 61 EIHDGMNLELYYQ 73
          EIHDGMNLELYYQ
Sbjct: 61 EIHDGMNLELYYQ 73




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242009222|ref|XP_002425390.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212509184|gb|EEB12652.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340711471|ref|XP_003394299.1| PREDICTED: ubiquitin-like protein 5-like [Bombus terrestris] gi|350416258|ref|XP_003490890.1| PREDICTED: ubiquitin-like protein 5-like [Bombus impatiens] gi|383848591|ref|XP_003699932.1| PREDICTED: ubiquitin-like protein 5-like [Megachile rotundata] gi|307168552|gb|EFN61610.1| Ubiquitin-like protein 5 [Camponotus floridanus] gi|332030516|gb|EGI70204.1| Ubiquitin-like protein 5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307210161|gb|EFN86834.1| Ubiquitin-like protein 5 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340374832|ref|XP_003385941.1| PREDICTED: ubiquitin-like protein 5-like [Amphimedon queenslandica] Back     alignment and taxonomy information
>gi|110755004|ref|XP_001120009.1| PREDICTED: ubiquitin like [Apis mellifera] gi|380030074|ref|XP_003698683.1| PREDICTED: ubiquitin-like protein 5-like [Apis florea] Back     alignment and taxonomy information
>gi|156542801|ref|XP_001607481.1| PREDICTED: ubiquitin-like protein 5-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|346470261|gb|AEO34975.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|91078218|ref|XP_969246.1| PREDICTED: similar to predicted protein [Tribolium castaneum] gi|270002984|gb|EEZ99431.1| hypothetical protein TcasGA2_TC030562 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357622113|gb|EHJ73714.1| hypothetical protein KGM_17710 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
FB|FBgn002222473 ubl "ubiquitin like" [Drosophi 1.0 1.0 0.931 3.2e-33
UNIPROTKB|Q3T0Z373 UBL5 "Ubiquitin-like protein 5 1.0 1.0 0.890 5.2e-33
UNIPROTKB|Q9BZL173 UBL5 "Ubiquitin-like protein 5 1.0 1.0 0.890 5.2e-33
UNIPROTKB|B4F45073 UBL5 "Ubiquitin-like protein 5 1.0 1.0 0.890 5.2e-33
MGI|MGI:191342773 Ubl5 "ubiquitin-like 5" [Mus m 1.0 1.0 0.890 5.2e-33
RGD|156464473 Ubl5 "ubiquitin-like 5" [Rattu 1.0 1.0 0.890 5.2e-33
UNIPROTKB|G3MY9973 UBL5 "Ubiquitin-like protein 5 1.0 1.0 0.876 1.8e-32
WB|WBGene0000672673 ubl-5 [Caenorhabditis elegans 1.0 1.0 0.876 1.8e-32
ZFIN|ZDB-GENE-040426-162973 zgc:66388 "zgc:66388" [Danio r 0.986 0.986 0.875 4.7e-32
TAIR|locus:215759773 UBL5 "AT5G42300" [Arabidopsis 0.986 0.986 0.791 8.2e-28
FB|FBgn0022224 ubl "ubiquitin like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 362 (132.5 bits), Expect = 3.2e-33, P = 3.2e-33
 Identities = 68/73 (93%), Positives = 70/73 (95%)

Query:     1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDY 60
             MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGT+ EKIVLKKWYTIFKD IR+ DY
Sbjct:     1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDY 60

Query:    61 EIHDGMNLELYYQ 73
             EIHDGMNLELYYQ
Sbjct:    61 EIHDGMNLELYYQ 73




GO:0003674 "molecular_function" evidence=ND
GO:0005737 "cytoplasm" evidence=ISS
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q3T0Z3 UBL5 "Ubiquitin-like protein 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BZL1 UBL5 "Ubiquitin-like protein 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4F450 UBL5 "Ubiquitin-like protein 5" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1913427 Ubl5 "ubiquitin-like 5" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1564644 Ubl5 "ubiquitin-like 5" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3MY99 UBL5 "Ubiquitin-like protein 5" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
WB|WBGene00006726 ubl-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1629 zgc:66388 "zgc:66388" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
TAIR|locus:2157597 UBL5 "AT5G42300" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9EPV8UBL5_MOUSENo assigned EC number0.89041.01.0yesN/A
Q6BUP7HUB1_DEBHANo assigned EC number0.65751.01.0yesN/A
Q6Q546HUB1_YEASTNo assigned EC number0.59720.98630.9863yesN/A
Q9BZL1UBL5_HUMANNo assigned EC number0.89041.01.0yesN/A
Q6FIX7HUB1_CANGANo assigned EC number0.58901.01.0yesN/A
Q6EGX7UBL5_MESAUNo assigned EC number0.89041.01.0N/AN/A
O94650HUB1_SCHPONo assigned EC number0.72601.01.0yesN/A
Q791B0UBL5_PSAOBNo assigned EC number0.89041.01.0N/AN/A
Q3T0Z3UBL5_BOVINNo assigned EC number0.89041.01.0yesN/A
Q9V998UBL5_DROMENo assigned EC number0.93151.01.0yesN/A
P91302UBL5_CAEELNo assigned EC number0.87671.01.0yesN/A
Q6CU12HUB1_KLULANo assigned EC number0.60270.98630.9729yesN/A
Q756X3HUB1_ASHGONo assigned EC number0.58330.98630.9863yesN/A
Q9FGZ9UBL5_ARATHNo assigned EC number0.78081.01.0yesN/A
Q7SXF2UBL5_DANRENo assigned EC number0.8750.98630.9863yesN/A
Q54Q03UBL5_DICDINo assigned EC number0.65750.91781.0yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
cd0179173 cd01791, Ubl5, UBL5 ubiquitin-like modifier 3e-48
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 7e-16
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 3e-08
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 0.002
>gnl|CDD|176386 cd01791, Ubl5, UBL5 ubiquitin-like modifier Back     alignment and domain information
 Score =  146 bits (370), Expect = 3e-48
 Identities = 67/73 (91%), Positives = 69/73 (94%)

Query: 1  MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDY 60
          MIE+ CNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTR EKIVLKKWYTIFKDHI + DY
Sbjct: 1  MIEVVCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRPEKIVLKKWYTIFKDHISLGDY 60

Query: 61 EIHDGMNLELYYQ 73
          EIHDGMNLELYYQ
Sbjct: 61 EIHDGMNLELYYQ 73


UBL5 (also known as HUB1) is a ubiquitin-like modifier that is both widely expressed and highly phylogenetically conserved. At the C-terminal end of the ubiquitin-like fold of UBL5 is a di-tyrosine motif followed by a single variable residue instead of the characteristic di-glycine found in all other ubiquitin-like modifiers. ULB5 interacts with a cyclin-like kinase called CLK4 but not with other cyclin-like kinase family members. Length = 73

>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.98
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.96
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.96
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.96
PTZ0004476 ubiquitin; Provisional 99.96
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.96
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.95
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.95
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.95
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.94
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.94
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.94
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.94
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.94
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.94
KOG0004|consensus156 99.94
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.94
KOG0003|consensus128 99.94
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.94
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.93
KOG0005|consensus70 99.93
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.92
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.91
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.9
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.89
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.88
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.87
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.87
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.87
TIGR00601 378 rad23 UV excision repair protein Rad23. All protei 99.85
KOG0010|consensus 493 99.84
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.8
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 99.8
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 99.75
KOG0001|consensus75 99.73
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 99.67
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.67
KOG0011|consensus 340 99.66
KOG3493|consensus73 99.62
PLN02560 308 enoyl-CoA reductase 99.61
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 99.55
KOG4248|consensus 1143 99.53
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 99.48
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 99.39
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 99.36
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 99.36
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 99.11
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 98.95
KOG0006|consensus 446 98.78
KOG1872|consensus 473 98.67
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 98.55
KOG1769|consensus99 98.51
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 98.38
KOG4495|consensus110 98.36
PF13019162 Telomere_Sde2: Telomere stability and silencing 98.32
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 98.3
KOG0013|consensus231 98.28
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 98.28
smart0016680 UBX Domain present in ubiquitin-regulatory protein 97.82
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 97.69
KOG1639|consensus 297 97.57
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 97.57
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 97.49
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 97.42
KOG3206|consensus 234 97.37
PRK0836470 sulfur carrier protein ThiS; Provisional 97.3
COG541781 Uncharacterized small protein [Function unknown] 97.13
cd0640986 PB1_MUG70 The MUG70 protein is a product of the me 97.08
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 97.03
PF0937980 FERM_N: FERM N-terminal domain ; InterPro: IPR0189 97.03
PRK0643767 hypothetical protein; Provisional 96.95
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 96.78
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 96.75
PLN0279982 Molybdopterin synthase sulfur carrier subunit 96.72
KOG4583|consensus 391 96.63
COG5227103 SMT3 Ubiquitin-like protein (sentrin) [Posttransla 96.53
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 96.51
PF1445357 ThiS-like: ThiS-like ubiquitin 96.47
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 96.39
cd0075480 MoaD Ubiquitin domain of MoaD-like proteins. MoaD 96.1
smart0045570 RBD Raf-like Ras-binding domain. 96.09
PRK0648865 sulfur carrier protein ThiS; Validated 95.95
PF08337 539 Plexin_cytopl: Plexin cytoplasmic RasGAP domain; I 95.84
cd0176072 RBD Ubiquitin-like domain of RBD-like S/T kinases. 95.57
PRK0608384 sulfur carrier protein ThiS; Provisional 95.54
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 95.51
PRK0744070 hypothetical protein; Provisional 95.35
PRK0565966 sulfur carrier protein ThiS; Validated 95.32
KOG0012|consensus 380 95.12
PRK0586365 sulfur carrier protein ThiS; Provisional 95.12
PF1079076 DUF2604: Protein of Unknown function (DUF2604); In 94.97
TIGR0168280 moaD molybdopterin converting factor, subunit 1, n 94.97
TIGR02958 452 sec_mycoba_snm4 secretion protein snm4. Members of 94.87
smart00295 207 B41 Band 4.1 homologues. Also known as ezrin/radix 94.87
PF1162088 GABP-alpha: GA-binding protein alpha chain; InterP 94.82
PF1445181 Ub-Mut7C: Mut7-C ubiquitin 94.74
KOG0007|consensus341 94.65
PF12754 309 Blt1: Cell-cycle control medial ring component; In 94.42
cd0056565 ThiS ThiaminS ubiquitin-like sulfur carrier protei 94.32
PF0623485 TmoB: Toluene-4-monooxygenase system protein B (Tm 94.05
PRK0769667 sulfur carrier protein ThiS; Provisional 94.02
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 93.99
KOG4250|consensus 732 93.93
PF0259777 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiam 93.54
cd0599281 PB1 The PB1 domain is a modular domain mediating s 93.31
TIGR0168364 thiS thiamine biosynthesis protein ThiS. This mode 93.31
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 93.2
PF12436249 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-sp 93.1
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 92.54
PF0219671 RBD: Raf-like Ras-binding domain; InterPro: IPR003 92.45
PRK0805366 sulfur carrier protein ThiS; Provisional 92.34
cd0640886 PB1_NoxR The PB1 domain is present in the Epichloe 92.13
cd0176887 RA RA (Ras-associating) ubiquitin domain. The RA ( 92.06
TIGR0168788 moaD_arch MoaD family protein, archaeal. Members o 91.9
cd0181773 RGS12_RBD Ubiquitin domain of RGS12 and RGS14. RGS 91.86
PF0078893 RA: Ras association (RalGDS/AF-6) domain; InterPro 91.84
COG5100 571 NPL4 Nuclear pore protein [Nuclear structure] 91.69
smart00144108 PI3K_rbd PI3-kinase family, Ras-binding domain. Ce 91.27
smart0031490 RA Ras association (RalGDS/AF-6) domain. RasGTP ef 91.16
PF1473287 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquiti 90.86
PF14533 213 USP7_C2: Ubiquitin-specific protease C-terminal; P 90.61
cd0178785 GRB7_RA RA (RAS-associated like) domain of Grb7. G 90.45
cd0641097 PB1_UP2 Uncharacterized protein 2. The PB1 domain 90.43
PRK11840 326 bifunctional sulfur carrier protein/thiazole synth 90.21
cd0641178 PB1_p51 The PB1 domain is present in the p51 prote 90.0
PRK0694465 sulfur carrier protein ThiS; Provisional 89.95
COG210468 ThiS Sulfur transfer protein involved in thiamine 89.77
cd0177787 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin 89.73
PRK0177795 hypothetical protein; Validated 89.09
cd0181877 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleo 87.78
PF02505153 MCR_D: Methyl-coenzyme M reductase operon protein 86.56
PF1183469 DUF3354: Domain of unknown function (DUF3354); Int 86.45
cd0176494 Urm1 Urm1-like ubuitin domain. Urm1 (Ubiquitin-Rel 86.16
PF14533213 USP7_C2: Ubiquitin-specific protease C-terminal; P 86.07
KOG3439|consensus116 85.11
cd0639891 PB1_Joka2 The PB1 domain is present in the Nicotia 84.94
KOG2982|consensus418 84.27
KOG2086|consensus380 84.18
PTZ00380121 microtubule-associated protein (MAP); Provisional 84.01
PF10209122 DUF2340: Uncharacterized conserved protein (DUF234 83.49
COG527257 UBI4 Ubiquitin [Posttranslational modification, pr 83.07
PF00794106 PI3K_rbd: PI3-kinase family, ras-binding domain; I 81.51
PF12436249 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-sp 81.45
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
Probab=99.98  E-value=2.4e-32  Score=160.47  Aligned_cols=73  Identities=92%  Similarity=1.419  Sum_probs=72.2

Q ss_pred             CEEEEEEcCCCCEEEEEeCCCCcHHHHHHHHHHHhCCCCccEEEEEcceEecCCccccccCCCCCCEEEEEeC
Q psy4181           1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYYQ   73 (73)
Q Consensus         1 ~~~i~vk~~~G~~~~v~v~~~~TV~~lK~~I~~~~gip~~~QrLif~Gk~L~D~~tL~~y~I~~g~ti~L~~~   73 (73)
                      ||.|+||++.|+.+.++|+|++||++||++|+++.|+||++|||+|+|++|+|+.||++|||++|+||||+||
T Consensus         1 ~~~i~vkt~~Gk~~~~~v~~~~TV~~LK~~I~~~~~~~~~~qrLi~~Gk~L~D~~tL~~ygi~~~stv~l~~~   73 (73)
T cd01791           1 MIEVVCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRPEKIVLKKWYTIFKDHISLGDYEIHDGMNLELYYQ   73 (73)
T ss_pred             CEEEEEECCCCCEEEEEeCCCCcHHHHHHHHHHHhCCChHHEEEEeCCcCCCCCCCHHHcCCCCCCEEEEEeC
Confidence            8999999999999999999999999999999999999999999999999999999999999999999999997



UBL5 (also known as HUB1) is a ubiquitin-like modifier that is both widely expressed and highly phylogenetically conserved. At the C-terminal end of the ubiquitin-like fold of UBL5 is a di-tyrosine motif followed by a single variable residue instead of the characteristic di-glycine found in all other ubiquitin-like modifiers. ULB5 interacts with a cyclin-like kinase called CLK4 but not with other cyclin-like kinase family members.

>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>KOG3493|consensus Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>KOG4495|consensus Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>KOG0013|consensus Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>KOG1639|consensus Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>PF09379 FERM_N: FERM N-terminal domain ; InterPro: IPR018979 This domain is the N-terminal ubiquitin-like structural domain of the FERM domain Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PLN02799 Molybdopterin synthase sulfur carrier subunit Back     alignment and domain information
>KOG4583|consensus Back     alignment and domain information
>COG5227 SMT3 Ubiquitin-like protein (sentrin) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>PF14453 ThiS-like: ThiS-like ubiquitin Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>cd00754 MoaD Ubiquitin domain of MoaD-like proteins Back     alignment and domain information
>smart00455 RBD Raf-like Ras-binding domain Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>PF08337 Plexin_cytopl: Plexin cytoplasmic RasGAP domain; InterPro: IPR013548 This domain is found at C terminus of various plexins (e Back     alignment and domain information
>cd01760 RBD Ubiquitin-like domain of RBD-like S/T kinases Back     alignment and domain information
>PRK06083 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PRK07440 hypothetical protein; Provisional Back     alignment and domain information
>PRK05659 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>KOG0012|consensus Back     alignment and domain information
>PRK05863 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>PF10790 DUF2604: Protein of Unknown function (DUF2604); InterPro: IPR019726 This entry represents bacterial proteins with undetermined function Back     alignment and domain information
>TIGR01682 moaD molybdopterin converting factor, subunit 1, non-archaeal Back     alignment and domain information
>TIGR02958 sec_mycoba_snm4 secretion protein snm4 Back     alignment and domain information
>smart00295 B41 Band 4 Back     alignment and domain information
>PF11620 GABP-alpha: GA-binding protein alpha chain; InterPro: IPR024668 GA-binding protein alpha is a transcription factor capable of interacting with purine rich repeats (GA repeats) Back     alignment and domain information
>PF14451 Ub-Mut7C: Mut7-C ubiquitin Back     alignment and domain information
>KOG0007|consensus Back     alignment and domain information
>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures Back     alignment and domain information
>cd00565 ThiS ThiaminS ubiquitin-like sulfur carrier protein Back     alignment and domain information
>PF06234 TmoB: Toluene-4-monooxygenase system protein B (TmoB); InterPro: IPR009355 This family consists of several Toluene-4-monooxygenase system protein B (TmoB) sequences Back     alignment and domain information
>PRK07696 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>PF02597 ThiS: ThiS family; InterPro: IPR003749 ThiS (thiaminS) is a 66 aa protein involved in sulphur transfer Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>TIGR01683 thiS thiamine biosynthesis protein ThiS Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>PF12436 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-specific protease 7; InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>PF02196 RBD: Raf-like Ras-binding domain; InterPro: IPR003116 This is the Ras-binding domain found in proteins related to Ras Back     alignment and domain information
>PRK08053 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA Back     alignment and domain information
>cd01768 RA RA (Ras-associating) ubiquitin domain Back     alignment and domain information
>TIGR01687 moaD_arch MoaD family protein, archaeal Back     alignment and domain information
>cd01817 RGS12_RBD Ubiquitin domain of RGS12 and RGS14 Back     alignment and domain information
>PF00788 RA: Ras association (RalGDS/AF-6) domain; InterPro: IPR000159 Proteins with this domain are mostly RasGTP effectors and include guanine-nucleotide releasing factor in mammals [] Back     alignment and domain information
>COG5100 NPL4 Nuclear pore protein [Nuclear structure] Back     alignment and domain information
>smart00144 PI3K_rbd PI3-kinase family, Ras-binding domain Back     alignment and domain information
>smart00314 RA Ras association (RalGDS/AF-6) domain Back     alignment and domain information
>PF14732 UAE_UbL: Ubiquitin/SUMO-activating enzyme ubiquitin-like domain; PDB: 1Y8Q_B 1Y8R_E 3KYD_B 3KYC_B Back     alignment and domain information
>PF14533 USP7_C2: Ubiquitin-specific protease C-terminal; PDB: 2YLM_A Back     alignment and domain information
>cd01787 GRB7_RA RA (RAS-associated like) domain of Grb7 Back     alignment and domain information
>cd06410 PB1_UP2 Uncharacterized protein 2 Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>cd06411 PB1_p51 The PB1 domain is present in the p51 protein, a homolog of the p67 protein Back     alignment and domain information
>PRK06944 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>COG2104 ThiS Sulfur transfer protein involved in thiamine biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>cd01777 SNX27_RA Ubiquitin domain of SNX27 (sorting nexin protein 27) Back     alignment and domain information
>PRK01777 hypothetical protein; Validated Back     alignment and domain information
>cd01818 TIAM1_RBD Ubiquitin domain of Tiam1 guanine nucleotide exchange factor Back     alignment and domain information
>PF02505 MCR_D: Methyl-coenzyme M reductase operon protein D; InterPro: IPR003901 Methyl-coenzyme M reductase (MCR) catalyses the reduction of methyl-coenzyme M (CH3-SCoM) and coenzyme B (HS-CoB) to methane and the corresponding heterosulphide CoM-S-S-CoB (2 Back     alignment and domain information
>PF11834 DUF3354: Domain of unknown function (DUF3354); InterPro: IPR021789 Potassium channels take part in important processes of higher plants, including opening and closing of stomatal pores and leaf movement Back     alignment and domain information
>cd01764 Urm1 Urm1-like ubuitin domain Back     alignment and domain information
>PF14533 USP7_C2: Ubiquitin-specific protease C-terminal; PDB: 2YLM_A Back     alignment and domain information
>KOG3439|consensus Back     alignment and domain information
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2086|consensus Back     alignment and domain information
>PTZ00380 microtubule-associated protein (MAP); Provisional Back     alignment and domain information
>PF10209 DUF2340: Uncharacterized conserved protein (DUF2340); InterPro: IPR018794 This entry consists of small proteins of approximately 150 amino acids whose function is unknown Back     alignment and domain information
>COG5272 UBI4 Ubiquitin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00794 PI3K_rbd: PI3-kinase family, ras-binding domain; InterPro: IPR000341 Phosphatidylinositol 3-kinase (PI3K) (2 Back     alignment and domain information
>PF12436 USP7_ICP0_bdg: ICP0-binding domain of Ubiquitin-specific protease 7; InterPro: IPR024729 This domain is found in eukaryotes, and is approximately 40 amino acids in length Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
1uh6_A100 Solution Structure Of The Murine Ubiquitin-Like 5 P 2e-34
1p0r_A93 Solution Structure Of Ubl5 A Human Ubiquitin-Like P 7e-34
1m94_A93 Solution Structure Of The Yeast Ubiquitin-Like Modi 4e-21
3plu_A93 Structure Of Hub-1 Protein In Complex With Snu66 Pe 5e-21
>pdb|1UH6|A Chain A, Solution Structure Of The Murine Ubiquitin-Like 5 Protein From Riken Cdna 0610031k06 Length = 100 Back     alignment and structure

Iteration: 1

Score = 140 bits (352), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 65/73 (89%), Positives = 68/73 (93%) Query: 1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDY 60 MIE+ CNDRLGKKVRVKCN DDTIGDLKKLIAAQTGTRW KIVLKKWYTIFKDH+ + DY Sbjct: 28 MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY 87 Query: 61 EIHDGMNLELYYQ 73 EIHDGMNLELYYQ Sbjct: 88 EIHDGMNLELYYQ 100
>pdb|1P0R|A Chain A, Solution Structure Of Ubl5 A Human Ubiquitin-Like Protein Length = 93 Back     alignment and structure
>pdb|1M94|A Chain A, Solution Structure Of The Yeast Ubiquitin-Like Modifier Protein Hub1 Length = 93 Back     alignment and structure
>pdb|3PLU|A Chain A, Structure Of Hub-1 Protein In Complex With Snu66 Peptide (Hindi) Length = 93 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 1e-42
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 1e-42
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 1e-06
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 2e-06
3m62_B106 UV excision repair protein RAD23; armadillo-like r 7e-06
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 1e-05
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 1e-05
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 1e-05
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 2e-05
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 2e-05
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 2e-05
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 2e-05
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 3e-05
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 3e-05
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 7e-05
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 9e-05
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 1e-04
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 1e-04
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 1e-04
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 2e-04
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 2e-04
3u5c_F 225 RP14, S2, YS8, 40S ribosomal protein S5; translati 2e-04
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 3e-04
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 3e-04
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 4e-04
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 5e-04
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 5e-04
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 6e-04
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 7e-04
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 8e-04
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 9e-04
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Length = 93 Back     alignment and structure
 Score =  132 bits (333), Expect = 1e-42
 Identities = 43/72 (59%), Positives = 56/72 (77%)

Query: 1  MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDY 60
          MIE+  NDRLGKKVRVKC  +D++GD KK+++ Q GT+  KIVL+K  ++ KDHI + DY
Sbjct: 21 MIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDY 80

Query: 61 EIHDGMNLELYY 72
          E+HD  NLELYY
Sbjct: 81 EVHDQTNLELYY 92


>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Length = 115 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 100.0
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 100.0
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.97
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.97
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.96
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.96
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.96
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.96
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.96
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.96
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.96
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.96
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.96
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.96
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.96
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.96
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.96
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.96
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.95
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.95
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.95
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.95
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.95
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.95
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.95
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.95
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.95
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.95
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.95
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.95
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.95
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.95
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.95
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.95
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.95
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.95
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.95
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.95
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.95
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.95
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.94
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.94
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.94
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.9
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.94
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.94
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.94
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.94
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.94
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.94
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.94
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.94
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.94
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.93
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.93
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.93
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.93
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.93
1we6_A111 Splicing factor, putative; structural genomics, ub 99.93
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.93
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.93
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.93
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.92
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.92
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.92
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.92
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.92
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.92
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.92
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.92
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.92
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.92
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.91
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.91
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.91
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.91
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.9
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.9
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.9
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.89
2xzm_9 189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 99.89
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.89
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.88
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 99.88
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 99.87
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.86
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 99.85
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.84
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 99.83
3shq_A 320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 99.83
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 99.82
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 99.81
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 99.79
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 99.78
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 99.77
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.72
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 99.61
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 99.55
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 99.44
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 99.31
2pjh_A80 Protein NPL4, nuclear protein localization protein 99.29
3v7o_A 227 Minor nucleoprotein VP30; ssgcid, seattle structur 99.28
3uf8_A 209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.17
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 99.14
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 99.11
3ix6_A 360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 99.04
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 98.93
4da1_A 389 Protein phosphatase 1K, mitochondrial; metal-ION-a 98.89
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 98.72
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 98.59
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 98.43
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 98.31
4e71_A111 Plexin-B2, MM1; transmembrane, signaling, RBD, str 97.96
3h6n_A127 Plexin-D1; structural genomics consortium, SGC, me 97.94
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 97.88
2r2o_A138 Plexin-B1; effector domain, structural genomics, s 97.84
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 97.77
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 97.76
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 97.72
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 97.63
4e74_A117 Plexin-A4; RBD, structural genomics, structural ge 97.43
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 97.42
3kuz_A126 Plexin-C1; structural genomics, structural genomic 97.28
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 97.27
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 97.06
3hm6_X 644 Plexin-B1; structural genomics consortium, SGC, me 97.04
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 96.87
3ig3_A 627 Plxna3 protein; plexin intracellular GAP RBD inact 96.81
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 96.61
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 96.53
2qjl_A99 URM1, ubiquitin-related modifier 1; ubiquitin-like 95.98
1h4r_A 314 Merlin; FERM, neurofibromatosis, NF2, structural p 95.67
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 95.58
2kl0_A73 Putative thiamin biosynthesis THis; structural gen 95.58
1ef1_A 294 Moesin; membrane, FERM domain, tail domain, membra 95.56
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 95.54
1f0z_A66 THis protein; ubiquitin fold, transport protein; N 95.43
3rpf_C74 Molybdopterin converting factor, subunit 1 (MOAD); 95.38
2inc_C83 TOUB protein; DIIRON, 4-helix bundle, carboxylate 95.13
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 95.05
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 95.02
3ge3_C84 Toluene-4-monooxygenase system protein B; DIIRON h 94.95
1vjk_A98 Molybdopterin converting factor, subunit 1; struct 94.92
2ylm_A 530 Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 94.92
2k5p_A78 THis protein, thiamine-biosynthesis protein; NESG, 94.91
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 94.8
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 94.74
3dwg_C93 9.5 kDa culture filtrate antigen CFP10A; sulfur ca 94.68
1wgr_A100 Growth factor receptor-bound protein 7; RA domain, 94.63
1wgk_A114 Riken cDNA 2900073H19 protein; THis domain, ubiqut 94.4
3po0_A89 Small archaeal modifier protein 1; ubiquitin-like 94.19
2kmc_A102 Fermitin family homolog 1; kindlin, cytoskeleton, 93.95
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 93.26
1fm0_D81 Molybdopterin convertin factor, subunit 1; molybde 93.01
3qij_A 296 Protein 4.1; cytoskeleton, structural genomics, st 92.82
2q5w_D77 Molybdopterin converting factor, subunit 1; MOCO, 92.62
2ylm_A 530 Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70 92.38
2l52_A99 Methanosarcina acetivorans SAMP1 homolog; beta-grA 92.35
3ivf_A 371 Talin-1; FERM domain, cell membrane, cell projecti 92.22
4gmv_A 281 RAS-associated and pleckstrin homology domains-CO 92.19
2kmm_A73 Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohy 92.12
2cu3_A64 Unknown function protein; thermus thermophilus HB8 91.98
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 90.04
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 88.98
2k9x_A110 Tburm1, uncharacterized protein; unknown function; 88.8
1rws_A77 Hypothetical protein PF1061; residual dipolar coup 88.58
3au4_A 555 Myosin-X; protein-protein complex, motor protein c 88.57
3hk0_A 256 Growth factor receptor-bound protein 10; GRB10, RA 88.32
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 88.0
2g1e_A90 Hypothetical protein TA0895; MOAD, molybdopterin, 87.8
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 87.44
3tca_A 291 Amyloid beta A4 precursor protein-binding family 1 87.24
1y8x_B98 Ubiquitin-activating enzyme E1C; ubiquitin-conjuga 87.01
3onh_A127 Ubiquitin-activating enzyme E1-like; ligase, SUMO 86.86
2lgx_A112 Fermitin family homolog 2; kindlin, membrane, inte 86.25
3pvl_A 655 Myosin VIIA isoform 1; protein complex, novel fold 84.85
1q1o_A98 Cell division control protein 24; PB1 domain, PCCR 84.51
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 82.79
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 82.03
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 81.45
2c7h_A86 RBBP6, retinoblastoma-binding protein 6, isoform 3 81.17
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
Probab=100.00  E-value=3.5e-37  Score=187.93  Aligned_cols=72  Identities=60%  Similarity=0.959  Sum_probs=71.6

Q ss_pred             CEEEEEEcCCCCEEEEEeCCCCcHHHHHHHHHHHhCCCCccEEEEEcceEecCCccccccCCCCCCEEEEEe
Q psy4181           1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYY   72 (73)
Q Consensus         1 ~~~i~vk~~~G~~~~v~v~~~~TV~~lK~~I~~~~gip~~~QrLif~Gk~L~D~~tL~~y~I~~g~ti~L~~   72 (73)
                      |||||||+++|++++++|+|+|||++||++|++++|+||++|||+|+|++|+|+.||++|+|++|+||||+|
T Consensus        21 mIqI~Vk~~~Gkk~~v~v~p~DTI~~LK~~I~~k~Gip~~qQrLif~Gk~LkD~~TL~dY~I~dgstLhL~~   92 (93)
T 3plu_A           21 MIEVVVNDRLGKKVRVKCLGEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYY   92 (93)
T ss_dssp             EEEEEEECTTSCEEEEEEETTSBHHHHHHHHHHHHTCCGGGEEEEETTEECCTTSBTGGGTCCTTCEEEEEE
T ss_pred             eEEEEEECCCCCEEEEEECCcCHHHHHHHHHHHHhCCCHHHEEEEeCCEEccCcCCHHHcCCCCCCEEEEEe
Confidence            899999999999999999999999999999999999999999999999999999999999999999999999



>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>4e71_A Plexin-B2, MM1; transmembrane, signaling, RBD, structural genomics consortium, SGC, signaling protein; 2.26A {Homo sapiens} Back     alignment and structure
>3h6n_A Plexin-D1; structural genomics consortium, SGC, membrane, transmembrane, receptor, alternative splicing, cell membrane, glycoprotein, polymorphism; 2.00A {Homo sapiens} Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>2r2o_A Plexin-B1; effector domain, structural genomics, structural GEN consortium, SGC, glycoprotein, membrane, phosphorylation, R secreted, transmembrane; 2.00A {Homo sapiens} PDB: 2rex_A* 2jph_A Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>4e74_A Plexin-A4; RBD, structural genomics, structural genomics consor SGC, signaling protein; 1.58A {Homo sapiens} PDB: 3q3j_A* Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3kuz_A Plexin-C1; structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>3hm6_X Plexin-B1; structural genomics consortium, SGC, membrane, transmembrane receptor, cell membrane, glycoprotein, phosphoprotein; 2.40A {Homo sapiens} PDB: 3sua_D* 3su8_X* Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>3ig3_A Plxna3 protein; plexin intracellular GAP RBD inactive, membrane, transmembra membrane protein, signaling protein; 1.99A {Mus musculus} PDB: 3ryt_A* Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>2qjl_A URM1, ubiquitin-related modifier 1; ubiquitin-like protein, signaling protein; 1.44A {Saccharomyces cerevisiae} PDB: 2pko_A 2ax5_A Back     alignment and structure
>1h4r_A Merlin; FERM, neurofibromatosis, NF2, structural protein, cytoskeleton, anti-oncogene; 1.8A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1isn_A 3u8z_A Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>1ef1_A Moesin; membrane, FERM domain, tail domain, membrane protein; 1.90A {Homo sapiens} SCOP: a.11.2.1 b.55.1.5 d.15.1.4 PDB: 1sgh_A 1j19_A 2emt_A 2ems_A 2d10_A 2d11_A 2yvc_A 2d2q_A 2zpy_A 1gc7_A 1gc6_A 1ni2_A Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1f0z_A THis protein; ubiquitin fold, transport protein; NMR {Escherichia coli} SCOP: d.15.3.2 PDB: 1zud_2 Back     alignment and structure
>3rpf_C Molybdopterin converting factor, subunit 1 (MOAD); MCSG, PSI-biology, structural genomics, midwest center for S genomics, transferase; 1.90A {Helicobacter pylori} Back     alignment and structure
>2inc_C TOUB protein; DIIRON, 4-helix bundle, carboxylate bridge, metalloenzyme, oxidoreductase; HET: P6G; 1.85A {Pseudomonas stutzeri} SCOP: d.15.12.1 PDB: 2ind_C* 3n20_C* 1t0r_C 1t0s_C 1t0q_C* 3n1x_C 3n1y_C* 3n1z_C* 2rdb_C* 3rn9_C* 3rna_C 3rnb_C 3rnc_C 3rne_C 3rnf_C* 3rng_C Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ge3_C Toluene-4-monooxygenase system protein B; DIIRON hydroxylase, effector protein, T201A, aromatic hydrocarbons catabolism, FAD, flavoprotein; 1.52A {Pseudomonas mendocina} SCOP: d.15.12.0 PDB: 3dhh_C* 3dhg_C* 3dhi_C 3ge8_C 3i5j_C 3i63_C 3q14_C 3q2a_C* 3q3m_C* 3q3n_C* 3q3o_C* 3rmk_C* 3ri7_C* Back     alignment and structure
>1vjk_A Molybdopterin converting factor, subunit 1; structural genomics, PSI, protein structure INI southeast collaboratory for structural genomics; 1.51A {Pyrococcus furiosus} SCOP: d.15.3.1 Back     alignment and structure
>2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} Back     alignment and structure
>2k5p_A THis protein, thiamine-biosynthesis protein; NESG, GMR137, structural genomics, PSI-2, protein structure initiative; NMR {Geobacter metallireducens gs-15} PDB: 3cwi_A Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>3dwg_C 9.5 kDa culture filtrate antigen CFP10A; sulfur carrier protein complex, beta-grAsp fold, amino-acid biosynthesis; HET: PLP; 1.53A {Mycobacterium tuberculosis} PDB: 3dwm_A Back     alignment and structure
>1wgr_A Growth factor receptor-bound protein 7; RA domain, GRB7, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.15.1.5 Back     alignment and structure
>1wgk_A Riken cDNA 2900073H19 protein; THis domain, ubiqutin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.3.3 PDB: 1xo3_A Back     alignment and structure
>3po0_A Small archaeal modifier protein 1; ubiquitin-like protein, protein binding; 1.55A {Haloferax volcanii} PDB: 2l83_A Back     alignment and structure
>2kmc_A Fermitin family homolog 1; kindlin, cytoskeleton, integrin, N-terminal, talin, cell adhesion, cell junction, cell membrane, cell projection; NMR {Mus musculus} Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>1fm0_D Molybdopterin convertin factor, subunit 1; molybdenum cofactor biosynthesis, transferase; 1.45A {Escherichia coli} SCOP: d.15.3.1 PDB: 1fma_D 1jw9_D 1jwa_D* 1jwb_D* 3bii_D 1nvi_D Back     alignment and structure
>3qij_A Protein 4.1; cytoskeleton, structural genomics, structural genomics conso SGC; 1.80A {Homo sapiens} PDB: 1gg3_A 3bin_A 2he7_A 2rq1_A Back     alignment and structure
>2q5w_D Molybdopterin converting factor, subunit 1; MOCO, MPT synthase, MOAD, MOAE, transferase, molybdenum cofactor biosynthesis; 2.00A {Staphylococcus aureus} PDB: 2qie_B* Back     alignment and structure
>2ylm_A Ubiquitin carboxyl-terminal hydrolase 7; UBL; 2.70A {Homo sapiens} Back     alignment and structure
>2l52_A Methanosarcina acetivorans SAMP1 homolog; beta-grAsp fold, protein binding, E1-like, SAMP activator, ELSA, adenylation, ubiquitin; NMR {Methanosarcina acetivorans} Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A Back     alignment and structure
>2kmm_A Guanosine-3',5'-BIS(diphosphate) 3'- pyrophosphohydrolase; methods development, TGS domain, predominantly beta-sheet structure; NMR {Porphyromonas gingivalis} Back     alignment and structure
>2cu3_A Unknown function protein; thermus thermophilus HB8, structural genomics, riken structu genomics/proteomics initiative, RSGI, NPPSFA; 1.70A {Thermus thermophilus} SCOP: d.15.3.2 PDB: 2htm_E Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>2k9x_A Tburm1, uncharacterized protein; unknown function; NMR {Trypanosoma brucei} Back     alignment and structure
>1rws_A Hypothetical protein PF1061; residual dipolar couplings, structural genomics, unknown FUN; NMR {Pyrococcus furiosus} SCOP: d.15.3.2 PDB: 1sf0_A Back     alignment and structure
>3au4_A Myosin-X; protein-protein complex, motor protein cargo transportation, protein-apoptosis complex; 1.90A {Homo sapiens} PDB: 3au5_A 3pzd_A Back     alignment and structure
>3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>2g1e_A Hypothetical protein TA0895; MOAD, molybdopterin, transferase; NMR {Thermoplasma acidophilum} PDB: 2k22_A Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} Back     alignment and structure
>1y8x_B Ubiquitin-activating enzyme E1C; ubiquitin-conjugating enzyme E2 M, ligase; 2.40A {Homo sapiens} SCOP: c.111.1.2 PDB: 3fn1_A Back     alignment and structure
>3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A Back     alignment and structure
>2lgx_A Fermitin family homolog 2; kindlin, membrane, integrin activation, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>1q1o_A Cell division control protein 24; PB1 domain, PCCR, PC motif, OPCA motif, yeast, cell polarity, protein-protein interaction; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 2kfj_A 2kfk_B Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2c7h_A RBBP6, retinoblastoma-binding protein 6, isoform 3; P53-associated, mRNA processing, splicing-associated, oesophageal cancer; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 73
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 4e-23
d1m94a_73 d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 3e-15
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 8e-11
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 1e-07
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 3e-07
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 3e-07
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 9e-07
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 1e-06
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 3e-06
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 3e-06
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 3e-06
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 9e-06
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 2e-05
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 3e-05
d1we6a_111 d.15.1.1 (A:) Splicing factor 3 subunit 1, C-termi 3e-05
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 4e-05
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 1e-04
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 1e-04
d2zeqa178 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin 2e-04
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 3e-04
d2faza176 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING fing 0.001
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 0.001
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 0.001
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 0.001
d1wy8a176 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING fing 0.001
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 0.001
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 0.002
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 0.002
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 0.003
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 0.004
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 0.004
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like protein 5, ubl5
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 82.0 bits (202), Expect = 4e-23
 Identities = 65/73 (89%), Positives = 68/73 (93%)

Query: 1   MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDY 60
           MIE+ CNDRLGKKVRVKCN DDTIGDLKKLIAAQTGTRW KIVLKKWYTIFKDH+ + DY
Sbjct: 28  MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDY 87

Query: 61  EIHDGMNLELYYQ 73
           EIHDGMNLELYYQ
Sbjct: 88  EIHDGMNLELYYQ 100


>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 111 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 100.0
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 100.0
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 100.0
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 100.0
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.98
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.97
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.97
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.97
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.97
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.97
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.96
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.96
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.96
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.96
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.95
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.95
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.94
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.94
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.94
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.93
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.93
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.92
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.92
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.92
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.91
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.91
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.9
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.9
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.89
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.86
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.83
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.81
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 99.81
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.8
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.76
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 99.41
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 99.27
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 98.58
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 98.03
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 97.76
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 97.66
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 97.25
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 95.81
d1ef1a384 Moesin {Human (Homo sapiens) [TaxId: 9606]} 94.74
d1wgra_100 Growth factor receptor-bound protein 7, GRB-7 {Hum 94.67
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 93.35
d1gg3a381 Erythroid membrane protein 4.1R {Human (Homo sapie 92.31
d1h4ra384 Merlin {Human (Homo sapiens) [TaxId: 9606]} 92.24
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 91.33
d1xo3a_101 C9orf74 homolog {Mouse (Mus musculus) [TaxId: 1009 90.87
d1y8xb192 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 90.64
d1c1yb_77 c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} 90.52
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 89.63
d2incc183 Toluene, o-xylene monooxygenase oxygenase subunit 89.16
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 88.96
d1wxma173 A-Raf proto-oncogene serine/threonine-protein kina 88.58
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 87.65
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 87.08
d2h2ja1 176 RuBisCo LSMT C-terminal, substrate-binding domain 86.2
d1zud2165 Thiamin biosynthesis sulfur carrier protein ThiS { 86.07
d2cu3a163 Uncharacterised protein TTHA0675 {Thermus thermoph 81.62
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Ubiquitin-like modifier protein hub1
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=100.00  E-value=1.2e-34  Score=167.31  Aligned_cols=72  Identities=60%  Similarity=0.968  Sum_probs=71.6

Q ss_pred             CEEEEEEcCCCCEEEEEeCCCCcHHHHHHHHHHHhCCCCccEEEEEcceEecCCccccccCCCCCCEEEEEe
Q psy4181           1 MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTRWEKIVLKKWYTIFKDHIRIMDYEIHDGMNLELYY   72 (73)
Q Consensus         1 ~~~i~vk~~~G~~~~v~v~~~~TV~~lK~~I~~~~gip~~~QrLif~Gk~L~D~~tL~~y~I~~g~ti~L~~   72 (73)
                      ||+|+||+++|++++++|+|++||++||++|+++.|+||++|||+|+|+.|+|+.||++|||++|+||||+|
T Consensus         1 mi~i~vk~~~Gk~~~v~V~~~~tV~~lK~~I~~~~~i~~~~q~Li~~Gk~L~d~~tL~~y~I~~gstl~L~~   72 (73)
T d1m94a_           1 MIEVVVNDRLGKKVRVKCLAEDSVGDFKKVLSLQIGTQPNKIVLQKGGSVLKDHISLEDYEVHDQTNLELYY   72 (73)
T ss_dssp             CEEEEEEETTTEEEEEEECTTSBHHHHHHHHHHHHCCTTTSEEEESSSCEECTTSBHHHHTCCTTEEEEEEE
T ss_pred             CeEEEEECCCCCEEEEEECCcCcHHHHHHHHHHhhcccccEEEEEEEeEEecccCcHHHcCCCCCCEEEEEE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999999



>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ef1a3 d.15.1.4 (A:4-87) Moesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgra_ d.15.1.5 (A:) Growth factor receptor-bound protein 7, GRB-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gg3a3 d.15.1.4 (A:1-81) Erythroid membrane protein 4.1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h4ra3 d.15.1.4 (A:20-103) Merlin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xo3a_ d.15.3.3 (A:) C9orf74 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y8xb1 c.111.1.2 (B:349-440) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c1yb_ d.15.1.5 (B:) c-Raf1 RBD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2incc1 d.15.12.1 (C:3-85) Toluene, o-xylene monooxygenase oxygenase subunit TouB {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1wxma1 d.15.1.5 (A:8-80) A-Raf proto-oncogene serine/threonine-protein kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d2h2ja1 a.166.1.1 (A:311-486) RuBisCo LSMT C-terminal, substrate-binding domain {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1zud21 d.15.3.2 (2:2-66) Thiamin biosynthesis sulfur carrier protein ThiS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cu3a1 d.15.3.2 (A:1-63) Uncharacterised protein TTHA0675 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure