Psyllid ID: psy4409


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-----
MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHSYDSFRSSTKKPGKYGVLIVKGSNISTMRVTSPSSQELTDDHSEDIEEYHVKHDDTSIQHEETCVQYEYDDDERTENK
ccccccccccccccccccccccccccccHHHHHHccccccccccccHHHHccccHHHHHHccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccccHHHHcc
ccccEEEcccccccccccccccEccccHHHHHccccccccccccccccccEccccHHHHHHcHccccccccccccccccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHcccccccccccccccccccccccccEEcccccccHcEEcccccccccccccccccccccEccccHHHHHHHHccccccccccHccccEccccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccccccccccccccccccccccHccccEccccHHHHHHHHcccccccc
mrrhlrkhsgekpytcyfcnfksaHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKrcsyvprpniqfnftclvcdyhsprsidmRRHIrrhtgekpfkcnfcfqcftQNVSLQTHIRIkhtrlfgqdkqestriyctfcrdplYNDLKILLQHTKNckgafrendsyryvcmvcpyhcrqnesMKRHLrkhtkdkpyecgfcslkfsrrdnlrrhlkdqhsydsfrsstkkpgkyGVLIVKgsnistmrvtspssqeltddhsedieeyhvkhddtsiqheetcvqyeydddertenk
mrrhlrkhsgekpyTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHtrlfgqdkqesTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHlrkhtkdkpyecGFCSLKFSRRDNLRRhlkdqhsydsfrsstkkpgkygVLIVkgsnistmrvtspssqeltddHSEDIEEYHvkhddtsiqheetcvqyeydddertenk
MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHSYDSFRSSTKKPGKYGVLIVKGSNISTMRVTSPSSQELTDDHSEDIEEYHVKHDDTSIQHEETCVQYEYDDDERTENK
************PYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQN*************KPYECGFCSLKFS***************************YGVLIVK*********************************************************
MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHSYDSFRSSTKKPGKYGVLIVKGSNISTMRVTSPSSQELTDD*******************EET***************
*********GEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHL*************KKPGKYGVLIVKGSNISTM*************HSEDIEEYHVKHDDTSIQHEETCVQYE**********
MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHSYDSFRSSTKKPGKYGVLIVKGSNISTMRVTSPSSQELTDDHSEDIEEYHVKHDDTSIQHEETCVQYEYDDD******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHSYDSFRSSTKKPGKYGVLIVKGSNISTMRVTSPSSQELTDDHSEDIEEYHVKHDDTSIQHEETCVQYEYDDDERTENK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query305 2.2.26 [Sep-21-2011]
Q99KE8643 Zinc finger protein 64 OS no N/A 0.734 0.348 0.286 4e-20
Q9NTW7645 Zinc finger protein 64 ho yes N/A 0.734 0.347 0.292 4e-20
Q61164 736 Transcriptional repressor no N/A 0.708 0.293 0.297 2e-19
Q9R1D1 737 Transcriptional repressor no N/A 0.708 0.293 0.297 2e-19
Q08705 728 Transcriptional repressor no N/A 0.708 0.296 0.297 2e-19
P49711 727 Transcriptional repressor no N/A 0.708 0.297 0.297 2e-19
Q8NI51663 Transcriptional repressor no N/A 0.714 0.328 0.268 3e-19
P08048801 Zinc finger Y-chromosomal no N/A 0.708 0.269 0.290 2e-18
Q6B4Z5801 Zinc finger Y-chromosomal no N/A 0.708 0.269 0.286 2e-18
P10076861 Zinc finger protein 26 OS no N/A 0.688 0.243 0.310 2e-18
>sp|Q99KE8|ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus GN=Zfp64 PE=2 SV=1 Back     alignment and function desciption
 Score = 99.0 bits (245), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/265 (28%), Positives = 120/265 (45%), Gaps = 41/265 (15%)

Query: 1   MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLK----IKHLEKIQCRYSILKLQSHEES 56
           + RHLR H+G+KP+ C FC+   +   ++  H++    +K  +   C Y+ +   S ++ 
Sbjct: 315 LDRHLRIHTGDKPHKCEFCDKCFSRKDNLTMHMRCHTSVKPHKCHLCDYAAVDSSSLKKH 374

Query: 57  LVQHA-------KRCSYVPRPNIQFN-----------FTCLVCDYHSPRSIDMRRHIRRH 98
           L  H+       + C Y  R + Q             F C +C      S D++RH+  H
Sbjct: 375 LRIHSDERPYKCQLCPYASRNSSQLTVHLRSHTGDTPFQCWLCSAKFKISSDLKRHMIVH 434

Query: 99  TGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILL 158
           +GEKPFKC FC    T   +L++HIRIKHT            ++C F       D   LL
Sbjct: 435 SGEKPFKCEFCDVRCTMKANLKSHIRIKHTFKC---------LHCAF----QGRDRADLL 481

Query: 159 QHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDN 218
           +H++  +    E       C  C Y C    +++ H R H  D+P++C FCS    R  +
Sbjct: 482 EHSRLHQADHPEK------CPECSYSCSNPAALRVHSRVHCTDRPFKCDFCSFDTKRPSS 535

Query: 219 LRRHLKDQHSYDSFRSSTKKPGKYG 243
           L +H+   H   +   +   PGK G
Sbjct: 536 LAKHIDKVHREGAKTENRAPPGKDG 560




May be involved in transcriptional regulation.
Mus musculus (taxid: 10090)
>sp|Q9NTW7|ZF64B_HUMAN Zinc finger protein 64 homolog, isoforms 3 and 4 OS=Homo sapiens GN=ZFP64 PE=2 SV=3 Back     alignment and function description
>sp|Q61164|CTCF_MOUSE Transcriptional repressor CTCF OS=Mus musculus GN=Ctcf PE=1 SV=2 Back     alignment and function description
>sp|Q9R1D1|CTCF_RAT Transcriptional repressor CTCF OS=Rattus norvegicus GN=Ctcf PE=2 SV=1 Back     alignment and function description
>sp|Q08705|CTCF_CHICK Transcriptional repressor CTCF OS=Gallus gallus GN=CTCF PE=1 SV=1 Back     alignment and function description
>sp|P49711|CTCF_HUMAN Transcriptional repressor CTCF OS=Homo sapiens GN=CTCF PE=1 SV=1 Back     alignment and function description
>sp|Q8NI51|CTCFL_HUMAN Transcriptional repressor CTCFL OS=Homo sapiens GN=CTCFL PE=1 SV=2 Back     alignment and function description
>sp|P08048|ZFY_HUMAN Zinc finger Y-chromosomal protein OS=Homo sapiens GN=ZFY PE=1 SV=3 Back     alignment and function description
>sp|Q6B4Z5|ZFY_PANTR Zinc finger Y-chromosomal protein OS=Pan troglodytes GN=ZFY PE=2 SV=1 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
260823046 517 hypothetical protein BRAFLDRAFT_71717 [B 0.675 0.398 0.305 7e-22
260823018 507 hypothetical protein BRAFLDRAFT_71732 [B 0.675 0.406 0.297 5e-21
440902858 562 Zinc finger protein 64-like protein, iso 0.790 0.428 0.289 7e-21
348555782 681 PREDICTED: zinc finger protein 64 homolo 0.672 0.301 0.301 1e-20
348555784 627 PREDICTED: zinc finger protein 64 homolo 0.672 0.326 0.301 1e-20
260823024 596 hypothetical protein BRAFLDRAFT_71729 [B 0.603 0.308 0.296 2e-20
260823004 909 hypothetical protein BRAFLDRAFT_71739 [B 0.629 0.211 0.310 2e-20
260823124 954 hypothetical protein BRAFLDRAFT_119785 [ 0.645 0.206 0.321 3e-20
72028083 939 PREDICTED: uncharacterized protein LOC59 0.744 0.241 0.290 4e-20
441638113 454 PREDICTED: transcriptional repressor CTC 0.783 0.526 0.28 4e-20
>gi|260823046|ref|XP_002603994.1| hypothetical protein BRAFLDRAFT_71717 [Branchiostoma floridae] gi|229289319|gb|EEN60005.1| hypothetical protein BRAFLDRAFT_71717 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score =  110 bits (275), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 112/239 (46%), Gaps = 33/239 (13%)

Query: 1   MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKI----QCRYSILKLQSHEES 56
           + RH++ HSGEKPY C  C +++A+  +++ H++    +K     QC YS  +  S ++ 
Sbjct: 256 LSRHMKIHSGEKPYMCGECGYRAAYKYNLSQHMRTHTGQKPYKCDQCNYSAAQKSSLDQH 315

Query: 57  LVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQN 116
           L++H     Y+          C  C + +    D+ RH+R HTGEKP+KC+ C     Q 
Sbjct: 316 LMKHTGEKPYM----------CGECGHRTTTKSDLSRHMRIHTGEKPYKCDQCDYSAAQK 365

Query: 117 VSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLK--ILLQHTKNCKGAFRENDSY 174
           V+   HI  KHT         S + Y   C +  Y       L +H +   G        
Sbjct: 366 VNFDAHIAAKHT---------SEKPY--MCGECGYRTAGRSTLSRHMRTHTG------ER 408

Query: 175 RYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHSYDSFR 233
           RY C  C Y   Q   + +HL  HT +KPY CG C  + +R+ NL RH++       F+
Sbjct: 409 RYKCDQCDYSAMQKGDLDKHLATHTGEKPYMCGECGYRTARKSNLSRHMRTHSGKKPFK 467




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|260823018|ref|XP_002603980.1| hypothetical protein BRAFLDRAFT_71732 [Branchiostoma floridae] gi|229289305|gb|EEN59991.1| hypothetical protein BRAFLDRAFT_71732 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|440902858|gb|ELR53593.1| Zinc finger protein 64-like protein, isoforms 1 and 2, partial [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|348555782|ref|XP_003463702.1| PREDICTED: zinc finger protein 64 homolog, isoforms 1 and 2-like isoform 1 [Cavia porcellus] Back     alignment and taxonomy information
>gi|348555784|ref|XP_003463703.1| PREDICTED: zinc finger protein 64 homolog, isoforms 1 and 2-like isoform 2 [Cavia porcellus] Back     alignment and taxonomy information
>gi|260823024|ref|XP_002603983.1| hypothetical protein BRAFLDRAFT_71729 [Branchiostoma floridae] gi|229289308|gb|EEN59994.1| hypothetical protein BRAFLDRAFT_71729 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260823004|ref|XP_002603973.1| hypothetical protein BRAFLDRAFT_71739 [Branchiostoma floridae] gi|229289298|gb|EEN59984.1| hypothetical protein BRAFLDRAFT_71739 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|260823124|ref|XP_002604033.1| hypothetical protein BRAFLDRAFT_119785 [Branchiostoma floridae] gi|229289358|gb|EEN60044.1| hypothetical protein BRAFLDRAFT_119785 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|72028083|ref|XP_797592.1| PREDICTED: uncharacterized protein LOC593001 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|441638113|ref|XP_004090109.1| PREDICTED: transcriptional repressor CTCFL [Nomascus leucogenys] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query305
UNIPROTKB|D4A4M7474 Zfp64 "Protein Zfp64" [Rattus 0.849 0.546 0.290 7.4e-28
RGD|1307948 678 Zfp64 "zinc finger protein 64" 0.849 0.382 0.290 3.8e-27
UNIPROTKB|Q5JWM1 679 ZFP64 "Zinc finger protein 64 0.668 0.300 0.320 2.8e-26
UNIPROTKB|Q9NPA5 681 ZFP64 "Zinc finger protein 64 0.668 0.299 0.320 2.8e-26
UNIPROTKB|E2R5D8 682 ZFP64 "Uncharacterized protein 0.908 0.406 0.272 2.8e-26
UNIPROTKB|A5GFU9 680 ZFP64 "Zinc finger protein 64 0.668 0.3 0.320 5.9e-26
UNIPROTKB|F1NMT1559 ZFP64 "Uncharacterized protein 0.665 0.363 0.326 7e-26
UNIPROTKB|F1NMT2 689 ZFP64 "Uncharacterized protein 0.665 0.294 0.326 1.3e-25
ZFIN|ZDB-GENE-110913-123429 si:dkey-14o6.4 "si:dkey-14o6.4 0.642 0.456 0.353 3.3e-25
ZFIN|ZDB-GENE-110914-70392 si:ch211-234c11.2 "si:ch211-23 0.642 0.5 0.353 3.6e-25
UNIPROTKB|D4A4M7 Zfp64 "Protein Zfp64" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 313 (115.2 bits), Expect = 7.4e-28, P = 7.4e-28
 Identities = 86/296 (29%), Positives = 137/296 (46%)

Query:     1 MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQH 60
             ++ H+R H+G KPY C  C++ +A  SS+N HL+I H ++   +  I    S   S +  
Sbjct:   190 LKTHMRCHTGVKPYKCKTCDYAAADSSSLNKHLRI-HSDERPFKCQICPYASRNSSQLTV 248

Query:    61 AKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFC-FQCFTQNVSL 119
               R      P     F C +C      S D++RH+R H+GEKPFKC+FC  +C T   +L
Sbjct:   249 HLRSHTGDAP-----FQCWLCSAKFKISSDLKRHMRVHSGEKPFKCDFCNVRC-TMKGNL 302

Query:   120 QTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCM 179
             ++HIRIKH+              C  C D L +    L +H++  +    E       C 
Sbjct:   303 KSHIRIKHS---------GNNFKCPHC-DFLGDSKSTLRKHSRLHQSEHPEK------CA 346

Query:   180 VCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHS----------Y 229
              C Y C    +++ H R H  ++P++C +CS    +  NL +H+K  H+           
Sbjct:   347 ECSYSCSSKAALRVHERIHCTERPFKCSYCSFDTKQPSNLSKHMKKFHADTLKNEAPERK 406

Query:   230 DSFRSSTKKPGKYGVLIVKGSNISTMRVTSPSSQELTDDHSEDIEEYHVKHDDTSI 285
             DS R S+++  K   L  K +    +   S   ++    H     EYH K+ D ++
Sbjct:   407 DSGRQSSRQVAK---LDAKKTFHCDICDASFMREDSLRSHKRQHSEYHSKNSDVTV 459


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
RGD|1307948 Zfp64 "zinc finger protein 64" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5JWM1 ZFP64 "Zinc finger protein 64 homolog, isoforms 1 and 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NPA5 ZFP64 "Zinc finger protein 64 homolog, isoforms 1 and 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R5D8 ZFP64 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFU9 ZFP64 "Zinc finger protein 64 homolog (Mouse)" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMT1 ZFP64 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMT2 ZFP64 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-123 si:dkey-14o6.4 "si:dkey-14o6.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-70 si:ch211-234c11.2 "si:ch211-234c11.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 34.7 bits (80), Expect = 0.002
 Identities = 14/26 (53%), Positives = 20/26 (76%)

Query: 90  DMRRHIRRHTGEKPFKCNFCFQCFTQ 115
           ++RRH+R HTGEKP+KC  C + F+ 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 305
KOG2462|consensus279 99.95
KOG2462|consensus279 99.94
KOG1074|consensus 958 99.93
KOG3608|consensus467 99.9
KOG3608|consensus467 99.89
KOG3623|consensus 1007 99.84
KOG1074|consensus 958 99.84
KOG3576|consensus267 99.69
KOG3576|consensus267 99.68
KOG3623|consensus 1007 99.57
PLN03086567 PRLI-interacting factor K; Provisional 99.34
PLN03086567 PRLI-interacting factor K; Provisional 99.1
PHA00733128 hypothetical protein 99.08
PHA00733128 hypothetical protein 99.03
PHA0276855 hypothetical protein; Provisional 98.98
KOG3993|consensus500 98.97
KOG3993|consensus500 98.89
PHA0276855 hypothetical protein; Provisional 98.8
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.71
PHA0061644 hypothetical protein 98.69
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.6
PHA0061644 hypothetical protein 98.43
PHA0073279 hypothetical protein 98.26
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.26
PHA0073279 hypothetical protein 98.09
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.08
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.99
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.98
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.93
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.93
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.89
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.77
COG5236 493 Uncharacterized conserved protein, contains RING Z 97.72
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.62
COG5189423 SFP1 Putative transcriptional repressor regulating 97.59
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.58
COG5189423 SFP1 Putative transcriptional repressor regulating 97.52
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 97.23
KOG1146|consensus 1406 97.14
KOG2231|consensus 669 97.11
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.07
KOG2231|consensus 669 97.06
smart0035526 ZnF_C2H2 zinc finger. 96.97
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.89
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.88
smart0035526 ZnF_C2H2 zinc finger. 96.88
KOG2785|consensus390 96.8
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.8
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.74
KOG2482|consensus423 96.74
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.62
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.54
PRK04860160 hypothetical protein; Provisional 96.43
KOG1146|consensus 1406 96.3
KOG2482|consensus423 96.13
PRK04860160 hypothetical protein; Provisional 95.78
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.53
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 95.51
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.28
KOG4173|consensus253 95.21
KOG2893|consensus341 95.05
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.03
KOG2893|consensus 341 94.82
COG5236 493 Uncharacterized conserved protein, contains RING Z 94.78
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 94.63
COG404965 Uncharacterized protein containing archaeal-type C 94.16
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.82
COG404965 Uncharacterized protein containing archaeal-type C 93.79
KOG2785|consensus390 93.75
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.93
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.86
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 92.6
COG5048467 FOG: Zn-finger [General function prediction only] 91.94
KOG4173|consensus253 91.3
COG5048467 FOG: Zn-finger [General function prediction only] 88.75
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 88.39
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 88.22
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 87.99
PF1371937 zinc_ribbon_5: zinc-ribbon domain 87.5
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 87.31
PF1371736 zinc_ribbon_4: zinc-ribbon domain 86.94
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 86.32
KOG2186|consensus276 85.86
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 85.5
PF09986214 DUF2225: Uncharacterized protein conserved in bact 84.87
PF09986214 DUF2225: Uncharacterized protein conserved in bact 84.42
KOG1280|consensus 381 84.19
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 83.83
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 83.06
COG1592166 Rubrerythrin [Energy production and conversion] 83.0
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 82.46
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 82.37
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 81.0
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 80.86
>KOG2462|consensus Back     alignment and domain information
Probab=99.95  E-value=4.9e-29  Score=195.33  Aligned_cols=134  Identities=23%  Similarity=0.527  Sum_probs=126.9

Q ss_pred             CCcccCCCCccCCCcHHHHHHHHhhCC---CCCeeCCcCcccccChHHHHHHHHHhcCccccccccCcCccccCCCCccc
Q psy4409          74 FNFTCLVCDYHSPRSIDMRRHIRRHTG---EKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPL  150 (305)
Q Consensus        74 ~~~~C~~C~~~f~~~~~l~~H~~~h~~---~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~C~~C~~~~  150 (305)
                      ..|+|..|++.+.+.+.|.+|.++|..   .+.|.|++|++.|.+...|..|+++ |..          ++.|.+|| +.
T Consensus       129 ~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirT-H~l----------~c~C~iCG-Ka  196 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRT-HTL----------PCECGICG-KA  196 (279)
T ss_pred             CceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhc-cCC----------Cccccccc-cc
Confidence            359999999999999999999999965   5779999999999999999999999 665          89999999 99


Q ss_pred             hhcHHHHHHHHhhhcCccccCCCCCcccCCCcccccCcHHHHHHHHHhCCCCCccCccchhhcCChHHHHHHHHh
Q psy4409         151 YNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKD  225 (305)
Q Consensus       151 ~~~~~~l~~h~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~  225 (305)
                      |.....|+.|+++|+|+      +||.|+.|+++|...++|+.||++|.+.|+|+|..|++.|..++.|.+|...
T Consensus       197 FSRPWLLQGHiRTHTGE------KPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  197 FSRPWLLQGHIRTHTGE------KPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             ccchHHhhcccccccCC------CCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            99999999999999999      9999999999999999999999999999999999999999999999999875



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG1280|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-10
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 5e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 3e-05
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-06
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-04
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 6e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-04
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-05
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 8e-04
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-05
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 8e-04
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 2e-05
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 9e-04
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 5e-04
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 5e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 3e-04
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 5e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 5e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-04
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 5e-05
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-05
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 7e-04
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 7e-05
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 7e-04
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-04
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 3e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 5e-04
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 6e-04
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 8e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 8e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 62.8 bits (151), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 48/147 (32%), Positives = 65/147 (44%), Gaps = 16/147 (10%) Query: 76 FTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDK 135 + C C D+ RH R HTGEKP+KC C + F+Q +L+ H R HT G+ Sbjct: 50 YKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRT-HT---GEKP 105 Query: 136 QESTRIYCTFCRDPLYNDLKILLQHTKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHL 195 C C ++ L L H + G Y C C + +++ H Sbjct: 106 -----YACPECGK-SFSQLAHLRAHQRTHTG------EKPYKCPECGKSFSREDNLHTHQ 153 Query: 196 RKHTKDKPYECGFCSLKFSRRDNLRRH 222 R HT +KPY+C C FSRRD L H Sbjct: 154 RTHTGEKPYKCPECGKSFSRRDALNVH 180
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query305
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-14
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-12
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-11
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-13
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-13
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-12
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-11
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-06
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-11
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-11
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-11
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-10
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-08
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-09
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-09
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-08
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-06
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 9e-08
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-08
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-08
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-08
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 6e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 7e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 7e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-08
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-08
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 8e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-08
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-06
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 8e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-07
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-06
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-04
1paa_A30 Yeast transcription factor ADR1; transcription reg 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 8e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score = 69.4 bits (171), Expect = 2e-14
 Identities = 59/228 (25%), Positives = 82/228 (35%), Gaps = 64/228 (28%)

Query: 2   RRHLRKHSGEKPYTCYFCNFKS-AHMSSINNHLKIKHLEK----IQCRYSILKLQSHEES 56
                   GEKPY C  C  KS +    +  H +    EK     +C     K  S ++ 
Sbjct: 10  VAQAALEPGEKPYACPECG-KSFSRSDHLAEHQRTHTGEKPYKCPECG----KSFSDKKD 64

Query: 57  LVQHAKRCSYVPRPNIQFNFTCLVCDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQN 116
           L +H +R     +P     + C  C     +  ++R H R HTGEKP+ C  C + F+Q 
Sbjct: 65  LTRH-QRTHTGEKP-----YKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQL 118

Query: 117 VSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQHT--KNCKGAFRENDSY 174
             L+ H R                                   HT  K            
Sbjct: 119 AHLRAHQRT----------------------------------HTGEK------------ 132

Query: 175 RYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRH 222
            Y C  C     + +++  H R HT +KPY+C  C   FSRRD L  H
Sbjct: 133 PYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVH 180


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 30 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.87
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.86
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.86
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.85
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.74
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.74
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.74
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.73
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.73
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.72
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.72
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.72
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.71
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.64
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.64
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.64
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.64
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.61
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.6
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.6
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.58
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.57
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.57
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.57
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.56
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.56
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.55
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.54
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.53
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.53
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.52
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.5
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.49
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.49
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.47
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.45
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.44
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.44
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.44
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.43
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.43
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.42
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.42
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.38
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.38
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.38
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.38
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.37
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.37
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.36
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.35
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.35
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.31
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.28
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.28
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.24
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.21
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.21
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.2
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.2
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.19
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.19
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.19
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.19
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.18
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.17
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.17
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.16
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.11
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.11
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.1
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.1
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.1
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.1
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.1
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.04
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.03
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.01
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.01
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.0
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.98
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.98
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.97
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.95
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.95
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.94
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.93
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.93
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.92
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.9
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.9
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.89
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.89
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.87
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.87
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.87
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.87
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.85
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.84
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.83
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.82
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.81
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.8
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.79
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.77
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.77
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.75
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.74
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.73
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.72
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.7
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.63
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.6
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.59
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.58
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.58
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.57
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.57
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.56
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.53
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.53
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.48
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.46
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.45
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.45
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.44
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.43
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.43
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.43
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.42
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.41
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.38
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.37
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.36
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.3
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.25
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.25
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.23
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.23
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.23
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.22
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.22
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.22
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.21
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.21
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.21
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.2
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.2
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.19
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.19
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.16
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.16
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.16
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.15
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.15
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.15
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.14
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.14
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.13
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.12
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.11
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.39
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.1
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.37
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.37
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.09
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.36
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.08
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.35
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.07
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.07
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.07
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.04
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.24
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.94
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.78
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.72
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.67
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.54
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 97.13
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.71
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.7
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.43
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.37
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.35
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.21
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.35
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.33
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.65
2k5c_A95 Uncharacterized protein PF0385; structural genomic 92.86
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 92.11
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.29
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 89.58
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 89.48
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 87.99
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 87.82
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 86.55
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 85.55
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 84.28
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 84.02
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 83.89
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.82
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 80.55
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 80.35
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=4.3e-38  Score=248.45  Aligned_cols=182  Identities=30%  Similarity=0.585  Sum_probs=142.9

Q ss_pred             CccccccccCCCcccCCCCCCcCcChHHHHhhhhhccccccceeeehhhhccchHHHHHhhhccCCCCCCCCCCCcccCC
Q psy4409           1 MRRHLRKHSGEKPYTCYFCNFKSAHMSSINNHLKIKHLEKIQCRYSILKLQSHEESLVQHAKRCSYVPRPNIQFNFTCLV   80 (305)
Q Consensus         1 L~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~c~~~~~~~~~~~~~l~~h~~~~h~~~~~~~~~~~~C~~   80 (305)
                      |..|++.|.++++|.|+.|++.|.+...|..|++.|++.                             .+     |.|..
T Consensus         9 l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~-----------------------------~~-----~~C~~   54 (190)
T 2i13_A            9 SVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGE-----------------------------KP-----YKCPE   54 (190)
T ss_dssp             ----------------------CCSSHHHHHGGGCC--------------------------------CC-----EECTT
T ss_pred             chhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCC-----------------------------CC-----ccCCC
Confidence            567888999999999999999999999999999776542                             22     99999


Q ss_pred             CCccCCCcHHHHHHHHhhCCCCCeeCCcCcccccChHHHHHHHHHhcCccccccccCcCccccCCCCccchhcHHHHHHH
Q psy4409          81 CDYHSPRSIDMRRHIRRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTRLFGQDKQESTRIYCTFCRDPLYNDLKILLQH  160 (305)
Q Consensus        81 C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~~H~~~~~~~~~~~~~~~C~~C~~~~~~~~~~l~~h  160 (305)
                      |++.|.+...|..|++.|.++++|.|+.|++.|.+...|..|++.++..         .+|.|+.|+ +.|.....|..|
T Consensus        55 C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~---------~~~~C~~C~-~~f~~~~~l~~H  124 (190)
T 2i13_A           55 CGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGE---------KPYACPECG-KSFSQLAHLRAH  124 (190)
T ss_dssp             TCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHTC---------CCEECTTTC-CEESSHHHHHHH
T ss_pred             cCchhCCHHHHHHHHHhcCCCCCccCcccCCccCCHHHHHHHHHhcCCC---------CCCcCCCCC-CccCCHHHHHHH
Confidence            9999999999999999999999999999999999999999999996543         289999999 999999999999


Q ss_pred             HhhhcCccccCCCCCcccCCCcccccCcHHHHHHHHHhCCCCCccCccchhhcCChHHHHHHHHhcCCcccc
Q psy4409         161 TKNCKGAFRENDSYRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQHSYDSF  232 (305)
Q Consensus       161 ~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~hh~~~~~  232 (305)
                      ++.|.+.      ++|.|+.|++.|.+...|..|+++|+++++|.|++|++.|.++..|..|+++|++++||
T Consensus       125 ~~~h~~~------~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          125 QRTHTGE------KPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             HHHHHCC------CCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             HHHhCCC------CCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            9999987      89999999999999999999999999999999999999999999999999999998875



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 305
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.002
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 3e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 4e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 5e-04
d2adra231 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Sac 7e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.003
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 45.4 bits (108), Expect = 1e-07
 Identities = 16/34 (47%), Positives = 23/34 (67%)

Query: 96  RRHTGEKPFKCNFCFQCFTQNVSLQTHIRIKHTR 129
           R H+GEKP++C  C   FTQ+ +++ HI  KHT 
Sbjct: 1   RTHSGEKPYECYICHARFTQSGTMKMHILQKHTE 34


>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 31 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query305
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.62
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.54
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.31
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.26
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.22
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.19
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.17
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.17
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.15
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.14
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.13
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.12
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.1
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.1
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.01
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.97
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.96
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.93
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.92
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.91
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.91
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.9
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.87
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.83
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.77
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.77
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.71
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.7
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.68
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.65
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.62
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.58
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.56
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.55
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.41
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.4
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.36
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.36
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.27
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.2
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.16
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.14
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.11
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.08
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.01
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.96
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.96
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.95
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.94
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.87
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.86
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.72
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.68
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.67
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.64
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.61
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.57
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.55
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.48
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.4
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.38
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.37
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.37
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.35
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.35
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.3
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.28
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.21
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.17
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.16
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.14
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.12
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.08
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.0
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.96
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.95
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.85
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.77
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.73
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.69
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.69
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.67
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.62
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.6
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.51
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.5
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.47
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.47
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.35
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.32
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.97
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.97
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.74
d1y0jb136 U-shaped transcription factor, different fingers { 95.6
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.3
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.11
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.03
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.71
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.24
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.96
d1y0jb136 U-shaped transcription factor, different fingers { 93.94
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 93.32
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.08
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.68
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.41
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.93
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.51
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 91.36
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.02
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 90.63
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.51
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 90.09
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 89.77
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.15
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 88.13
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 88.08
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.74
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 87.69
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.35
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 86.17
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.43
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 84.36
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 83.66
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 83.09
d2glia132 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 81.66
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 80.81
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 80.43
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 80.31
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.62  E-value=1.3e-16  Score=95.30  Aligned_cols=52  Identities=31%  Similarity=0.642  Sum_probs=49.8

Q ss_pred             CCcccCCCcccccCcHHHHHHHHHhCCCCCccCccchhhcCChHHHHHHHHhc
Q psy4409         174 YRYVCMVCPYHCRQNESMKRHLRKHTKDKPYECGFCSLKFSRRDNLRRHLKDQ  226 (305)
Q Consensus       174 ~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  226 (305)
                      ++|.|. ||+.|.....|..|+++|++++||.|.+||+.|...+.|..|+++|
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            799995 9999999999999999999999999999999999999999999875



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia1 g.37.1.1 (A:103-134) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure