Psyllid ID: psy4421


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------
VQESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH
ccccccccccccccccccccccHHHHcHHHHccccccccccccccccccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccHHHHHHHHcc
cccccccccccccccccccccccEEEcccHHHHHHHHcccccccccccccccEccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccHccccEccccHHHHHHHHccccccccccHcccccccccHHHHHHHHcc
vqeslninqcvhchltltKSTEVIVKHAQTCIsmvrpdsfkykygcyrcsyftyesnNLKKHILKhtgekpfsymYENQQYCIHCNSYISSDIKDLIEHckscshmtrpdafhFKFVCYACEYntymsgnikthlrlhlddkpykcslcnyecrqnvhlkshmksnh
vqeslninqcvHCHLTLTKSTEVIVKHAQTCismvrpdsfkYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQnvhlkshmksnh
VQESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH
*****NINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVH*********
VQESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHM****
VQESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHL********
****LNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVH*KS******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VQESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query167 2.2.26 [Sep-21-2011]
Q8VIG1 1082 RE1-silencing transcripti no N/A 0.724 0.111 0.279 2e-13
O54963 1069 RE1-silencing transcripti yes N/A 0.700 0.109 0.270 2e-13
Q6PD29541 Zinc finger protein 513 O yes N/A 0.622 0.192 0.35 2e-13
Q8N8E2541 Zinc finger protein 513 O yes N/A 0.622 0.192 0.35 2e-13
Q13127 1097 RE1-silencing transcripti no N/A 0.724 0.110 0.279 4e-13
Q5FWU5541 Zinc finger protein 513 O no N/A 0.622 0.192 0.35 5e-13
Q9NPA5 681 Zinc finger protein 64 ho no N/A 0.646 0.158 0.330 1e-10
Q9PVG3 529 RE1-silencing transcripti N/A N/A 0.724 0.228 0.279 3e-10
Q2EI21 1501 RE1-silencing transcripti N/A N/A 0.700 0.077 0.277 9e-10
Q99KE8 643 Zinc finger protein 64 OS no N/A 0.634 0.164 0.303 5e-09
>sp|Q8VIG1|REST_MOUSE RE1-silencing transcription factor OS=Mus musculus GN=Rest PE=2 SV=2 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 38/136 (27%), Positives = 66/136 (48%), Gaps = 15/136 (11%)

Query: 32  ISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISS 91
           +  VR  + +  Y C  C Y + +  +L +H+  H+GEKPF         C  CN Y++S
Sbjct: 287 VQHVRTHTGERPYKCELCPYSSSQKTHLTRHMRTHSGEKPFK--------CDQCN-YVAS 337

Query: 92  DIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNY 151
           +  ++  H +   +  +P        C  C+Y T    N K H+ LH++ + + C +C+Y
Sbjct: 338 NQHEVTRHARQVHNGPKP------LNCPHCDYKTADRSNFKKHVELHVNPRQFNCPVCDY 391

Query: 152 ECRQNVHLKSHMKSNH 167
              +  +L+ H KS H
Sbjct: 392 AASKKCNLQYHFKSKH 407




Transcriptional repressor which binds neuron-restrictive silencer element (NRSE) and represses neuronal gene transcription in non-neuronal cells. Restricts the expression of neuronal genes by associating with two distinct corepressors, mSin3 and CoREST, which in turn recruit histone deacetylase to the promoters of REST-regulated genes. Mediates repression by recruiting the BHC complex at RE1/NRSE sites which acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier.
Mus musculus (taxid: 10090)
>sp|O54963|REST_RAT RE1-silencing transcription factor OS=Rattus norvegicus GN=Rest PE=2 SV=1 Back     alignment and function description
>sp|Q6PD29|ZN513_MOUSE Zinc finger protein 513 OS=Mus musculus GN=Znf513 PE=1 SV=2 Back     alignment and function description
>sp|Q8N8E2|ZN513_HUMAN Zinc finger protein 513 OS=Homo sapiens GN=ZNF513 PE=1 SV=2 Back     alignment and function description
>sp|Q13127|REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 Back     alignment and function description
>sp|Q5FWU5|ZN513_RAT Zinc finger protein 513 OS=Rattus norvegicus GN=Znf513 PE=2 SV=1 Back     alignment and function description
>sp|Q9NPA5|ZF64A_HUMAN Zinc finger protein 64 homolog, isoforms 1 and 2 OS=Homo sapiens GN=ZFP64 PE=1 SV=3 Back     alignment and function description
>sp|Q9PVG3|RESTB_XENLA RE1-silencing transcription factor B (Fragment) OS=Xenopus laevis GN=rest-b PE=2 SV=1 Back     alignment and function description
>sp|Q2EI21|RESTA_XENLA RE1-silencing transcription factor A OS=Xenopus laevis GN=rest-a PE=2 SV=1 Back     alignment and function description
>sp|Q99KE8|ZFP64_MOUSE Zinc finger protein 64 OS=Mus musculus GN=Zfp64 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
260819188 409 hypothetical protein BRAFLDRAFT_185156 [ 0.700 0.286 0.360 2e-13
444516263 979 RE1-silencing transcription factor [Tupa 0.652 0.111 0.314 4e-13
332243333 632 PREDICTED: zinc finger protein 513 [Noma 0.622 0.164 0.35 2e-12
432096793 538 Zinc finger protein 513 [Myotis davidii] 0.622 0.193 0.35 3e-12
148705403 570 zinc finger protein 513, isoform CRA_b [ 0.622 0.182 0.35 4e-12
311262204 1037 PREDICTED: RE1-silencing transcription f 0.724 0.116 0.279 5e-12
395851383 1172 PREDICTED: RE1-silencing transcription f 0.724 0.103 0.279 6e-12
295444870 539 zinc finger protein 513 isoform 2 [Mus m 0.622 0.192 0.35 7e-12
390460850 1244 PREDICTED: LOW QUALITY PROTEIN: RE1-sile 0.724 0.097 0.279 7e-12
431911929 539 Zinc finger protein 513 [Pteropus alecto 0.622 0.192 0.35 7e-12
>gi|260819188|ref|XP_002604919.1| hypothetical protein BRAFLDRAFT_185156 [Branchiostoma floridae] gi|229290248|gb|EEN60929.1| hypothetical protein BRAFLDRAFT_185156 [Branchiostoma floridae] Back     alignment and taxonomy information
 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 66/133 (49%), Gaps = 16/133 (12%)

Query: 35  VRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIK 94
           +R  S +  Y C RCSY   +S++LKKH+  HT E+PF       Q C + +   S  I 
Sbjct: 137 LRVHSGEKPYACSRCSYAAADSSSLKKHVRTHTNERPFKC-----QICPYASRNSSQLIV 191

Query: 95  DLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECR 154
            L  H   C            F C  CE    +  ++K H+R H  DKPYKC LC+Y C 
Sbjct: 192 HLRSHTGDCP-----------FHCQLCEAKFKIKSDLKRHMRTHTGDKPYKCDLCDYRCA 240

Query: 155 QNVHLKSHMKSNH 167
              +LK H+++NH
Sbjct: 241 MKGNLKVHVRNNH 253




Source: Branchiostoma floridae

Species: Branchiostoma floridae

Genus: Branchiostoma

Family: Branchiostomidae

Order:

Class:

Phylum: Chordata

Superkingdom: Eukaryota

>gi|444516263|gb|ELV11094.1| RE1-silencing transcription factor [Tupaia chinensis] Back     alignment and taxonomy information
>gi|332243333|ref|XP_003270833.1| PREDICTED: zinc finger protein 513 [Nomascus leucogenys] Back     alignment and taxonomy information
>gi|432096793|gb|ELK27371.1| Zinc finger protein 513 [Myotis davidii] Back     alignment and taxonomy information
>gi|148705403|gb|EDL37350.1| zinc finger protein 513, isoform CRA_b [Mus musculus] Back     alignment and taxonomy information
>gi|311262204|ref|XP_003129069.1| PREDICTED: RE1-silencing transcription factor [Sus scrofa] gi|335293561|ref|XP_003356995.1| PREDICTED: RE1-silencing transcription factor-like [Sus scrofa] gi|456753171|gb|JAA74113.1| RE1-silencing transcription factor [Sus scrofa] Back     alignment and taxonomy information
>gi|395851383|ref|XP_003798239.1| PREDICTED: RE1-silencing transcription factor, partial [Otolemur garnettii] Back     alignment and taxonomy information
>gi|295444870|ref|NP_001171372.1| zinc finger protein 513 isoform 2 [Mus musculus] gi|74178313|dbj|BAE32430.1| unnamed protein product [Mus musculus] Back     alignment and taxonomy information
>gi|390460850|ref|XP_002745853.2| PREDICTED: LOW QUALITY PROTEIN: RE1-silencing transcription factor [Callithrix jacchus] Back     alignment and taxonomy information
>gi|431911929|gb|ELK14073.1| Zinc finger protein 513 [Pteropus alecto] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query167
UNIPROTKB|F1NUB6186 ZNF513 "Uncharacterized protei 0.622 0.559 0.341 5.4e-15
ZFIN|ZDB-GENE-110914-29350 si:ch211-245n8.2 "si:ch211-245 0.892 0.425 0.278 1.5e-14
UNIPROTKB|Q8N8E2541 ZNF513 "Zinc finger protein 51 0.622 0.192 0.35 2.2e-14
MGI|MGI:2141255541 Zfp513 "zinc finger protein 51 0.622 0.192 0.35 2.2e-14
RGD|1310456541 Zfp513 "zinc finger protein 51 0.622 0.192 0.35 2.2e-14
UNIPROTKB|Q5FWU5541 Znf513 "Zinc finger protein 51 0.622 0.192 0.35 2.2e-14
UNIPROTKB|E1B7S0542 ZNF513 "Uncharacterized protei 0.622 0.191 0.35 2.2e-14
UNIPROTKB|E2RFE2543 ZNF513 "Uncharacterized protei 0.622 0.191 0.35 2.2e-14
UNIPROTKB|E1BQQ6 947 ZNF507 "Uncharacterized protei 0.275 0.048 0.456 4.9e-14
UNIPROTKB|E7EUE3 613 CTCFL "Transcriptional repress 0.850 0.231 0.291 1.2e-13
UNIPROTKB|F1NUB6 ZNF513 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 190 (71.9 bits), Expect = 5.4e-15, P = 5.4e-15
 Identities = 41/120 (34%), Positives = 65/120 (54%)

Query:    44 YGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSC 103
             + C  C + T+  N+L +H+  H+GEKPF+        C  C  Y S+ + +L  H +  
Sbjct:    27 FACSLCPFVTHYPNHLARHMKTHSGEKPFA--------CPLC-PYASAHLDNLKRHQRVH 77

Query:   104 SHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHM 163
             +   +P      + C  C+Y      N+K H R+H  DKP++CSLC+Y C Q+++LK HM
Sbjct:    78 TG-EKP------YKCQLCDYACGNLANLKRHGRIHSGDKPFQCSLCSYSCNQSMNLKRHM 130


GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
ZFIN|ZDB-GENE-110914-29 si:ch211-245n8.2 "si:ch211-245n8.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N8E2 ZNF513 "Zinc finger protein 513" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2141255 Zfp513 "zinc finger protein 513" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1310456 Zfp513 "zinc finger protein 513" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q5FWU5 Znf513 "Zinc finger protein 513" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7S0 ZNF513 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFE2 ZNF513 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BQQ6 ZNF507 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E7EUE3 CTCFL "Transcriptional repressor CTCFL" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 167
KOG2462|consensus279 99.97
KOG2462|consensus279 99.89
KOG1074|consensus 958 99.77
KOG1074|consensus958 99.75
KOG3608|consensus467 99.71
KOG3608|consensus 467 99.7
KOG3576|consensus267 99.69
KOG3576|consensus267 99.63
KOG3623|consensus 1007 99.63
KOG3623|consensus1007 99.43
PLN03086567 PRLI-interacting factor K; Provisional 99.27
PHA00733128 hypothetical protein 99.22
PHA0276855 hypothetical protein; Provisional 99.12
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.98
PLN03086567 PRLI-interacting factor K; Provisional 98.96
PHA00733128 hypothetical protein 98.94
KOG3993|consensus500 98.9
PHA0276855 hypothetical protein; Provisional 98.71
PHA0073279 hypothetical protein 98.51
PHA0061644 hypothetical protein 98.47
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.37
PHA0061644 hypothetical protein 98.29
KOG3993|consensus 500 98.26
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.23
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.19
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.18
PHA0073279 hypothetical protein 98.12
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.07
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.02
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.81
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.69
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.6
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.5
COG5189423 SFP1 Putative transcriptional repressor regulating 97.47
smart0035526 ZnF_C2H2 zinc finger. 97.41
PRK04860160 hypothetical protein; Provisional 97.38
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.27
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.23
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.15
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.06
COG5189423 SFP1 Putative transcriptional repressor regulating 97.05
smart0035526 ZnF_C2H2 zinc finger. 96.99
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.95
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.91
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 96.62
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.47
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.59
COG5048467 FOG: Zn-finger [General function prediction only] 95.54
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.52
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.09
PRK04860160 hypothetical protein; Provisional 94.91
KOG2231|consensus 669 94.58
KOG2893|consensus 341 93.77
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 93.53
COG404965 Uncharacterized protein containing archaeal-type C 92.93
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 92.92
PHA0062659 hypothetical protein 92.27
COG5048 467 FOG: Zn-finger [General function prediction only] 92.02
KOG2231|consensus 669 91.8
KOG2482|consensus 423 91.33
KOG1146|consensus 1406 91.02
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 91.01
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 90.92
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 90.2
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 90.16
COG1592166 Rubrerythrin [Energy production and conversion] 89.71
PF1371937 zinc_ribbon_5: zinc-ribbon domain 89.68
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 89.18
PRK00464 154 nrdR transcriptional regulator NrdR; Validated 88.99
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 88.92
PF1371736 zinc_ribbon_4: zinc-ribbon domain 88.33
KOG1146|consensus1406 87.91
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 86.68
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 86.68
PRK0967872 DNA-binding transcriptional regulator; Provisional 85.99
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 85.99
PRK00464154 nrdR transcriptional regulator NrdR; Validated 85.83
smart00531147 TFIIE Transcription initiation factor IIE. 85.35
COG5236 493 Uncharacterized conserved protein, contains RING Z 85.35
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 85.06
PF09986214 DUF2225: Uncharacterized protein conserved in bact 85.0
KOG2893|consensus 341 84.53
PF09845131 DUF2072: Zn-ribbon containing protein (DUF2072); I 84.11
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 83.45
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 82.74
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 82.54
COG1592166 Rubrerythrin [Energy production and conversion] 82.33
COG404965 Uncharacterized protein containing archaeal-type C 82.03
PF0217660 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 81.72
PF0879028 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IP 80.9
KOG2482|consensus423 80.31
>KOG2462|consensus Back     alignment and domain information
Probab=99.97  E-value=6.1e-31  Score=181.89  Aligned_cols=134  Identities=23%  Similarity=0.346  Sum_probs=125.5

Q ss_pred             CcccccccccccCchHHHHHHhhhhhccccCCCC---CccceecCccCccccChHHHHHHHHHhhCCCCCCcccccCccc
Q psy4421           6 NINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDS---FKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYC   82 (167)
Q Consensus         6 ~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~---~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~~~~~~c   82 (167)
                      .-|.|.+|++.+...++|.        +|.++|-   .++.+.|.+|++.+.+...|..|+++|+  .+.+        |
T Consensus       129 ~r~~c~eCgk~ysT~snLs--------rHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~--------C  190 (279)
T KOG2462|consen  129 PRYKCPECGKSYSTSSNLS--------RHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCE--------C  190 (279)
T ss_pred             Cceeccccccccccccccc--------hhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcc--------c
Confidence            4589999999999999999        8888773   3677999999999999999999999998  4777        9


Q ss_pred             ccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHH
Q psy4421          83 IHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSH  162 (167)
Q Consensus        83 ~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H  162 (167)
                      .+||+. |+....|.-|+++       ++||+||.|+.|++.|..+++|+.|+++|.+.|+|.|..|+|+|...+.|.+|
T Consensus       191 ~iCGKa-FSRPWLLQGHiRT-------HTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH  262 (279)
T KOG2462|consen  191 GICGKA-FSRPWLLQGHIRT-------HTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKH  262 (279)
T ss_pred             cccccc-ccchHHhhccccc-------ccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHh
Confidence            999999 9999999999999       99999999999999999999999999999999999999999999999999999


Q ss_pred             hhh
Q psy4421         163 MKS  165 (167)
Q Consensus       163 ~~~  165 (167)
                      ..+
T Consensus       263 ~ES  265 (279)
T KOG2462|consen  263 SES  265 (279)
T ss_pred             hhh
Confidence            864



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK09678 DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09845 DUF2072: Zn-ribbon containing protein (DUF2072); InterPro: IPR018645 This archaeal Zinc-ribbon containing proteins have no known function Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>PF02176 zf-TRAF: TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A Back     alignment and domain information
>PF08790 zf-LYAR: LYAR-type C2HC zinc finger ; InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-08
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-06
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 8e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 4e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 55.5 bits (132), Expect = 1e-08, Method: Compositional matrix adjust. Identities = 36/122 (29%), Positives = 49/122 (40%), Gaps = 16/122 (13%) Query: 44 YGCYRCSYFTYESNNLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSC 103 Y C C S++L +H HTGEKP+ C C S D KDL H Sbjct: 22 YACPECGKSFSRSDHLAEHQRTHTGEKPYK--------CPECGKSFS-DKKDLTRH---- 68 Query: 104 SHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHM 163 R + C C + N++ H R H +KPY C C Q HL++H Sbjct: 69 ---QRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQ 125 Query: 164 KS 165 ++ Sbjct: 126 RT 127
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query167
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-08
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 5e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 8e-04
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
 Score = 47.5 bits (114), Expect = 3e-08
 Identities = 16/112 (14%), Positives = 29/112 (25%), Gaps = 46/112 (41%)

Query: 58  NLKKHILKHTGEKPFSYMYENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFV 117
           +       H+GEKP+         C  C+                 +             
Sbjct: 2   SSGSSGRTHSGEKPYE--------CYICH--------------ARFTQ------------ 27

Query: 118 CYACEYNTYMSGNIKTHLRLHL--DDKPYKCSLCNYECRQNVHLKSHMKSNH 167
                     SG +K H+      +   + C  C+    +   L  H++  H
Sbjct: 28  ----------SGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQH 69


>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.98
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.94
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.93
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.92
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.92
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.91
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.9
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.88
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.82
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.81
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.8
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.8
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.79
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.79
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.79
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.79
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.78
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.78
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.78
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.76
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.76
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.74
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.73
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.69
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.66
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.66
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.65
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.65
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.64
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.64
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.63
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.62
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.61
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.61
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.61
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.6
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.6
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.6
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.6
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.59
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.59
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.59
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.59
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.58
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.57
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.57
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.55
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.55
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.54
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.52
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.51
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.5
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.5
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.5
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.49
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.47
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.46
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.43
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.43
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.4
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.39
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.37
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.37
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.37
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.31
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.31
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.31
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.31
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.31
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.3
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.29
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.29
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.29
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.29
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.29
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.28
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.28
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.28
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.28
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.28
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.28
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.28
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.28
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.27
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.27
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.27
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.27
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.27
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.27
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.27
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.26
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.26
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.26
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.26
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.26
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.26
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.26
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.26
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.26
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.25
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.25
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.25
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.25
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.25
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.25
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.25
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.25
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.25
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.25
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.24
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.24
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.24
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.24
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.24
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.23
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.23
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.23
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.22
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.21
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.2
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.2
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.19
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.18
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.18
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.18
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.16
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.16
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.16
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.14
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.14
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.14
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.14
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.12
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.12
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.12
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.12
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.12
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.12
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.11
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.11
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.11
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.11
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.1
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.1
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.1
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.1
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.1
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.1
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.09
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.06
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.05
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.04
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.03
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.03
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.03
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.01
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.98
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.97
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.95
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.94
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.94
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.94
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.89
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.89
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.85
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.85
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.83
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.79
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.78
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.76
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.76
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.74
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.72
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.71
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.69
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.69
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.68
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.67
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.66
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.65
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.65
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.64
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.64
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.62
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.62
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.59
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.58
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.58
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.57
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.56
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.53
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.5
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.49
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.49
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.47
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.45
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.43
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.81
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.43
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.42
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.41
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.4
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.4
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.4
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.4
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.39
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.39
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.38
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.37
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.37
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.37
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.36
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.35
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.33
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.33
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.32
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.32
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.65
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.28
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.27
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.27
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.58
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.26
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.57
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.57
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.24
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.21
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.2
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.19
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.29
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.93
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.93
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.43
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.18
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.69
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.46
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.33
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.05
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.66
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.56
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 94.38
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 93.84
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 93.14
2k5c_A95 Uncharacterized protein PF0385; structural genomic 92.71
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.11
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 90.09
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 90.01
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 89.95
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 87.26
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 87.15
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 85.67
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 83.63
3h0g_L63 DNA-directed RNA polymerases I, II, and III subuni 83.56
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 81.6
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.54
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 81.09
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=1.4e-33  Score=192.64  Aligned_cols=150  Identities=24%  Similarity=0.449  Sum_probs=99.5

Q ss_pred             CCcCCcccccccccccCchHHHHHHhhhhhccccCCCCCccceecCccCccccChHHHHHHHHHhhCCCCCCccc-----
Q psy4421           2 QESLNINQCVHCHLTLTKSTEVIVKHAQTCISMVRPDSFKYKYGCYRCSYFTYESNNLKKHILKHTGEKPFSYMY-----   76 (167)
Q Consensus         2 ~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~h~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~~~~-----   76 (167)
                      +++++||.|+.|++.|.....|.        .|++.|.++++|.|+.|++.|.....|..|++.|.++++|.|..     
T Consensus        16 ~~~~~~~~C~~C~~~f~~~~~l~--------~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f   87 (190)
T 2i13_A           16 EPGEKPYACPECGKSFSRSDHLA--------EHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSF   87 (190)
T ss_dssp             ---------------CCSSHHHH--------HGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEE
T ss_pred             cCCCCCCcCCCCccccCCHHHHH--------HHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCCcc
Confidence            45677777777777777777777        77777777777777777777777777777777777777766432     


Q ss_pred             ---------------ccCcccccccccccCChHHHHHHHhhcCCCCCCCCCCCcccCCCCCccccCchhHHHHHhhhCCC
Q psy4421          77 ---------------ENQQYCIHCNSYISSDIKDLIEHCKSCSHMTRPDAFHFKFVCYACEYNTYMSGNIKTHLRLHLDD  141 (167)
Q Consensus        77 ---------------~~~~~c~~c~~~~~~~~~~l~~h~~~~~~~~~~~~~~~~~~C~~C~~~~~~~~~l~~H~~~h~~~  141 (167)
                                     +....|+.|++. |.+...|..|+.+       +.++++|.|++|++.|.....|..|+++|.++
T Consensus        88 ~~~~~l~~H~~~h~~~~~~~C~~C~~~-f~~~~~l~~H~~~-------h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~  159 (190)
T 2i13_A           88 SQRANLRAHQRTHTGEKPYACPECGKS-FSQLAHLRAHQRT-------HTGEKPYKCPECGKSFSREDNLHTHQRTHTGE  159 (190)
T ss_dssp             SCHHHHHHHHHHHHTCCCEECTTTCCE-ESSHHHHHHHHHH-------HHCCCCEECTTTCCEESCHHHHHHHHHHHHCC
T ss_pred             CCHHHHHHHHHhcCCCCCCcCCCCCCc-cCCHHHHHHHHHH-------hCCCCCeECCCCCcccCCHHHHHHHHHhcCCC
Confidence                           122347777777 7777777777777       77778888888888888888888888888888


Q ss_pred             CceeCCCCcccccCchhHHHHhhhcC
Q psy4421         142 KPYKCSLCNYECRQNVHLKSHMKSNH  167 (167)
Q Consensus       142 ~~~~C~~C~~~f~~~~~l~~H~~~hh  167 (167)
                      ++|.|+.|++.|.....|..|+++|+
T Consensus       160 ~~~~C~~C~~~f~~~~~L~~H~~~H~  185 (190)
T 2i13_A          160 KPYKCPECGKSFSRRDALNVHQRTHT  185 (190)
T ss_dssp             CCEECTTTCCEESSHHHHHHHHTTC-
T ss_pred             CCeECCCCCCccCCHHHHHHHHHhcC
Confidence            88888888888888888888888764



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>3h0g_L DNA-directed RNA polymerases I, II, and III subunit rpabc4; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 167
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.003
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.004
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.004
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Transcriptional repressor CTCF
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 32.6 bits (75), Expect = 0.001
 Identities = 11/32 (34%), Positives = 18/32 (56%)

Query: 136 RLHLDDKPYKCSLCNYECRQNVHLKSHMKSNH 167
           R H  +KPY+C +C+    Q+  +K H+   H
Sbjct: 1   RTHSGEKPYECYICHARFTQSGTMKMHILQKH 32


>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query167
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.77
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.65
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.39
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.39
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.34
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.34
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.33
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.31
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.27
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.27
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.22
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.17
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.16
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.16
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.13
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.11
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.1
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.09
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.09
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.09
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.07
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.03
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.01
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.0
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.94
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.87
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.81
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.81
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.8
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.75
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.74
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.73
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.69
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.67
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.57
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.5
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.45
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.37
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.36
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.24
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.17
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.17
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.14
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.13
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.12
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.11
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 98.06
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.03
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.98
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.96
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.92
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.91
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.85
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.8
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.78
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.78
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.6
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.57
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.57
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.57
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.54
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.53
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.52
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.51
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.47
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.43
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.41
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.4
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.4
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.37
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.36
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.29
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.25
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.14
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.13
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.1
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.91
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.9
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.82
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.82
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.79
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.78
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.76
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.64
d1y0jb136 U-shaped transcription factor, different fingers { 96.49
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.45
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.31
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.27
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.01
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 95.72
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.66
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 95.53
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.25
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 95.22
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 95.18
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.42
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 94.36
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.98
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 93.96
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 93.69
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 93.18
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 93.01
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.86
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.84
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.6
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.4
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.05
d1y0jb136 U-shaped transcription factor, different fingers { 91.77
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 91.64
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 89.33
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 89.09
d1fu9a_36 U-shaped transcription factor, different fingers { 88.98
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.78
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 88.44
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.77
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 84.06
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 83.09
d2czra1218 TBP-interacting protein {Thermococcus kodakaraensi 82.84
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 82.07
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 81.68
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 80.75
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 80.42
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 80.4
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.77  E-value=2.1e-19  Score=95.88  Aligned_cols=53  Identities=26%  Similarity=0.587  Sum_probs=51.1

Q ss_pred             CCcccCCCCCccccCchhHHHHHhhhCCCCceeCCCCcccccCchhHHHHhhhc
Q psy4421         113 HFKFVCYACEYNTYMSGNIKTHLRLHLDDKPYKCSLCNYECRQNVHLKSHMKSN  166 (167)
Q Consensus       113 ~~~~~C~~C~~~~~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  166 (167)
                      |+||.| .||+.|....+|..|+++|.|++||.|.+||++|.+.++|..|+++|
T Consensus         1 EK~y~C-~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC-QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC-TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC-CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            589999 59999999999999999999999999999999999999999999986



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure