Psyllid ID: psy4449
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 2417 | 2.2.26 [Sep-21-2011] | |||||||
| Q9W5U2 | 2286 | Probable chitinase 3 OS=D | yes | N/A | 0.249 | 0.264 | 0.558 | 0.0 | |
| Q28542 | 539 | Oviduct-specific glycopro | N/A | N/A | 0.143 | 0.643 | 0.404 | 3e-76 | |
| Q13231 | 466 | Chitotriosidase-1 OS=Homo | yes | N/A | 0.170 | 0.884 | 0.352 | 1e-75 | |
| Q60557 | 671 | Oviduct-specific glycopro | N/A | N/A | 0.146 | 0.529 | 0.389 | 1e-75 | |
| Q95M17 | 472 | Acidic mammalian chitinas | yes | N/A | 0.146 | 0.75 | 0.408 | 2e-75 | |
| Q6RY07 | 473 | Acidic mammalian chitinas | no | N/A | 0.178 | 0.911 | 0.375 | 2e-75 | |
| Q28042 | 537 | Oviduct-specific glycopro | no | N/A | 0.143 | 0.646 | 0.399 | 4e-75 | |
| Q62010 | 721 | Oviduct-specific glycopro | yes | N/A | 0.144 | 0.484 | 0.387 | 3e-74 | |
| Q9D7Q1 | 464 | Chitotriosidase-1 OS=Mus | no | N/A | 0.173 | 0.903 | 0.348 | 3e-74 | |
| Q91XA9 | 473 | Acidic mammalian chitinas | no | N/A | 0.178 | 0.911 | 0.360 | 5e-74 |
| >sp|Q9W5U2|CHIT3_DROME Probable chitinase 3 OS=Drosophila melanogaster GN=Cht3 PE=2 SV=2 | Back alignment and function desciption |
|---|
Score = 745 bits (1923), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 355/636 (55%), Positives = 451/636 (70%), Gaps = 32/636 (5%)
Query: 1710 EFKIVCYFTNWAWYRQSGGKYLPSDIDSDLCTHVIYGFAVLDTDQLVIKPHDTWADLDNK 1769
EFKI+CYFTNWAWYRQ GGK+LP DIDSDLCTH+IYGFAVL D L I+PHD+WADLDNK
Sbjct: 1408 EFKIICYFTNWAWYRQGGGKFLPEDIDSDLCTHIIYGFAVLSRDNLTIQPHDSWADLDNK 1467
Query: 1770 FYEKVTALKKKGVKVTLAIGGWNDSAGNKYSRLVNSQQARSKFIAHVVNFILEHNFDGLD 1829
FYE++ A +KKG KVT+AIGGWNDSAG+KYSRLV + +ARS+FI +V++FI E+NFDGLD
Sbjct: 1468 FYERIVAYRKKGAKVTVAIGGWNDSAGDKYSRLVRNPEARSRFIRNVLDFIEEYNFDGLD 1527
Query: 1830 LDWEYPKCWQVDCKQGPASDKQGFADLIKELRAAFNPHDLLLSAAVSPSKAVIDNAYDIP 1889
LDWEYP CWQVDCK+G A +K GF+ L++EL AF P L+LSAAVSP+K VID Y++
Sbjct: 1528 LDWEYPVCWQVDCKKGTAEEKIGFSALVRELFYAFQPRGLILSAAVSPNKKVIDAGYEVA 1587
Query: 1890 VMSENLDWISVMTYDYHGQWDKKTGHVAPMYALPNDTTPTFNANYSLHYWVSHGADRKKV 1949
+S WISVM YDYHGQWDKKTGHVAPMY+ P + T FNAN+S++YW+S GADR+K+
Sbjct: 1588 ELSHYFSWISVMAYDYHGQWDKKTGHVAPMYSHP-EGTANFNANFSMNYWISMGADRRKL 1646
Query: 1950 IFGMPMYGQSFTLADKNKNGLNSQTYGGAEAGENTRARGFLAYYEICDKIQKDGWVVVRD 2009
+ G+P+YGQSF+LA+ K+ LN+ TYGG EAGE TRARGFLAYYEIC KI+ W VVRD
Sbjct: 1647 VMGIPLYGQSFSLAETTKHQLNAPTYGGGEAGEATRARGFLAYYEICLKIRHHRWNVVRD 1706
Query: 2010 RKRRIGPYAFKGDQWVGFDDQAMIHHKAEFVKYNDLGGAMIWALDLDDFKNFCGCESYPL 2069
K RIGP+A+ GDQWV FDD MI HK+E++K LGGAMIWALDLDDFKN C CESYPL
Sbjct: 1707 TKGRIGPFAYHGDQWVSFDDVPMIRHKSEYIKAMGLGGAMIWALDLDDFKNVCECESYPL 1766
Query: 2070 LKTINRVLRNYPGPGPNCFL-------KP-VPPKHEDNVPQTTGTQYEEDETLSDDTIVI 2121
LK INRVLR + GP P C L KP + P + +G + + +
Sbjct: 1767 LKAINRVLRGFGGPQPKCLLENPKSTMKPNIKPPFRPTINAPSGPNLDS----PTQNVSL 1822
Query: 2122 DSKSNRCNRTGELYQHEGDCAKFASCENGLIKIYDCPPGLHFN-----FVRAFYTHIESK 2176
+ S +C+ L HE DC K+ CE+G CP GL +N + + + S
Sbjct: 1823 NVLSIKCHSKNYL-AHEWDCTKYYICEHGTYVERSCPLGLQWNKTYCDWPTNVQSSLGSN 1881
Query: 2177 QSNQQEQIRYAEP-------------YKVICYYTSWAYLRQAEGKYSPEDIDGSLCTHLV 2223
Q Q+ + P YKV+CY+TSWA+ R ++GK+ PEDID +LCTHL+
Sbjct: 1882 QRTQEPAVHRPNPTSVITEPPIINNSYKVVCYFTSWAWYRSSQGKFVPEDIDANLCTHLI 1941
Query: 2224 YAFADLDEQELVIRSHNNKLDLEQGFYEKITKFNERGIQVILAIGGWSDSRSDKYSRLVN 2283
Y FA LD + L I++H++ D++ FYE++ ++ +RG++V+LAIGGW+DS KY+RLV
Sbjct: 1942 YGFAVLDSKSLTIKTHDSWTDIDNRFYERVVEYKQRGLRVMLAIGGWNDSLGSKYARLVL 2001
Query: 2284 DIPARRNFVRHVTEFLEFYGFNGLEFAWEYPKCWQT 2319
+ +RR FV V FLE +GF GL+ AWE+P CWQ
Sbjct: 2002 NSQSRRRFVASVISFLEQHGFEGLDLAWEFPVCWQV 2037
|
Drosophila melanogaster (taxid: 7227) EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 4 |
| >sp|Q28542|OVGP1_SHEEP Oviduct-specific glycoprotein OS=Ovis aries GN=OVGP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q13231|CHIT1_HUMAN Chitotriosidase-1 OS=Homo sapiens GN=CHIT1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q60557|OVGP1_MESAU Oviduct-specific glycoprotein OS=Mesocricetus auratus GN=OVGP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q95M17|CHIA_BOVIN Acidic mammalian chitinase OS=Bos taurus GN=CHIA PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q6RY07|CHIA_RAT Acidic mammalian chitinase OS=Rattus norvegicus GN=Chia PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q28042|OVGP1_BOVIN Oviduct-specific glycoprotein (Fragment) OS=Bos taurus GN=OVGP1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q62010|OVGP1_MOUSE Oviduct-specific glycoprotein OS=Mus musculus GN=Ovgp1 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9D7Q1|CHIT1_MOUSE Chitotriosidase-1 OS=Mus musculus GN=Chit1 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q91XA9|CHIA_MOUSE Acidic mammalian chitinase OS=Mus musculus GN=Chia PE=1 SV=2 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2417 | ||||||
| 110624800 | 2700 | chitinase 10 precursor [Tribolium castan | 0.257 | 0.230 | 0.559 | 0.0 | |
| 270014040 | 2712 | hypothetical protein TcasGA2_TC012734 [T | 0.257 | 0.229 | 0.559 | 0.0 | |
| 21038943 | 2838 | chitinase [Tenebrio molitor] | 0.275 | 0.235 | 0.516 | 0.0 | |
| 170286895 | 2828 | chitinase [Monochamus alternatus] | 0.257 | 0.219 | 0.538 | 0.0 | |
| 170286893 | 2901 | chitinase [Monochamus alternatus] | 0.254 | 0.211 | 0.537 | 0.0 | |
| 198476020 | 2487 | GA25359 [Drosophila pseudoobscura pseudo | 0.300 | 0.292 | 0.487 | 0.0 | |
| 195434503 | 2431 | GK14769 [Drosophila willistoni] gi|19416 | 0.299 | 0.297 | 0.480 | 0.0 | |
| 116007452 | 2286 | chitinase 3, isoform A [Drosophila melan | 0.249 | 0.264 | 0.558 | 0.0 | |
| 194877596 | 2102 | GG21384 [Drosophila erecta] gi|190657093 | 0.291 | 0.335 | 0.494 | 0.0 | |
| 195476481 | 2311 | GE17254 [Drosophila yakuba] gi|194185813 | 0.250 | 0.261 | 0.554 | 0.0 |
| >gi|110624800|ref|NP_001036067.1| chitinase 10 precursor [Tribolium castaneum] gi|109895312|gb|ABG47448.1| chitinase 10 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 762 bits (1968), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 369/660 (55%), Positives = 459/660 (69%), Gaps = 37/660 (5%)
Query: 1687 TTTVKPKPTTVKPKPVIPPSTKDEFKIVCYFTNWAWYRQSGGKYLPSDIDSDLCTHVIYG 1746
++TV P P + ++ P K EFK+VCYFTNWAWYRQ GKYLPSDID DLCTH++YG
Sbjct: 1801 SSTVVPPPQHSTTQSLVDP--KSEFKVVCYFTNWAWYRQGVGKYLPSDIDPDLCTHIVYG 1858
Query: 1747 FAVLDTDQLVIKPHDTWADLDNKFYEKVTALKKKGVKVTLAIGGWNDSAGNKYSRLVNSQ 1806
FAVL+ DQL+IKPHDTWAD DNKFYEKVTA K KG+KV +AIGGWNDSAG+KYSRLVN+
Sbjct: 1859 FAVLNGDQLIIKPHDTWADFDNKFYEKVTAYKSKGIKVLVAIGGWNDSAGDKYSRLVNNP 1918
Query: 1807 QARSKFIAHVVNFILEHNFDGLDLDWEYPKCWQVDCKQGPASDKQGFADLIKELRAAFNP 1866
AR +FIAHVV+FI +NFDGLDLDWEYPKCWQVDC +GPASDK FAD +KEL AF P
Sbjct: 1919 SARRRFIAHVVDFIETNNFDGLDLDWEYPKCWQVDCNKGPASDKSAFADFVKELHEAFKP 1978
Query: 1867 HDLLLSAAVSPSKAVIDNAYDIPVMSENLDWISVMTYDYHGQWDKKTGHVAPMYALPNDT 1926
LLSAAVSPS+ V+D YD+P +S+ LDWI+VM YDYHGQWDK TGHVAPMYA P D
Sbjct: 1979 KGWLLSAAVSPSRRVVDAGYDVPTLSKYLDWIAVMCYDYHGQWDKITGHVAPMYAHPEDA 2038
Query: 1927 TPTFNANYSLHYWVSHGADRKKVIFGMPMYGQSFTLADKNKNGLNSQTYGGAEAGENTRA 1986
TFN N+++HYW+ GADR+K++ GMPMYGQSF+LAD N+NGLN+ TYGG EAGE TRA
Sbjct: 2039 DATFNTNFTIHYWIEKGADRRKLVMGMPMYGQSFSLADNNQNGLNAATYGGGEAGEETRA 2098
Query: 1987 RGFLAYYEICDKIQKDGWVVVRDRKRRIGPYAFKGDQWVGFDDQAMIHHKAEFVKYNDLG 2046
RGFLAYYEIC + K GW VVRDR+ RIGPYA+ DQWV FDD MI HK+EF+K LG
Sbjct: 2099 RGFLAYYEICTNVIKKGWKVVRDRRGRIGPYAYLRDQWVSFDDIGMIRHKSEFIKAMGLG 2158
Query: 2047 GAMIWALDLDDFKNFCGCESYPLLKTINRVLRNYPGPGPNCFL---KPVPPKHEDNVPQT 2103
G MIWALDLDDFKN CGCE YPLL+TINRVLR Y P P C L + T
Sbjct: 2159 GGMIWALDLDDFKNLCGCEEYPLLRTINRVLRGYAKPDPKCILGRDNDKTKPKPTTMKPT 2218
Query: 2104 TGTQYEEDETLSDDTIVIDSKSNRCNRTGELY-QHEGDCAKFASCENGLIKIYDCPPGL- 2161
T YE E V+ ++ C G L+ + +CA++ C G +++ CP GL
Sbjct: 2219 TTIGYEPQEP------VLPAEVVPCQ--GRLFVADDTNCAQYYLCNQGQLQLQVCPNGLF 2270
Query: 2162 ----HFNFVRAFYTHIESKQ------------------SNQQEQIRYAEPYKVICYYTSW 2199
H ++ H ++ +++ ++ YKV+CY+T+W
Sbjct: 2271 WNKDHCDWPENTECHPDASSTMAPSTTPMVPDKPVTTTTSRPIGTDTSDDYKVVCYFTNW 2330
Query: 2200 AYLRQAEGKYSPEDIDGSLCTHLVYAFADLDEQELVIRSHNNKLDLEQGFYEKITKFNER 2259
A+ RQ +GKY P DID SLCTH+ Y FA LD + ++ H++ D++ FY+K+ + R
Sbjct: 2331 AWYRQGDGKYLPSDIDPSLCTHINYGFAVLDSSSMTLKPHDSWADIDNEFYKKVVSYKSR 2390
Query: 2260 GIQVILAIGGWSDSRSDKYSRLVNDIPARRNFVRHVTEFLEFYGFNGLEFAWEYPKCWQT 2319
G++V++A+GGW+DS +KYSRLVND AR F+ HV F+E + F+GL+ WEYPKCWQ
Sbjct: 2391 GVKVLIALGGWNDSAGNKYSRLVNDPQARAAFIAHVLAFIEEWNFDGLDLDWEYPKCWQV 2450
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270014040|gb|EFA10488.1| hypothetical protein TcasGA2_TC012734 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|21038943|emb|CAD31740.4| chitinase [Tenebrio molitor] | Back alignment and taxonomy information |
|---|
| >gi|170286895|dbj|BAG13449.1| chitinase [Monochamus alternatus] | Back alignment and taxonomy information |
|---|
| >gi|170286893|dbj|BAG13448.1| chitinase [Monochamus alternatus] | Back alignment and taxonomy information |
|---|
| >gi|198476020|ref|XP_002132239.1| GA25359 [Drosophila pseudoobscura pseudoobscura] gi|198137511|gb|EDY69641.1| GA25359 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|195434503|ref|XP_002065242.1| GK14769 [Drosophila willistoni] gi|194161327|gb|EDW76228.1| GK14769 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|116007452|ref|NP_001036422.1| chitinase 3, isoform A [Drosophila melanogaster] gi|442628917|ref|NP_001260697.1| chitinase 3, isoform B [Drosophila melanogaster] gi|442628919|ref|NP_001260698.1| chitinase 3, isoform C [Drosophila melanogaster] gi|215273952|sp|Q9W5U2.2|CHIT3_DROME RecName: Full=Probable chitinase 3; AltName: Full=Probable chitinase 1; Flags: Precursor gi|30923533|gb|EAA46011.1| chitinase 3, isoform A [Drosophila melanogaster] gi|60678027|gb|AAX33520.1| LP05745p [Drosophila melanogaster] gi|440214072|gb|AGB93232.1| chitinase 3, isoform B [Drosophila melanogaster] gi|440214073|gb|AGB93233.1| chitinase 3, isoform C [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194877596|ref|XP_001973906.1| GG21384 [Drosophila erecta] gi|190657093|gb|EDV54306.1| GG21384 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195476481|ref|XP_002086146.1| GE17254 [Drosophila yakuba] gi|194185813|gb|EDW99424.1| GE17254 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 2417 | ||||||
| FB|FBgn0250907 | 2286 | Cht3 "Chitinase 3" [Drosophila | 0.195 | 0.206 | 0.6 | 0.0 | |
| FB|FBgn0035398 | 1013 | Cht7 "Cht7" [Drosophila melano | 0.146 | 0.349 | 0.413 | 5.1e-115 | |
| UNIPROTKB|G3H3K7 | 719 | I79_004795 "Chitinase-3-like p | 0.230 | 0.776 | 0.331 | 4.6e-108 | |
| UNIPROTKB|E2R8B1 | 483 | CHIA "Uncharacterized protein" | 0.181 | 0.906 | 0.364 | 7.6e-76 | |
| FB|FBgn0263132 | 4541 | Cht6 "Cht6" [Drosophila melano | 0.157 | 0.083 | 0.39 | 4.1e-75 | |
| UNIPROTKB|E1BZP3 | 473 | CHIA "Uncharacterized protein" | 0.177 | 0.909 | 0.370 | 3.5e-73 | |
| UNIPROTKB|E1BZP6 | 480 | CHIA "Uncharacterized protein" | 0.180 | 0.908 | 0.367 | 2.4e-74 | |
| UNIPROTKB|F1NM31 | 479 | CHIA "Uncharacterized protein" | 0.180 | 0.910 | 0.367 | 2.4e-74 | |
| RGD|1303058 | 473 | Chia "chitinase, acidic" [Ratt | 0.178 | 0.911 | 0.379 | 4.9e-74 | |
| ZFIN|ZDB-GENE-071004-113 | 481 | chia.5 "chitinase, acidic.5" [ | 0.177 | 0.889 | 0.367 | 6.3e-74 |
| FB|FBgn0250907 Cht3 "Chitinase 3" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1547 (549.6 bits), Expect = 0., Sum P(9) = 0.
Identities = 288/480 (60%), Positives = 352/480 (73%)
Query: 1710 EFKIVCYFTNWAWYRQSGGKYLPSDIDSDLCTHVIYGFAVLDTDQLVIKPHDTWADLDNK 1769
EFKI+CYFTNWAWYRQ GGK+LP DIDSDLCTH+IYGFAVL D L I+PHD+WADLDNK
Sbjct: 1408 EFKIICYFTNWAWYRQGGGKFLPEDIDSDLCTHIIYGFAVLSRDNLTIQPHDSWADLDNK 1467
Query: 1770 FYEKVTALKKKGVKVTLAIGGWNDSAGNKYSRLVNSQQARSKFIAHVVNFILEHNFDGLD 1829
FYE++ A +KKG KVT+AIGGWNDSAG+KYSRLV + +ARS+FI +V++FI E+NFDGLD
Sbjct: 1468 FYERIVAYRKKGAKVTVAIGGWNDSAGDKYSRLVRNPEARSRFIRNVLDFIEEYNFDGLD 1527
Query: 1830 LDWEYPKCWQVDCKQGPASDKQGFADLIKELRAAFNPHDLLLSAAVSPSKAVIDNAYDIP 1889
LDWEYP CWQVDCK+G A +K GF+ L++EL AF P L+LSAAVSP+K VID Y++
Sbjct: 1528 LDWEYPVCWQVDCKKGTAEEKIGFSALVRELFYAFQPRGLILSAAVSPNKKVIDAGYEVA 1587
Query: 1890 VMSENLDWISVMTYDYHGQWDKKTGHVAPMYALPNDTTPTFNANYSLHYWVSHGADRKKV 1949
+S WISVM YDYHGQWDKKTGHVAPMY+ P T FNAN+S++YW+S GADR+K+
Sbjct: 1588 ELSHYFSWISVMAYDYHGQWDKKTGHVAPMYSHPEGTA-NFNANFSMNYWISMGADRRKL 1646
Query: 1950 IFGMPMYGQSFTLADKNKNGLNSQTYGGAEAGENTRARGFLAYYEICDKIQKDGWVVVRD 2009
+ G+P+YGQSF+LA+ K+ LN+ TYGG EAGE TRARGFLAYYEIC KI+ W VVRD
Sbjct: 1647 VMGIPLYGQSFSLAETTKHQLNAPTYGGGEAGEATRARGFLAYYEICLKIRHHRWNVVRD 1706
Query: 2010 RKRRIGPYAFKGDQWVGFDDQAMIHHKAEFVKYNDLGGAMIWALDLDDFKNFCGCESYPL 2069
K RIGP+A+ GDQWV FDD MI HK+E++K LGGAMIWALDLDDFKN C CESYPL
Sbjct: 1707 TKGRIGPFAYHGDQWVSFDDVPMIRHKSEYIKAMGLGGAMIWALDLDDFKNVCECESYPL 1766
Query: 2070 LKTINRVLRNYPGPGPNCFLKPVPPKHEDNV--PQTTGTQYEEDETLSDDT--IVIDSKS 2125
LK INRVLR + GP P C L+ + N+ P L T + ++ S
Sbjct: 1767 LKAINRVLRGFGGPQPKCLLENPKSTMKPNIKPPFRPTINAPSGPNLDSPTQNVSLNVLS 1826
Query: 2126 NRCNRTGELYQHEGDCAKFASCENGLIKIYDCPPGLHFNFVRAFY-THIESKQ-SNQQEQ 2183
+C+ L HE DC K+ CE+G CP GL +N + T+++S SNQ+ Q
Sbjct: 1827 IKCHSKNYL-AHEWDCTKYYICEHGTYVERSCPLGLQWNKTYCDWPTNVQSSLGSNQRTQ 1885
|
|
| FB|FBgn0035398 Cht7 "Cht7" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3H3K7 I79_004795 "Chitinase-3-like protein 1" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R8B1 CHIA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0263132 Cht6 "Cht6" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZP3 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BZP6 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NM31 CHIA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1303058 Chia "chitinase, acidic" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071004-113 chia.5 "chitinase, acidic.5" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 3.2.1 | 0.691 |
| 3rd Layer | 3.2.1.14 | LOW CONFIDENCE prediction! |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 2417 | |||
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-172 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 1e-119 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-117 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 1e-102 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-91 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 3e-88 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 5e-88 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 2e-70 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 4e-67 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 5e-67 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 4e-66 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 1e-58 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 1e-51 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 9e-51 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 3e-50 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 2e-48 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 2e-47 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 1e-46 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 1e-46 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 8e-46 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 1e-42 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 6e-42 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-40 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 3e-40 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 1e-38 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 5e-37 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 7e-34 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 6e-32 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 4e-30 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 2e-29 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 9e-29 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 2e-27 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 1e-26 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 2e-26 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 8e-26 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 1e-25 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 7e-24 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 2e-22 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 7e-22 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 7e-22 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 3e-20 | |
| cd06545 | 253 | cd06545, GH18_3CO4_chitinase, The Bacteroides thet | 5e-19 | |
| cd06545 | 253 | cd06545, GH18_3CO4_chitinase, The Bacteroides thet | 9e-18 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 1e-17 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 3e-16 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 1e-15 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 7e-15 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 4e-14 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 2e-13 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 5e-13 | |
| cd06542 | 255 | cd06542, GH18_EndoS-like, Endo-beta-N-acetylglucos | 2e-12 | |
| smart00636 | 334 | smart00636, Glyco_18, Glyco_18 domain | 2e-11 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 2e-11 | |
| cd02876 | 318 | cd02876, GH18_SI-CLP, Stabilin-1 interacting chiti | 2e-11 | |
| pfam00704 | 325 | pfam00704, Glyco_hydro_18, Glycosyl hydrolases fam | 3e-11 | |
| cd06545 | 253 | cd06545, GH18_3CO4_chitinase, The Bacteroides thet | 5e-11 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 1e-10 | |
| pfam01607 | 53 | pfam01607, CBM_14, Chitin binding Peritrophin-A do | 5e-10 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 2e-09 | |
| pfam01607 | 53 | pfam01607, CBM_14, Chitin binding Peritrophin-A do | 4e-09 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 5e-09 | |
| pfam01607 | 53 | pfam01607, CBM_14, Chitin binding Peritrophin-A do | 6e-09 | |
| smart00494 | 49 | smart00494, ChtBD2, Chitin-binding domain type 2 | 8e-09 | |
| smart00494 | 49 | smart00494, ChtBD2, Chitin-binding domain type 2 | 1e-08 | |
| cd02872 | 362 | cd02872, GH18_chitolectin_chitotriosidase, This co | 2e-08 | |
| smart00494 | 49 | smart00494, ChtBD2, Chitin-binding domain type 2 | 2e-08 | |
| cd06548 | 322 | cd06548, GH18_chitinase, The GH18 (glycosyl hydrol | 4e-08 | |
| cd02874 | 313 | cd02874, GH18_CFLE_spore_hydrolase, Cortical fragm | 4e-08 | |
| cd06542 | 255 | cd06542, GH18_EndoS-like, Endo-beta-N-acetylglucos | 1e-07 | |
| cd02876 | 318 | cd02876, GH18_SI-CLP, Stabilin-1 interacting chiti | 1e-07 | |
| cd02876 | 318 | cd02876, GH18_SI-CLP, Stabilin-1 interacting chiti | 3e-07 | |
| pfam01456 | 143 | pfam01456, Mucin, Mucin-like glycoprotein | 3e-07 | |
| cd02871 | 312 | cd02871, GH18_chitinase_D-like, GH18 domain of Chi | 3e-07 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 4e-07 | |
| pfam01456 | 143 | pfam01456, Mucin, Mucin-like glycoprotein | 8e-07 | |
| cd02875 | 358 | cd02875, GH18_chitobiase, Chitobiase (also known a | 2e-06 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 2e-06 | |
| cd06549 | 298 | cd06549, GH18_trifunctional, GH18 domain of an unc | 3e-06 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 5e-06 | |
| pfam01456 | 143 | pfam01456, Mucin, Mucin-like glycoprotein | 5e-06 | |
| cd02871 | 312 | cd02871, GH18_chitinase_D-like, GH18 domain of Chi | 6e-06 | |
| cd02873 | 413 | cd02873, GH18_IDGF, The IDGF's (imaginal disc grow | 1e-05 | |
| smart00494 | 49 | smart00494, ChtBD2, Chitin-binding domain type 2 | 1e-05 | |
| COG3858 | 423 | COG3858, COG3858, Predicted glycosyl hydrolase [Ge | 2e-05 | |
| pfam01456 | 143 | pfam01456, Mucin, Mucin-like glycoprotein | 3e-05 | |
| pfam01034 | 207 | pfam01034, Syndecan, Syndecan domain | 3e-05 | |
| cd02878 | 345 | cd02878, GH18_zymocin_alpha, Zymocin, alpha subuni | 4e-05 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 4e-05 | |
| cd06546 | 256 | cd06546, GH18_CTS3_chitinase, GH18 domain of CTS3 | 6e-05 | |
| pfam01607 | 53 | pfam01607, CBM_14, Chitin binding Peritrophin-A do | 7e-05 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 7e-05 | |
| pfam05539 | 408 | pfam05539, Pneumo_att_G, Pneumovirinae attachment | 9e-05 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 1e-04 | |
| COG3889 | 872 | COG3889, COG3889, Predicted solute binding protein | 1e-04 | |
| COG3087 | 264 | COG3087, FtsN, Cell division protein [Cell divisio | 1e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 1e-04 | |
| pfam01456 | 143 | pfam01456, Mucin, Mucin-like glycoprotein | 2e-04 | |
| pfam01299 | 305 | pfam01299, Lamp, Lysosome-associated membrane glyc | 2e-04 | |
| cd06549 | 298 | cd06549, GH18_trifunctional, GH18 domain of an unc | 3e-04 | |
| pfam05283 | 187 | pfam05283, MGC-24, Multi-glycosylated core protein | 4e-04 | |
| PHA03255 | 234 | PHA03255, PHA03255, BDLF3; Provisional | 4e-04 | |
| pfam01456 | 143 | pfam01456, Mucin, Mucin-like glycoprotein | 5e-04 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 5e-04 | |
| COG3325 | 441 | COG3325, ChiA, Chitinase [Carbohydrate transport a | 9e-04 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 9e-04 | |
| PRK13335 | 356 | PRK13335, PRK13335, superantigen-like protein; Rev | 9e-04 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 0.001 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.001 | |
| pfam05086 | 910 | pfam05086, Dicty_REP, Dictyostelium (Slime Mold) R | 0.001 | |
| cd02875 | 358 | cd02875, GH18_chitobiase, Chitobiase (also known a | 0.002 | |
| cd02875 | 358 | cd02875, GH18_chitobiase, Chitobiase (also known a | 0.002 | |
| pfam05109 | 830 | pfam05109, Herpes_BLLF1, Herpes virus major outer | 0.002 | |
| cd06546 | 256 | cd06546, GH18_CTS3_chitinase, GH18 domain of CTS3 | 0.002 | |
| COG3889 | 872 | COG3889, COG3889, Predicted solute binding protein | 0.002 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.002 | |
| PRK10905 | 328 | PRK10905, PRK10905, cell division protein DamX; Va | 0.002 | |
| pfam11489 | 671 | pfam11489, DUF3210, Protein of unknown function (D | 0.002 | |
| cd00598 | 210 | cd00598, GH18_chitinase-like, The GH18 (glycosyl h | 0.003 | |
| cd02879 | 299 | cd02879, GH18_plant_chitinase_class_V, The class V | 0.003 | |
| PHA03255 | 234 | PHA03255, PHA03255, BDLF3; Provisional | 0.003 | |
| PHA03255 | 234 | PHA03255, PHA03255, BDLF3; Provisional | 0.003 | |
| PRK12757 | 256 | PRK12757, PRK12757, cell division protein FtsN; Pr | 0.003 | |
| PRK14907 | 295 | PRK14907, rplD, 50S ribosomal protein L4; Provisio | 0.003 | |
| cd02875 | 358 | cd02875, GH18_chitobiase, Chitobiase (also known a | 0.004 | |
| COG3889 | 872 | COG3889, COG3889, Predicted solute binding protein | 0.004 |
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
Score = 531 bits (1370), Expect = e-172
Identities = 183/371 (49%), Positives = 240/371 (64%), Gaps = 15/371 (4%)
Query: 1713 IVCYFTNWAWYRQSGGKYLPSDIDSDLCTHVIYGFAVLDTDQLVIKPHDTWADLDNKFYE 1772
+VCYFTNWA YR GK++P +ID LCTH+IY FA L+ D +I D W D+D YE
Sbjct: 1 VVCYFTNWAQYRPGNGKFVPENIDPFLCTHIIYAFAGLNPDGNIIIL-DEWNDIDLGLYE 59
Query: 1773 KVTALKKK--GVKVTLAIGGWNDSAGNKYSRLVNSQQARSKFIAHVVNFILEHNFDGLDL 1830
+ ALK+K +K LAIGGWN + K+S + S + R FI + F+ ++ FDGLDL
Sbjct: 60 RFNALKEKNPNLKTLLAIGGWNFGSA-KFSAMAASPENRKTFIKSAIAFLRKYGFDGLDL 118
Query: 1831 DWEYPKCWQVDCKQGPASDKQGFADLIKELRAAFNPHD--LLLSAAVSPSKAVIDNAYDI 1888
DWEYP GP DK+ F L+KELR AF P LLL+AAVS K ID AYDI
Sbjct: 119 DWEYPGQRG-----GPPEDKENFVTLLKELREAFEPEAPRLLLTAAVSAGKETIDAAYDI 173
Query: 1889 PVMSENLDWISVMTYDYHGQWDKKTGHVAPMYALPNDTT--PTFNANYSLHYWVSHGADR 1946
P +S+ LD+I+VMTYD+HG W+ TGH +P+YA DT N +Y++ YW+S GA
Sbjct: 174 PEISKYLDFINVMTYDFHGSWEGVTGHNSPLYAGSADTGDQKYLNVDYAIKYWLSKGAPP 233
Query: 1947 KKVIFGMPMYGQSFTLADKNKNGLNSQTYGGAEAGENTRARGFLAYYEICDKIQKDGWVV 2006
+K++ G+P YG+SFTLA + G+ + G AG TR GFLAYYEIC+ K GW V
Sbjct: 234 EKLVLGIPTYGRSFTLASPSNTGVGAPASGPGTAGPYTREAGFLAYYEICEF-LKSGWTV 292
Query: 2007 VRDRKRRIGPYAFKGDQWVGFDDQAMIHHKAEFVKYNDLGGAMIWALDLDDFKNFCGCES 2066
V D +++ PYA+KG+QWVG+DD+ I K +++K LGGAM+W++DLDDF+ CG
Sbjct: 293 VWDDEQK-VPYAYKGNQWVGYDDEESIALKVQYLKSKGLGGAMVWSIDLDDFRGTCGQGK 351
Query: 2067 YPLLKTINRVL 2077
YPLL INR L
Sbjct: 352 YPLLNAINRAL 362
|
The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens. Length = 362 |
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|119359 cd06542, GH18_EndoS-like, Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >gnl|CDD|214753 smart00636, Glyco_18, Glyco_18 domain | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|119355 cd02876, GH18_SI-CLP, Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >gnl|CDD|216071 pfam00704, Glyco_hydro_18, Glycosyl hydrolases family 18 | Back alignment and domain information |
|---|
| >gnl|CDD|119362 cd06545, GH18_3CO4_chitinase, The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216601 pfam01607, CBM_14, Chitin binding Peritrophin-A domain | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|216601 pfam01607, CBM_14, Chitin binding Peritrophin-A domain | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|216601 pfam01607, CBM_14, Chitin binding Peritrophin-A domain | Back alignment and domain information |
|---|
| >gnl|CDD|214696 smart00494, ChtBD2, Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >gnl|CDD|214696 smart00494, ChtBD2, Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >gnl|CDD|119351 cd02872, GH18_chitolectin_chitotriosidase, This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >gnl|CDD|214696 smart00494, ChtBD2, Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >gnl|CDD|119365 cd06548, GH18_chitinase, The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >gnl|CDD|119353 cd02874, GH18_CFLE_spore_hydrolase, Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >gnl|CDD|119359 cd06542, GH18_EndoS-like, Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >gnl|CDD|119355 cd02876, GH18_SI-CLP, Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >gnl|CDD|119355 cd02876, GH18_SI-CLP, Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >gnl|CDD|216513 pfam01456, Mucin, Mucin-like glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|119350 cd02871, GH18_chitinase_D-like, GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216513 pfam01456, Mucin, Mucin-like glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|119366 cd06549, GH18_trifunctional, GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|216513 pfam01456, Mucin, Mucin-like glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|119350 cd02871, GH18_chitinase_D-like, GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >gnl|CDD|119352 cd02873, GH18_IDGF, The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >gnl|CDD|214696 smart00494, ChtBD2, Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >gnl|CDD|226376 COG3858, COG3858, Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|216513 pfam01456, Mucin, Mucin-like glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|216257 pfam01034, Syndecan, Syndecan domain | Back alignment and domain information |
|---|
| >gnl|CDD|119357 cd02878, GH18_zymocin_alpha, Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|119363 cd06546, GH18_CTS3_chitinase, GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >gnl|CDD|216601 pfam01607, CBM_14, Chitin binding Peritrophin-A domain | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|114270 pfam05539, Pneumo_att_G, Pneumovirinae attachment membrane glycoprotein G | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|226406 COG3889, COG3889, Predicted solute binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|225629 COG3087, FtsN, Cell division protein [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216513 pfam01456, Mucin, Mucin-like glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|216421 pfam01299, Lamp, Lysosome-associated membrane glycoprotein (Lamp) | Back alignment and domain information |
|---|
| >gnl|CDD|119366 cd06549, GH18_trifunctional, GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >gnl|CDD|191251 pfam05283, MGC-24, Multi-glycosylated core protein 24 (MGC-24) | Back alignment and domain information |
|---|
| >gnl|CDD|165513 PHA03255, PHA03255, BDLF3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216513 pfam01456, Mucin, Mucin-like glycoprotein | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|225862 COG3325, ChiA, Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|139494 PRK13335, PRK13335, superantigen-like protein; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218421 pfam05086, Dicty_REP, Dictyostelium (Slime Mold) REP protein | Back alignment and domain information |
|---|
| >gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|218439 pfam05109, Herpes_BLLF1, Herpes virus major outer envelope glycoprotein (BLLF1) | Back alignment and domain information |
|---|
| >gnl|CDD|119363 cd06546, GH18_CTS3_chitinase, GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >gnl|CDD|226406 COG3889, COG3889, Predicted solute binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236792 PRK10905, PRK10905, cell division protein DamX; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|221121 pfam11489, DUF3210, Protein of unknown function (DUF3210) | Back alignment and domain information |
|---|
| >gnl|CDD|119349 cd00598, GH18_chitinase-like, The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >gnl|CDD|119358 cd02879, GH18_plant_chitinase_class_V, The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|165513 PHA03255, PHA03255, BDLF3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165513 PHA03255, PHA03255, BDLF3; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237191 PRK12757, PRK12757, cell division protein FtsN; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|184900 PRK14907, rplD, 50S ribosomal protein L4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|119354 cd02875, GH18_chitobiase, Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >gnl|CDD|226406 COG3889, COG3889, Predicted solute binding protein [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2417 | |||
| cd02873 | 413 | GH18_IDGF The IDGF's (imaginal disc growth factors | 100.0 | |
| cd02872 | 362 | GH18_chitolectin_chitotriosidase This conserved do | 100.0 | |
| cd02873 | 413 | GH18_IDGF The IDGF's (imaginal disc growth factors | 100.0 | |
| cd02872 | 362 | GH18_chitolectin_chitotriosidase This conserved do | 100.0 | |
| COG3325 | 441 | ChiA Chitinase [Carbohydrate transport and metabol | 100.0 | |
| COG3325 | 441 | ChiA Chitinase [Carbohydrate transport and metabol | 100.0 | |
| cd02878 | 345 | GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin | 100.0 | |
| KOG2806|consensus | 432 | 100.0 | ||
| cd02878 | 345 | GH18_zymocin_alpha Zymocin, alpha subunit. Zymocin | 100.0 | |
| KOG2806|consensus | 432 | 100.0 | ||
| cd06548 | 322 | GH18_chitinase The GH18 (glycosyl hydrolases, fami | 100.0 | |
| cd06548 | 322 | GH18_chitinase The GH18 (glycosyl hydrolases, fami | 100.0 | |
| cd02879 | 299 | GH18_plant_chitinase_class_V The class V plant chi | 100.0 | |
| smart00636 | 334 | Glyco_18 Glycosyl hydrolase family 18. | 100.0 | |
| cd02879 | 299 | GH18_plant_chitinase_class_V The class V plant chi | 100.0 | |
| smart00636 | 334 | Glyco_18 Glycosyl hydrolase family 18. | 100.0 | |
| PF00704 | 343 | Glyco_hydro_18: Glycosyl hydrolases family 18; Int | 100.0 | |
| PF00704 | 343 | Glyco_hydro_18: Glycosyl hydrolases family 18; Int | 100.0 | |
| cd02876 | 318 | GH18_SI-CLP Stabilin-1 interacting chitinase-like | 100.0 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 100.0 | |
| cd02876 | 318 | GH18_SI-CLP Stabilin-1 interacting chitinase-like | 100.0 | |
| cd02874 | 313 | GH18_CFLE_spore_hydrolase Cortical fragment-lytic | 100.0 | |
| cd02875 | 358 | GH18_chitobiase Chitobiase (also known as di-N-ace | 100.0 | |
| cd06545 | 253 | GH18_3CO4_chitinase The Bacteroides thetaiotaomicr | 100.0 | |
| cd02874 | 313 | GH18_CFLE_spore_hydrolase Cortical fragment-lytic | 100.0 | |
| cd06545 | 253 | GH18_3CO4_chitinase The Bacteroides thetaiotaomicr | 100.0 | |
| cd06549 | 298 | GH18_trifunctional GH18 domain of an uncharacteriz | 100.0 | |
| cd06549 | 298 | GH18_trifunctional GH18 domain of an uncharacteriz | 100.0 | |
| cd00598 | 210 | GH18_chitinase-like The GH18 (glycosyl hydrolase, | 100.0 | |
| cd06546 | 256 | GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase | 99.97 | |
| cd06546 | 256 | GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase | 99.97 | |
| cd00598 | 210 | GH18_chitinase-like The GH18 (glycosyl hydrolase, | 99.97 | |
| cd02871 | 312 | GH18_chitinase_D-like GH18 domain of Chitinase D ( | 99.97 | |
| cd02871 | 312 | GH18_chitinase_D-like GH18 domain of Chitinase D ( | 99.96 | |
| cd06544 | 253 | GH18_narbonin Narbonin is a plant 2S protein from | 99.96 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 99.96 | |
| cd06544 | 253 | GH18_narbonin Narbonin is a plant 2S protein from | 99.96 | |
| COG3858 | 423 | Predicted glycosyl hydrolase [General function pre | 99.9 | |
| cd06542 | 255 | GH18_EndoS-like Endo-beta-N-acetylglucosaminidases | 99.89 | |
| KOG4701|consensus | 568 | 99.89 | ||
| cd02877 | 280 | GH18_hevamine_XipI_class_III This conserved domain | 99.88 | |
| KOG2091|consensus | 392 | 99.87 | ||
| cd06542 | 255 | GH18_EndoS-like Endo-beta-N-acetylglucosaminidases | 99.86 | |
| cd02877 | 280 | GH18_hevamine_XipI_class_III This conserved domain | 99.85 | |
| cd06543 | 294 | GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch | 99.8 | |
| KOG2091|consensus | 392 | 99.73 | ||
| COG3469 | 332 | Chitinase [Carbohydrate transport and metabolism] | 99.72 | |
| cd06543 | 294 | GH18_PF-ChiA-like PF-ChiA is an uncharacterized ch | 99.71 | |
| COG3469 | 332 | Chitinase [Carbohydrate transport and metabolism] | 99.67 | |
| KOG4701|consensus | 568 | 99.18 | ||
| PF01607 | 53 | CBM_14: Chitin binding Peritrophin-A domain; Inter | 98.42 | |
| PF01607 | 53 | CBM_14: Chitin binding Peritrophin-A domain; Inter | 98.4 | |
| cd06547 | 339 | GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG | 98.2 | |
| smart00494 | 56 | ChtBD2 Chitin-binding domain type 2. | 98.17 | |
| smart00494 | 56 | ChtBD2 Chitin-binding domain type 2. | 98.17 | |
| cd06547 | 339 | GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENG | 97.86 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 97.31 | |
| PF03644 | 311 | Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int | 97.21 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 97.2 | |
| PF13200 | 316 | DUF4015: Putative glycosyl hydrolase domain | 97.1 | |
| PF03644 | 311 | Glyco_hydro_85: Glycosyl hydrolase family 85 ; Int | 96.98 | |
| PF02638 | 311 | DUF187: Glycosyl hydrolase like GH101; InterPro: I | 96.53 | |
| PF11340 | 181 | DUF3142: Protein of unknown function (DUF3142); In | 96.47 | |
| PF11340 | 181 | DUF3142: Protein of unknown function (DUF3142); In | 95.86 | |
| KOG2331|consensus | 526 | 93.31 | ||
| PF03427 | 61 | CBM_19: Carbohydrate binding domain (family 19); I | 91.42 | |
| KOG2331|consensus | 526 | 90.23 | ||
| TIGR01370 | 315 | cysRS possible cysteinyl-tRNA synthetase, Methanoc | 89.63 | |
| TIGR01370 | 315 | cysRS possible cysteinyl-tRNA synthetase, Methanoc | 88.32 | |
| COG1649 | 418 | Uncharacterized protein conserved in bacteria [Fun | 87.6 | |
| PF14883 | 294 | GHL13: Hypothetical glycosyl hydrolase family 13 | 84.64 | |
| TIGR02402 | 542 | trehalose_TreZ malto-oligosyltrehalose trehalohydr | 84.37 | |
| PRK12568 | 730 | glycogen branching enzyme; Provisional | 80.98 |
| >cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.2e-65 Score=653.95 Aligned_cols=364 Identities=32% Similarity=0.661 Sum_probs=315.6
Q ss_pred EEEEEEecCcccccCCCCCCCCCCCCCC--ccEEEEEeEEecCCCcEEccCCCcchhhHHHHHHHHHHHhC--CCEEEEE
Q psy4449 1712 KIVCYFTNWAWYRQSGGKYLPSDIDSDL--CTHVIYGFAVLDTDQLVIKPHDTWADLDNKFYEKVTALKKK--GVKVTLA 1787 (2417)
Q Consensus 1712 ~vvcY~~~W~~yr~~~~~~~~~~i~~~~--cTHIiyaFa~i~~~~~~~~~~d~~~d~~~~~~~~i~~lk~~--glKvlls 1787 (2417)
+|||||.+|++||.+.++|.|++||+.+ ||||+|||+.|++++..+...+.+.+.+...++++..||++ ++|||||
T Consensus 1 ~vvcyy~~~a~~r~~~~~~~~~~i~~~~~~~THl~yaf~~i~~~~~~~~~~~~~~~~~~~~~~~~~~lk~~~p~lKvllS 80 (413)
T cd02873 1 KLVCYYDSKSYLREGLAKMSLEDLEPALQFCTHLVYGYAGIDADTYKIKSLNEDLDLDKSHYRAITSLKRKYPHLKVLLS 80 (413)
T ss_pred CEEEEecchhhcCCCCCeeCHHHcCCccccCCeEEEEEEEEeCCCCEEEecCcccchhhhHHHHHHHHHhhCCCCeEEEe
Confidence 5899999999999999999999999976 99999999999998877777777777776778899999886 7999999
Q ss_pred EcCCCCCC----CcchhHhhcCHHHHHHHHHHHHHHHHHcCCCeEEEeecCCCCccCCC---------------------
Q psy4449 1788 IGGWNDSA----GNKYSRLVNSQQARSKFIAHVVNFILEHNFDGLDLDWEYPKCWQVDC--------------------- 1842 (2417)
Q Consensus 1788 IGGw~~s~----~~~fs~~~~~~~~R~~Fi~siv~~l~~ygfDGiDiDwEyP~~~~~~~--------------------- 1842 (2417)
||||..+. +..|+.|++++++|++||+++++||++|+|||||||||||+..+...
T Consensus 81 iGGw~~~~~~~~s~~fs~~~~~~~~R~~Fi~siv~~l~~~~fDGidiDWEyP~~~~~~~~g~~~~~~~~~~~~~~g~~~~ 160 (413)
T cd02873 81 VGGDRDTDEEGENEKYLLLLESSESRNAFINSAHSLLKTYGFDGLDLAWQFPKNKPKKVRGTFGSAWHSFKKLFTGDSVV 160 (413)
T ss_pred ecCCCCCCCcccchhhHHHhCCHHHHHHHHHHHHHHHHHcCCCCeEeeeeCCCCcccccccccchhhhhhhccccccccc
Confidence 99998642 35799999999999999999999999999999999999997421100
Q ss_pred CCCCcchhhhHHHHHHHHHHhcCCCCcEEEEEECCChhhhcccCCccccccCcceEEEEeccCCCCCCC--CCCCCCcCC
Q psy4449 1843 KQGPASDKQGFADLIKELRAAFNPHDLLLSAAVSPSKAVIDNAYDIPVMSENLDWISVMTYDYHGQWDK--KTGHVAPMY 1920 (2417)
Q Consensus 1843 ~~~~~~d~~~~~~llkeLr~~l~~~~~~Ls~av~~~~~~~~~~yd~~~l~~~vD~i~vMtYD~~g~w~~--~tg~~aPLy 1920 (2417)
....++|+++|+.||+|||++|++.+++|++++++.... ...||+++|+++|||||||+|||||+|.. .++|+||||
T Consensus 161 ~~~~~~d~~nf~~Ll~elr~~l~~~~~~ls~av~~~~~~-~~~~d~~~l~~~vD~inlMtYD~~g~~~~~~~~~~~apL~ 239 (413)
T cd02873 161 DEKAAEHKEQFTALVRELKNALRPDGLLLTLTVLPHVNS-TWYFDVPAIANNVDFVNLATFDFLTPERNPEEADYTAPIY 239 (413)
T ss_pred CCCChhHHHHHHHHHHHHHHHhcccCcEEEEEecCCchh-ccccCHHHHhhcCCEEEEEEecccCCCCCCCccCcCCccC
Confidence 112468999999999999999999999999998764332 23589999999999999999999999865 589999999
Q ss_pred CCCCCCCCCccHHHHHHHHHHcCCCCCcEeeeccccceeeEeccCCC-CCC--CCccccCCCCCCccccCccchHHHHHH
Q psy4449 1921 ALPNDTTPTFNANYSLHYWVSHGADRKKVIFGMPMYGQSFTLADKNK-NGL--NSQTYGGAEAGENTRARGFLAYYEICD 1997 (2417)
Q Consensus 1921 ~~~~~~~~~~nv~~~v~~~~~~G~p~~KLvlGiP~YG~~ftl~~~~~-~~~--~a~~~g~g~~g~~t~~~G~l~y~eic~ 1997 (2417)
..... ...+|++.+|++|+++|+|++|||||||||||.|++.+... .+. .+++.|++.+|+++.+.|.++|+|||+
T Consensus 240 ~~~~~-~~~~~v~~~v~~~~~~gvp~~KlvlGip~YGr~w~l~~~~~~~g~~~~~~~~g~~~~G~~~~~~g~l~y~ei~~ 318 (413)
T cd02873 240 ELYER-NPHHNVDYQVKYWLNQGTPASKLNLGIATYGRAWKLTKDSGITGVPPVLETDGPGPAGPQTKTPGLLSWPEICS 318 (413)
T ss_pred CCccc-cccccHHHHHHHHHHcCCCHHHeEEEEecceeeeEccCCCCCcCCCCCccCCCCCCCCCCcCCCccccHHHHHH
Confidence 76432 35689999999999999999999999999999999986542 232 246788899999999999999999999
Q ss_pred hhhcC--------CcEEEEcCCCceeeEEee-------CCEEEEeCCHHHHHHHHHHhhcCCcceEEEEeccCccccCcC
Q psy4449 1998 KIQKD--------GWVVVRDRKRRIGPYAFK-------GDQWVGFDDQAMIHHKAEFVKYNDLGGAMIWALDLDDFKNFC 2062 (2417)
Q Consensus 1998 ~~~~~--------~~~~~~D~~~~~~py~~~-------~~~wv~Ydd~~Si~~K~~~~k~~gLgGvmiW~ld~DDf~g~C 2062 (2417)
.+... .|..+||+..+..+|+|+ .++||+|||++||+.|++||+++||||+|+|+|++|||+|.|
T Consensus 319 ~~~~~~~~~g~~~~~~~~~d~~~~~~~y~y~~~d~~~~~~~wvsydd~~Si~~K~~y~~~~gLgGv~~W~l~~DD~~g~c 398 (413)
T cd02873 319 KLPNPANLKGADAPLRKVGDPTKRFGSYAYRPADENGEHGIWVSYEDPDTAANKAGYAKAKGLGGVALFDLSLDDFRGQC 398 (413)
T ss_pred hhccCccccccccceeEeecccccccceEEeccccCCCCCeEEEeCCHHHHHHHHHHHHhCCCceEEEEeeecCcCCCCc
Confidence 87653 366789987665699984 257999999999999999999999999999999999999999
Q ss_pred CCCCchHHHHHHHHh
Q psy4449 2063 GCESYPLLKTINRVL 2077 (2417)
Q Consensus 2063 g~~~~pLl~ai~~~l 2077 (2417)
+.+.||||++|+..|
T Consensus 399 ~~~~~pll~~i~~~~ 413 (413)
T cd02873 399 TGDKFPILRSAKYRL 413 (413)
T ss_pred CCCCChHHHHHHhhC
Confidence 888999999999865
|
The IDGF's have an eight-stranded alpha/beta barrel fold and are related to the glycosyl hydrolase family 18 (GH18) chitinases, but they have an amino acid substitution known to abolish chitinase catalytic activity. IDGFs may have evolved from chitinases to gain new functions as growth factors, interacting with cell surface glycoproteins involved in growth-promoting processes. |
| >cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >cd02873 GH18_IDGF The IDGF's (imaginal disc growth factors) are a family of growth factors identified in insects that include at least five members, some of which are encoded by genes in a tight cluster | Back alignment and domain information |
|---|
| >cd02872 GH18_chitolectin_chitotriosidase This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases | Back alignment and domain information |
|---|
| >COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3325 ChiA Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02878 GH18_zymocin_alpha Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >KOG2806|consensus | Back alignment and domain information |
|---|
| >cd02878 GH18_zymocin_alpha Zymocin, alpha subunit | Back alignment and domain information |
|---|
| >KOG2806|consensus | Back alignment and domain information |
|---|
| >cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >cd06548 GH18_chitinase The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites | Back alignment and domain information |
|---|
| >cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >smart00636 Glyco_18 Glycosyl hydrolase family 18 | Back alignment and domain information |
|---|
| >cd02879 GH18_plant_chitinase_class_V The class V plant chitinases have a glycosyl hydrolase family 18 (GH18) domain, but lack the chitin-binding domain present in other GH18 enzymes | Back alignment and domain information |
|---|
| >smart00636 Glyco_18 Glycosyl hydrolase family 18 | Back alignment and domain information |
|---|
| >PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF00704 Glyco_hydro_18: Glycosyl hydrolases family 18; InterPro: IPR001223 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >cd02876 GH18_SI-CLP Stabilin-1 interacting chitinase-like protein (SI-CLP) is a eukaryotic chitinase-like protein of unknown function that interacts with the endocytic/sorting transmembrane receptor stabilin-1 and is secreted from the lysosome | Back alignment and domain information |
|---|
| >cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >cd02875 GH18_chitobiase Chitobiase (also known as di-N-acetylchitobiase) is a lysosomal glycosidase that hydrolyzes the reducing-end N-acetylglucosamine from the chitobiose core of oligosaccharides during the ordered degradation of asparagine-linked glycoproteins in eukaryotes | Back alignment and domain information |
|---|
| >cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >cd02874 GH18_CFLE_spore_hydrolase Cortical fragment-lytic enzyme (CFLE) is a peptidoglycan hydrolase involved in bacterial endospore germination | Back alignment and domain information |
|---|
| >cd06545 GH18_3CO4_chitinase The Bacteroides thetaiotaomicron protein represented by pdb structure 3CO4 is an uncharacterized bacterial member of the family 18 glycosyl hydrolases with homologs found in Flavobacterium, Stigmatella, and Pseudomonas | Back alignment and domain information |
|---|
| >cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >cd06549 GH18_trifunctional GH18 domain of an uncharacterized family of bacterial proteins, which share a common three-domain architecture: an N-terminal glycosyl hydrolase family 18 (GH18) domain, a glycosyl transferase family 2 domain, and a C-terminal polysaccharide deacetylase domain | Back alignment and domain information |
|---|
| >cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >cd06546 GH18_CTS3_chitinase GH18 domain of CTS3 (chitinase 3), an uncharacterized protein from the human fungal pathogen Coccidioides posadasii | Back alignment and domain information |
|---|
| >cd00598 GH18_chitinase-like The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods | Back alignment and domain information |
|---|
| >cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >cd02871 GH18_chitinase_D-like GH18 domain of Chitinase D (ChiD) | Back alignment and domain information |
|---|
| >cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06544 GH18_narbonin Narbonin is a plant 2S protein from the globulin fraction of narbon bean (Vicia narbonensis L | Back alignment and domain information |
|---|
| >COG3858 Predicted glycosyl hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >KOG4701|consensus | Back alignment and domain information |
|---|
| >cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain | Back alignment and domain information |
|---|
| >KOG2091|consensus | Back alignment and domain information |
|---|
| >cd06542 GH18_EndoS-like Endo-beta-N-acetylglucosaminidases are bacterial chitinases that hydrolyze the chitin core of various asparagine (N)-linked glycans and glycoproteins | Back alignment and domain information |
|---|
| >cd02877 GH18_hevamine_XipI_class_III This conserved domain family includes xylanase inhibitor Xip-I, and the class III plant chitinases such as hevamine, concanavalin B, and PPL2, all of which have a glycosyl hydrolase family 18 (GH18) domain | Back alignment and domain information |
|---|
| >cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain | Back alignment and domain information |
|---|
| >KOG2091|consensus | Back alignment and domain information |
|---|
| >COG3469 Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd06543 GH18_PF-ChiA-like PF-ChiA is an uncharacterized chitinase found in the hyperthermophilic archaeon Pyrococcus furiosus with a glycosyl hydrolase family 18 (GH18) catalytic domain as well as a cellulose-binding domain | Back alignment and domain information |
|---|
| >COG3469 Chitinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4701|consensus | Back alignment and domain information |
|---|
| >PF01607 CBM_14: Chitin binding Peritrophin-A domain; InterPro: IPR002557 This entry represents a chitin binding domain [] | Back alignment and domain information |
|---|
| >PF01607 CBM_14: Chitin binding Peritrophin-A domain; InterPro: IPR002557 This entry represents a chitin binding domain [] | Back alignment and domain information |
|---|
| >cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins | Back alignment and domain information |
|---|
| >smart00494 ChtBD2 Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >smart00494 ChtBD2 Chitin-binding domain type 2 | Back alignment and domain information |
|---|
| >cd06547 GH85_ENGase Endo-beta-N-acetylglucosaminidase (ENGase) hydrolyzes the N-N'-diacetylchitobiosyl core of N-glycosylproteins | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >PF13200 DUF4015: Putative glycosyl hydrolase domain | Back alignment and domain information |
|---|
| >PF03644 Glyco_hydro_85: Glycosyl hydrolase family 85 ; InterPro: IPR005201 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function | Back alignment and domain information |
|---|
| >PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >PF11340 DUF3142: Protein of unknown function (DUF3142); InterPro: IPR021488 This bacterial family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG2331|consensus | Back alignment and domain information |
|---|
| >PF03427 CBM_19: Carbohydrate binding domain (family 19); InterPro: IPR005089 A carbohydrate-binding module (CBM) is defined as a contiguous amino acid sequence within a carbohydrate-active enzyme with a discreet fold having carbohydrate-binding activity | Back alignment and domain information |
|---|
| >KOG2331|consensus | Back alignment and domain information |
|---|
| >TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type | Back alignment and domain information |
|---|
| >TIGR01370 cysRS possible cysteinyl-tRNA synthetase, Methanococcus type | Back alignment and domain information |
|---|
| >COG1649 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PF14883 GHL13: Hypothetical glycosyl hydrolase family 13 | Back alignment and domain information |
|---|
| >TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase | Back alignment and domain information |
|---|
| >PRK12568 glycogen branching enzyme; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 2417 | ||||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 7e-77 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 2e-21 | ||
| 1waw_A | 445 | Specificity And Affinity Of Natural Product Cyclope | 6e-10 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 1e-74 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 3e-21 | ||
| 1lg1_A | 365 | Crystal Structure Of Human Chitotriosidase In Compl | 3e-10 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 2e-74 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 3e-21 | ||
| 1guv_A | 366 | Structure Of Human Chitotriosidase Length = 366 | 4e-10 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 2e-74 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 2e-18 | ||
| 3fxy_A | 395 | Acidic Mammalian Chinase, Catalytic Domain Length = | 7e-10 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 3e-74 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 3e-21 | ||
| 1hki_A | 365 | Crystal Structure Of Human Chitinase In Complex Wit | 3e-10 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 3e-74 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 2e-19 | ||
| 2ybt_A | 381 | Crystal Structure Of Human Acidic Chitinase In Comp | 8e-10 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 3e-74 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 3e-21 | ||
| 1hkk_A | 364 | High Resoultion Crystal Structure Of Human Chitinas | 4e-10 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 2e-73 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 2e-18 | ||
| 1xhg_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein Fr | 5e-08 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 4e-73 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 6e-18 | ||
| 1hjv_A | 362 | Crystal Structure Of Hcgp-39 In Complex With Chitin | 1e-08 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 1e-72 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 4e-18 | ||
| 1sr0_A | 361 | Crystal Structure Of Signalling Protein From Sheep( | 5e-08 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 3e-72 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 2e-18 | ||
| 1syt_A | 361 | Crystal Structure Of Signalling Protein From Goat S | 5e-08 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 3e-72 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 2e-18 | ||
| 2pi6_A | 361 | Crystal Structure Of The Sheep Signalling Glycoprot | 5e-08 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 4e-72 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 1e-18 | ||
| 1zbv_A | 361 | Crystal Structure Of The Goat Signalling Protein (S | 5e-08 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 9e-72 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 4e-18 | ||
| 1ljy_A | 361 | Crystal Structure Of A Novel Regulatory 40 Kda Mamm | 5e-08 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 2e-71 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 2e-19 | ||
| 2esc_A | 361 | Crystal Structure Of A 40 Kda Protective Signalling | 7e-08 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 3e-71 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 2e-19 | ||
| 1owq_A | 361 | Crystal Structure Of A 40 Kda Signalling Protein (S | 8e-08 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 4e-71 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 2e-18 | ||
| 1tfv_A | 361 | Crystal Structure Of A Buffalo Signaling Glycoprote | 8e-08 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 2e-68 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 3e-17 | ||
| 4ay1_A | 365 | Human Ykl-39 Is A Pseudo-Chitinase With Retained Ch | 3e-12 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 3e-66 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 2e-18 | ||
| 1e9l_A | 377 | The Crystal Structure Of Novel Mammalian Lectin Ym1 | 6e-08 | ||
| 1jnd_A | 420 | Crystal Structure Of Imaginal Disc Growth Factor-2 | 3e-33 | ||
| 1jnd_A | 420 | Crystal Structure Of Imaginal Disc Growth Factor-2 | 2e-13 | ||
| 1jnd_A | 420 | Crystal Structure Of Imaginal Disc Growth Factor-2 | 2e-04 | ||
| 1itx_A | 419 | Catalytic Domain Of Chitinase A1 From Bacillus Circ | 5e-32 | ||
| 1itx_A | 419 | Catalytic Domain Of Chitinase A1 From Bacillus Circ | 3e-08 | ||
| 3alf_A | 353 | Crystal Structure Of Class V Chitinase From Nicotia | 4e-30 | ||
| 3alf_A | 353 | Crystal Structure Of Class V Chitinase From Nicotia | 1e-05 | ||
| 3aqu_A | 356 | Crystal Structure Of A Class V Chitinase From Arabi | 6e-30 | ||
| 3aqu_A | 356 | Crystal Structure Of A Class V Chitinase From Arabi | 5e-08 | ||
| 3alg_A | 353 | Crystal Structure Of Class V Chitinase (E115q Mutan | 9e-30 | ||
| 3alg_A | 353 | Crystal Structure Of Class V Chitinase (E115q Mutan | 3e-05 | ||
| 1d2k_A | 392 | C. Immitis Chitinase 1 At 2.2 Angstroms Resolution | 9e-29 | ||
| 1d2k_A | 392 | C. Immitis Chitinase 1 At 2.2 Angstroms Resolution | 3e-06 | ||
| 1ll7_A | 392 | Structure Of The E171q Mutant Of C. Immitis Chitina | 2e-28 | ||
| 1ll7_A | 392 | Structure Of The E171q Mutant Of C. Immitis Chitina | 8e-06 | ||
| 1ll6_A | 392 | Structure Of The D169n Mutant Of C. Immitis Chitina | 3e-28 | ||
| 1ll6_A | 392 | Structure Of The D169n Mutant Of C. Immitis Chitina | 3e-06 | ||
| 3g6l_A | 406 | The Crystal Structure Of A Chitinase Crchi1 From Th | 4e-27 | ||
| 3g6l_A | 406 | The Crystal Structure Of A Chitinase Crchi1 From Th | 3e-07 | ||
| 1w9p_A | 433 | Specificity And Affinity Of Natural Product Cyclope | 2e-26 | ||
| 1w9p_A | 433 | Specificity And Affinity Of Natural Product Cyclope | 1e-09 | ||
| 1wno_A | 395 | Crystal Structure Of A Native Chitinase From Asperg | 3e-26 | ||
| 1wno_A | 395 | Crystal Structure Of A Native Chitinase From Asperg | 5e-09 | ||
| 1kfw_A | 435 | Structure Of Catalytic Domain Of Psychrophilic Chit | 2e-20 | ||
| 2wly_A | 548 | Chitinase A From Serratia Marcescens Atcc990 In Com | 8e-20 | ||
| 1edq_A | 540 | Crystal Structure Of Chitinase A From S. Marcescens | 8e-20 | ||
| 2wk2_A | 540 | Chitinase A From Serratia Marcescens Atcc990 In Com | 9e-20 | ||
| 1rd6_A | 563 | Crystal Structure Of S. Marcescens Chitinase A Muta | 1e-19 | ||
| 1ctn_A | 540 | Crystal Structure Of A Bacterial Chitinase At 2.3 A | 1e-19 | ||
| 1ffr_A | 540 | Crystal Structure Of Chitinase A Mutant Y390f Compl | 2e-19 | ||
| 1ehn_A | 540 | Crystal Structure Of Chitinase A Mutant E315q Compl | 2e-19 | ||
| 1nh6_A | 540 | Structure Of S. Marcescens Chitinase A, E315l, Comp | 5e-19 | ||
| 1eib_A | 540 | Crystal Structure Of Chitinase A Mutant D313a Compl | 6e-19 | ||
| 1k9t_A | 540 | Chitinase A Complexed With Tetra-N-Acetylchitotrios | 6e-19 | ||
| 1e15_A | 499 | Chitinase B From Serratia Marcescens Length = 499 | 8e-19 | ||
| 1h0g_A | 499 | Complex Of A Chitinase With The Natural Product Cyc | 9e-19 | ||
| 1e6z_A | 498 | Chitinase B From Serratia Marcescens Wildtype In Co | 9e-19 | ||
| 1e6n_B | 499 | Chitinase B From Serratia Marcescens Inactive Mutan | 2e-18 | ||
| 1ur9_A | 499 | Interactions Of A Family 18 Chitinase With The Desi | 3e-18 | ||
| 1ogb_A | 499 | Chitinase B From Serratia Marcescens Mutant D142n L | 3e-18 | ||
| 1goi_A | 499 | Crystal Structure Of The D140n Mutant Of Chitinase | 3e-18 | ||
| 3b8s_A | 584 | Crystal Structure Of Wild-Type Chitinase A From Vib | 6e-15 | ||
| 3oa5_A | 574 | The Structure Of Chi1, A Chitinase From Yersinia En | 1e-14 | ||
| 4a5q_A | 546 | Crystal Structure Of The Chitinase Chi1 Fitted Into | 1e-14 | ||
| 3b9a_A | 584 | Crystal Structure Of Vibrio Harveyi Chitinase A Com | 4e-14 | ||
| 3ars_A | 584 | Crystal Structure Analysis Of Chitinase A From Vibr | 2e-13 | ||
| 4dws_A | 546 | Crystal Structure Of A Chitinase From The Yersinia | 6e-13 | ||
| 4dws_C | 546 | Crystal Structure Of A Chitinase From The Yersinia | 2e-12 | ||
| 4dws_D | 546 | Crystal Structure Of A Chitinase From The Yersinia | 2e-12 | ||
| 4dws_B | 546 | Crystal Structure Of A Chitinase From The Yersinia | 1e-11 | ||
| 3qok_A | 420 | Crystal Structure Of Putative Chitinase Ii From Kle | 1e-11 | ||
| 3cz8_A | 319 | Crystal Structure Of Putative Sporulation-Specific | 9e-05 | ||
| 3co4_A | 312 | Crystal Structure Of A Chitinase From Bacteroides T | 4e-04 | ||
| 3n11_A | 333 | Crystal Stricture Of Wild-Type Chitinase From Bacil | 4e-04 | ||
| 2y8v_A | 290 | Structure Of Chitinase, Chic, From Aspergillus Fumi | 9e-04 | ||
| 3n15_A | 333 | Crystal Stricture Of E145q Chitinase In Complex Wit | 9e-04 |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
|
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|1WAW|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitor Argadin Against Human Chitinase Length = 445 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1LG1|A Chain A, Crystal Structure Of Human Chitotriosidase In Complex With Chitobiose Length = 365 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|1GUV|A Chain A, Structure Of Human Chitotriosidase Length = 366 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|3FXY|A Chain A, Acidic Mammalian Chinase, Catalytic Domain Length = 395 | Back alignment and structure |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|1HKI|A Chain A, Crystal Structure Of Human Chitinase In Complex With Glucoallosamidin B Length = 365 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|2YBT|A Chain A, Crystal Structure Of Human Acidic Chitinase In Complex With Bisdionin C Length = 381 | Back alignment and structure |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1HKK|A Chain A, High Resoultion Crystal Structure Of Human Chitinase In Complex With Allosamidin Length = 364 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1XHG|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein From Porcine (spp-40) At 2.89a Resolution Length = 361 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|1HJV|A Chain A, Crystal Structure Of Hcgp-39 In Complex With Chitin Tetramer Length = 362 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1SR0|A Chain A, Crystal Structure Of Signalling Protein From Sheep(Sps-40) At 3.0a Resolution Using Crystal Grown In The Presence Of Polysaccharides Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|1SYT|A Chain A, Crystal Structure Of Signalling Protein From Goat Spg-40 In The Presense Of N,n',n''-triacetyl-chitotriose At 2.6a Resolution Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|2PI6|A Chain A, Crystal Structure Of The Sheep Signalling Glycoprotein (Sps-40) Complex With 2-Methyl-2-4-Pentanediol At 1.65a Resolution Reveals Specific Binding Characteristics Of Sps-40 Length = 361 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1ZBV|A Chain A, Crystal Structure Of The Goat Signalling Protein (Spg-40) Complexed With A Designed Peptide Trp-Pro-Trp At 3.2a Resolution Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1LJY|A Chain A, Crystal Structure Of A Novel Regulatory 40 Kda Mammary Gland Protein (Mgp-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|2ESC|A Chain A, Crystal Structure Of A 40 Kda Protective Signalling Protein From Bovine (Spc-40) At 2.1 A Resolution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1OWQ|A Chain A, Crystal Structure Of A 40 Kda Signalling Protein (Spc-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|1TFV|A Chain A, Crystal Structure Of A Buffalo Signaling Glycoprotein (Spb-40) Secreted During Involution Length = 361 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|4AY1|A Chain A, Human Ykl-39 Is A Pseudo-Chitinase With Retained Chitooligosaccharide Binding Properties Length = 365 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1E9L|A Chain A, The Crystal Structure Of Novel Mammalian Lectin Ym1 Suggests A Saccharide Binding Site Length = 377 | Back alignment and structure |
| >pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 | Back alignment and structure |
| >pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 | Back alignment and structure |
| >pdb|1JND|A Chain A, Crystal Structure Of Imaginal Disc Growth Factor-2 Length = 420 | Back alignment and structure |
| >pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 | Back alignment and structure |
| >pdb|1ITX|A Chain A, Catalytic Domain Of Chitinase A1 From Bacillus Circulans Wl-12 Length = 419 | Back alignment and structure |
| >pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 | Back alignment and structure |
| >pdb|3ALF|A Chain A, Crystal Structure Of Class V Chitinase From Nicotiana Tobaccum Length = 353 | Back alignment and structure |
| >pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 | Back alignment and structure |
| >pdb|3AQU|A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana Length = 356 | Back alignment and structure |
| >pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 | Back alignment and structure |
| >pdb|3ALG|A Chain A, Crystal Structure Of Class V Chitinase (E115q Mutant) From Nicotiana Tobaccum In Complex With Nag4 Length = 353 | Back alignment and structure |
| >pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 | Back alignment and structure |
| >pdb|1D2K|A Chain A, C. Immitis Chitinase 1 At 2.2 Angstroms Resolution Length = 392 | Back alignment and structure |
| >pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL7|A Chain A, Structure Of The E171q Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|1LL6|A Chain A, Structure Of The D169n Mutant Of C. Immitis Chitinase 1 Length = 392 | Back alignment and structure |
| >pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 | Back alignment and structure |
| >pdb|3G6L|A Chain A, The Crystal Structure Of A Chitinase Crchi1 From The Nematophagous Fungus Clonostachys Rosea Length = 406 | Back alignment and structure |
| >pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 | Back alignment and structure |
| >pdb|1W9P|A Chain A, Specificity And Affinity Of Natural Product Cyclopentapeptide Inhibitors Against Aspergillus Fumigatus, Human And Bacterial Chitinasefra Length = 433 | Back alignment and structure |
| >pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 | Back alignment and structure |
| >pdb|1WNO|A Chain A, Crystal Structure Of A Native Chitinase From Aspergillus Fumigatus Yj- 407 Length = 395 | Back alignment and structure |
| >pdb|1KFW|A Chain A, Structure Of Catalytic Domain Of Psychrophilic Chitinase B From Arthrobacter Tad20 Length = 435 | Back alignment and structure |
| >pdb|2WLY|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline. Length = 548 | Back alignment and structure |
| >pdb|1EDQ|A Chain A, Crystal Structure Of Chitinase A From S. Marcescens At 1.55 Angstroms Length = 540 | Back alignment and structure |
| >pdb|2WK2|A Chain A, Chitinase A From Serratia Marcescens Atcc990 In Complex With Chitotrio-Thiazoline Dithioamide Length = 540 | Back alignment and structure |
| >pdb|1RD6|A Chain A, Crystal Structure Of S. Marcescens Chitinase A Mutant W167a Length = 563 | Back alignment and structure |
| >pdb|1CTN|A Chain A, Crystal Structure Of A Bacterial Chitinase At 2.3 Angstroms Resolution Length = 540 | Back alignment and structure |
| >pdb|1FFR|A Chain A, Crystal Structure Of Chitinase A Mutant Y390f Complexed With Hexa-n- Acetylchitohexaose (nag)6 Length = 540 | Back alignment and structure |
| >pdb|1EHN|A Chain A, Crystal Structure Of Chitinase A Mutant E315q Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1NH6|A Chain A, Structure Of S. Marcescens Chitinase A, E315l, Complex With Hexasaccharide Length = 540 | Back alignment and structure |
| >pdb|1EIB|A Chain A, Crystal Structure Of Chitinase A Mutant D313a Complexed With Octa-N- Acetylchitooctaose (Nag)8 Length = 540 | Back alignment and structure |
| >pdb|1K9T|A Chain A, Chitinase A Complexed With Tetra-N-Acetylchitotriose Length = 540 | Back alignment and structure |
| >pdb|1E15|A Chain A, Chitinase B From Serratia Marcescens Length = 499 | Back alignment and structure |
| >pdb|1H0G|A Chain A, Complex Of A Chitinase With The Natural Product Cyclopentapeptide Argadin From Clonostachys Length = 499 | Back alignment and structure |
| >pdb|1E6Z|A Chain A, Chitinase B From Serratia Marcescens Wildtype In Complex With Catalytic Intermediate Length = 498 | Back alignment and structure |
| >pdb|1E6N|B Chain B, Chitinase B From Serratia Marcescens Inactive Mutant E144q In Complex With N-Acetylglucosamine-Pentamer Length = 499 | Back alignment and structure |
| >pdb|1UR9|A Chain A, Interactions Of A Family 18 Chitinase With The Designed Inhibitor Hm508, And Its Degradation Product, Chitobiono-Delta-Lactone Length = 499 | Back alignment and structure |
| >pdb|1OGB|A Chain A, Chitinase B From Serratia Marcescens Mutant D142n Length = 499 | Back alignment and structure |
| >pdb|1GOI|A Chain A, Crystal Structure Of The D140n Mutant Of Chitinase B From Serratia Marcescens At 1.45 A Resolution Length = 499 | Back alignment and structure |
| >pdb|3B8S|A Chain A, Crystal Structure Of Wild-Type Chitinase A From Vibrio Harveyi Length = 584 | Back alignment and structure |
| >pdb|3OA5|A Chain A, The Structure Of Chi1, A Chitinase From Yersinia Entomophaga Length = 574 | Back alignment and structure |
| >pdb|4A5Q|A Chain A, Crystal Structure Of The Chitinase Chi1 Fitted Into The 3d Structure Of The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|3B9A|A Chain A, Crystal Structure Of Vibrio Harveyi Chitinase A Complexed With Hexasaccharide Length = 584 | Back alignment and structure |
| >pdb|3ARS|A Chain A, Crystal Structure Analysis Of Chitinase A From Vibrio Harveyi With Novel Inhibitors - Apo Structure Of Mutant W275g Length = 584 | Back alignment and structure |
| >pdb|4DWS|A Chain A, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|C Chain C, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|D Chain D, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|4DWS|B Chain B, Crystal Structure Of A Chitinase From The Yersinia Entomophaga Toxin Complex Length = 546 | Back alignment and structure |
| >pdb|3QOK|A Chain A, Crystal Structure Of Putative Chitinase Ii From Klebsiella Pneumoniae Length = 420 | Back alignment and structure |
| >pdb|3CZ8|A Chain A, Crystal Structure Of Putative Sporulation-Specific Glycosylase Ydhd From Bacillus Subtilis Length = 319 | Back alignment and structure |
| >pdb|3CO4|A Chain A, Crystal Structure Of A Chitinase From Bacteroides Thetaiotaomicron Length = 312 | Back alignment and structure |
| >pdb|3N11|A Chain A, Crystal Stricture Of Wild-Type Chitinase From Bacillus Cereus Nctu2 Length = 333 | Back alignment and structure |
| >pdb|2Y8V|A Chain A, Structure Of Chitinase, Chic, From Aspergillus Fumigatus. Length = 290 | Back alignment and structure |
| >pdb|3N15|A Chain A, Crystal Stricture Of E145q Chitinase In Complex With Nag From Bacillus Cereus Nctu2 Length = 333 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
Score = 513 bits (1324), Expect = e-164
Identities = 161/465 (34%), Positives = 235/465 (50%), Gaps = 42/465 (9%)
Query: 1712 KIVCYFTNWAWYRQSGGKYLPSDIDSDLCTHVIYGFAVLDTDQLVIKPHDTWADLDNKFY 1771
K+VCYFTNWA YRQ ++LP D+D LCTH+IY FA + QL + D Y
Sbjct: 2 KLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTTEWN-----DETLY 56
Query: 1772 EKVTALKKK--GVKVTLAIGGWNDSAGNKYSRLVNSQQARSKFIAHVVNFILEHNFDGLD 1829
++ LKK +K LAIGGWN K++ +V + R F+ + F+ +++FDGLD
Sbjct: 57 QEFNGLKKMNPKLKTLLAIGGWNFG-TQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLD 115
Query: 1830 LDWEYPKCWQVDCKQGPASDKQGFADLIKELRAAFNPH-------DLLLSAAVSPSKAVI 1882
LDWEYP + PA DK+ F L+++L AF LLLSAAV + +
Sbjct: 116 LDWEYP-----GSQGSPAVDKERFTTLVQDLANAFQQEAQTSGKERLLLSAAVPAGQTYV 170
Query: 1883 DNAYDIPVMSENLDWISVMTYDYHGQWDKKTGHVAPMYALPNDT--TPTFNANYSLHYWV 1940
D Y++ +++NLD++++M YD+HG W+K TGH +P+Y ++ + N + ++ W+
Sbjct: 171 DAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWL 230
Query: 1941 SHGADRKKVIFGMPMYGQSFTLADKNKNGLNSQTYGGAEAGENTRARGFLAYYEICDKIQ 2000
G K+I GMP YG+SFTLA + + + G G T+ G LAYYE+C
Sbjct: 231 QKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCS--- 287
Query: 2001 KDGWVVVRDRKRRIGPYAFKGDQWVGFDDQAMIHHKAEFVKYNDLGGAMIWALDLDDFKN 2060
G R + ++ PY F+ +QWVGFDD K ++K LGGAM+WALDLDDF
Sbjct: 288 WKGATKQRIQDQK-VPYIFRDNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAG 346
Query: 2061 -FCGCESYPLLKTINRVLRNYPGPGPNCFLKPVPPKHEDNVPQTTGTQYEEDETLSDDTI 2119
C YPL++T+ + L P L+ P +
Sbjct: 347 FSCNQGRYPLIQTLRQELSLPYLPSGTPELEVPKPGQPSEPEHGPSPGQDTF-------- 398
Query: 2120 VIDSKSNRCNRTGELYQHEGDCAKFASCENGLIKIYDCPPGLHFN 2164
+ G LY + + + F SC G + CP GL F+
Sbjct: 399 ------CQGKADG-LYPNPRERSSFYSCAAGRLFQQSCPTGLVFS 436
|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* Length = 445 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A Length = 377 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* Length = 395 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} Length = 365 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... Length = 361 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* Length = 420 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} Length = 356 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* Length = 353 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} Length = 420 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* Length = 433 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 Length = 419 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* Length = 540 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A Length = 392 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* Length = 406 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 Length = 435 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* Length = 499 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Length = 584 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A Length = 574 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A Length = 312 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} Length = 319 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} Length = 275 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* Length = 333 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A Length = 271 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} Length = 393 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 Length = 289 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} Length = 290 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} Length = 321 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 Length = 290 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} Length = 451 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} Length = 302 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A Length = 311 | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 Length = 74 | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 Length = 74 | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 Length = 74 | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 Length = 74 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Length = 290 | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* Length = 290 | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Length = 273 | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* Length = 273 | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Length = 294 | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* Length = 294 | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Length = 273 | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* Length = 273 | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Length = 274 | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* Length = 274 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Length = 299 | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 Length = 299 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A Length = 937 | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* Length = 310 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} Length = 271 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2417 | |||
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 100.0 | |
| 1wb0_A | 445 | Chitinase 1, chitotriosidase 1; cyclopentapeptide | 100.0 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 100.0 | |
| 3fy1_A | 395 | Amcase, TSA1902, acidic mammalian chitinase; struc | 100.0 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 100.0 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 100.0 | |
| 4ay1_A | 365 | Chitinase-3-like protein 2; chilectin, lectin, chi | 100.0 | |
| 1vf8_A | 377 | YM1, secretory protein; chitinase, CHI-lectin, str | 100.0 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 100.0 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 100.0 | |
| 2pi6_A | 361 | Chitinase-3-like protein 1; complex, signaling pro | 100.0 | |
| 1jnd_A | 420 | Imaginal DISC growth factor-2; IDGF, chitinase, in | 100.0 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 100.0 | |
| 1itx_A | 419 | Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) | 100.0 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 100.0 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 100.0 | |
| 1kfw_A | 435 | Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrob | 100.0 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 100.0 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 100.0 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 100.0 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 100.0 | |
| 3g6m_A | 406 | Chitinase, crchi1; inhibitor, caffeine, glycosidas | 100.0 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 100.0 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 100.0 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 100.0 | |
| 1goi_A | 499 | Chitinase B; chitin degradation, hydrolase, glycos | 100.0 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 100.0 | |
| 3aqu_A | 356 | AT4G19810; stress response, TIM barrel, hydrolase, | 100.0 | |
| 3oa5_A | 574 | CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yers | 100.0 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 100.0 | |
| 3alf_A | 353 | Chitinase, class V; hydrolase; 1.20A {Nicotiana ta | 100.0 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 100.0 | |
| 3qok_A | 420 | Putative chitinase II; structural genomics, PSI-bi | 100.0 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 100.0 | |
| 1ll7_A | 392 | Chitinase 1; beta-alpha barrel, hydrolase; 2.00A { | 100.0 | |
| 1w9p_A | 433 | Chitinase; peptide inhibitors, argifin, argadin, g | 100.0 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 100.0 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 100.0 | |
| 3cz8_A | 319 | Putative sporulation-specific glycosylase YDHD; st | 100.0 | |
| 3fnd_A | 312 | Chitinase; TIM-barrel, structural genomics, PSI-2, | 100.0 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 100.0 | |
| 3bxw_B | 393 | Chitinase domain-containing protein 1; TIM barrel, | 100.0 | |
| 4axn_A | 328 | Chitinase C1; hydrolase; 1.68A {Serratia marcescen | 100.0 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 100.0 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 100.0 | |
| 1nar_A | 290 | Narbonin; plant SEED protein; 1.80A {Vicia narbone | 100.0 | |
| 3n12_A | 333 | Chitinase A, chinctu2; zinc atoms, complex, hydrol | 100.0 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 100.0 | |
| 4axn_A | 328 | Chitinase C1; hydrolase; 1.68A {Serratia marcescen | 100.0 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 100.0 | |
| 2y8v_A | 290 | CHIC, class III chitinase, putative; afchic, hydro | 100.0 | |
| 3ian_A | 321 | Chitinase; structural genomics, hydrolase, glycosi | 100.0 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 100.0 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 100.0 | |
| 3ebv_A | 302 | Chinitase A; chitinase A, CHIA, glycosidase, struc | 100.0 | |
| 3sim_A | 275 | Protein, family 18 chitinase; family 18 plant chit | 100.0 | |
| 4ac1_X | 283 | Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g | 99.97 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 99.97 | |
| 4ac1_X | 283 | Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, g | 99.97 | |
| 1edt_A | 271 | Endo-beta-N-acetylglucosaminidase H, endo H; hydro | 99.97 | |
| 2uy2_A | 294 | Endochitinase; carbohydrate metabolism, polysaccha | 99.96 | |
| 2hvm_A | 273 | Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He | 99.96 | |
| 2gsj_A | 271 | Protein PPL-2; mimosoideae, chimerolectin, endochi | 99.96 | |
| 2hvm_A | 273 | Hevamine; hydrolase, chitinase/lysozyme; 1.80A {He | 99.96 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 99.96 | |
| 2uy2_A | 294 | Endochitinase; carbohydrate metabolism, polysaccha | 99.95 | |
| 2gsj_A | 271 | Protein PPL-2; mimosoideae, chimerolectin, endochi | 99.95 | |
| 2ebn_A | 289 | Endo-beta-N-acetylglucosaminidase F1; hydrolase(gl | 99.95 | |
| 1eok_A | 290 | Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b | 99.94 | |
| 1cnv_A | 299 | Concanavalin B; plant chitinase, chitin binding pr | 99.94 | |
| 1cnv_A | 299 | Concanavalin B; plant chitinase, chitin binding pr | 99.94 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 99.94 | |
| 2xtk_A | 310 | CHIA1, class III chitinase CHIA1; hydrolase, GH18; | 99.93 | |
| 1eok_A | 290 | Endo-beta-N-acetylglucosaminidase F3; alpha/beta-b | 99.93 | |
| 1ta3_A | 274 | XIP-1, xylanase inhibitor protein I; beta alpha ba | 99.89 | |
| 1ta3_A | 274 | XIP-1, xylanase inhibitor protein I; beta alpha ba | 99.89 | |
| 3mu7_A | 273 | XAIP-II, xylanase and alpha-amylase inhibitor prot | 99.84 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 99.83 | |
| 3mu7_A | 273 | XAIP-II, xylanase and alpha-amylase inhibitor prot | 99.81 | |
| 3poh_A | 451 | Endo-beta-N-acetylglucosaminidase F1; TIM barrel, | 99.79 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 99.76 | |
| 2dsk_A | 311 | Chitinase; catalytic domain, active domain, crysta | 99.71 | |
| 1dqc_A | 74 | Tachycitin; disulfide-rich, antimicrobial protein; | 98.92 | |
| 1dqc_A | 74 | Tachycitin; disulfide-rich, antimicrobial protein; | 98.9 | |
| 2vtf_A | 626 | Endo-beta-N-acetylglucosaminidase; hydrolase, fami | 97.35 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 97.3 | |
| 2vtf_A | 626 | Endo-beta-N-acetylglucosaminidase; hydrolase, fami | 97.14 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 96.89 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 89.76 | |
| 3gdb_A | 937 | Endo-D, putative uncharacterized protein SPR0440; | 89.03 | |
| 2aam_A | 309 | Hypothetical protein TM1410; structural genomics, | 88.49 | |
| 2aam_A | 309 | Hypothetical protein TM1410; structural genomics, | 87.75 | |
| 3vmn_A | 643 | Dextranase; TIM barrel, immunoglobrin fold, greek- | 80.34 |
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-79 Score=792.44 Aligned_cols=428 Identities=37% Similarity=0.748 Sum_probs=324.4
Q ss_pred EEEEEEecCcccccCCCCCCCCCCCCCCccEEEEEeEEecCCCcEEccCCCcchhhHHHHHHHHHHHhC--CCEEEEEEc
Q psy4449 1712 KIVCYFTNWAWYRQSGGKYLPSDIDSDLCTHVIYGFAVLDTDQLVIKPHDTWADLDNKFYEKVTALKKK--GVKVTLAIG 1789 (2417)
Q Consensus 1712 ~vvcY~~~W~~yr~~~~~~~~~~i~~~~cTHIiyaFa~i~~~~~~~~~~d~~~d~~~~~~~~i~~lk~~--glKvllsIG 1789 (2417)
||||||++|++||++.++|.+++|++++||||+|||+.++.+ .+...| |.|.+ ++++|.+||++ ++|||||||
T Consensus 2 kvv~Y~~~w~~~r~~~~~~~~~~i~~~~~THi~yaF~~i~~~--~~~~~d-~~d~~--~~~~~~~lk~~~p~lKvllsiG 76 (445)
T 1wb0_A 2 KLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNH--QLSTTE-WNDET--LYQEFNGLKKMNPKLKTLLAIG 76 (445)
T ss_dssp EEEEEEETTGGGSCGGGCCCGGGCCTTTCSEEEEEEEEEETT--EEECSS-TTHHH--HHHHHHHGGGTCTTCEEEEEEE
T ss_pred eEEEEECcccccCCCCCCCCHHHCCcccCCEEEEEEEeeccC--ceeecC-hhHHH--HHHHHHHHHHhCCCCeEEEEEC
Confidence 699999999999999999999999999999999999999977 444455 66643 68889999876 699999999
Q ss_pred CCCCCCCcchhHhhcCHHHHHHHHHHHHHHHHHcCCCeEEEeecCCCCccCCCCCCCcchhhhHHHHHHHHHHhcC----
Q psy4449 1790 GWNDSAGNKYSRLVNSQQARSKFIAHVVNFILEHNFDGLDLDWEYPKCWQVDCKQGPASDKQGFADLIKELRAAFN---- 1865 (2417)
Q Consensus 1790 Gw~~s~~~~fs~~~~~~~~R~~Fi~siv~~l~~ygfDGiDiDwEyP~~~~~~~~~~~~~d~~~~~~llkeLr~~l~---- 1865 (2417)
||+.+ +..|+.|++++++|++||+++++||++|||||||||||||+. +++.++|+++|+.||+|||++|+
T Consensus 77 Gw~~~-s~~fs~~~~~~~~R~~fi~siv~~l~~~gfDGiDiDwEyP~~-----~g~~~~d~~nf~~ll~eLr~~l~~~~~ 150 (445)
T 1wb0_A 77 GWNFG-TQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGS-----QGSPAVDKERFTTLVQDLANAFQQEAQ 150 (445)
T ss_dssp CTTTC-SHHHHHHHTSHHHHHHHHHHHHHHHHHTTCCEEEEECSCTTS-----TTCCTTHHHHHHHHHHHHHHHHHHHHH
T ss_pred CCCCC-CchHHHHHcCHHHHHHHHHHHHHHHHHcCCCeEEEeCccCCC-----CCCCHHHHHHHHHHHHHHHHHHHHhhh
Confidence 99874 478999999999999999999999999999999999999973 34567899999999999999998
Q ss_pred ---CCCcEEEEEECCChhhhcccCCccccccCcceEEEEeccCCCCCCCCCCCCCcCCCCCCCCC--CCccHHHHHHHHH
Q psy4449 1866 ---PHDLLLSAAVSPSKAVIDNAYDIPVMSENLDWISVMTYDYHGQWDKKTGHVAPMYALPNDTT--PTFNANYSLHYWV 1940 (2417)
Q Consensus 1866 ---~~~~~Ls~av~~~~~~~~~~yd~~~l~~~vD~i~vMtYD~~g~w~~~tg~~aPLy~~~~~~~--~~~nv~~~v~~~~ 1940 (2417)
+.+++||+|+++....+..+||+++|+++|||||||+||+||.|+..+||+||||..+.+.. ..+|++.+|++|+
T Consensus 151 ~~~~~~~~Ls~av~~~~~~~~~~~d~~~l~~~vD~inlMtYD~~g~w~~~~g~~apL~~~~~~~~~~~~~~v~~av~~~~ 230 (445)
T 1wb0_A 151 TSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWL 230 (445)
T ss_dssp HHCSCCCEEEEEECCCHHHHHHHCCHHHHHHHCSEEEECCCCSSCTTSSBCCCSSCSSCCTTCCGGGGGCSHHHHHHHHH
T ss_pred ccCCCceEEEEEecCCHHHHHccCCHHHHHHhcceeeeeeeeccCCCcCCCCCCCCCCCCCCCccccccccHHHHHHHHH
Confidence 57899999999987777678999999999999999999999999999999999998766542 3579999999999
Q ss_pred HcCCCCCcEeeeccccceeeEeccCCCCCCCCccccCCCCCCccccCccchHHHHHHhhhcCCcEEEEcCCCceeeEEee
Q psy4449 1941 SHGADRKKVIFGMPMYGQSFTLADKNKNGLNSQTYGGAEAGENTRARGFLAYYEICDKIQKDGWVVVRDRKRRIGPYAFK 2020 (2417)
Q Consensus 1941 ~~G~p~~KLvlGiP~YG~~ftl~~~~~~~~~a~~~g~g~~g~~t~~~G~l~y~eic~~~~~~~~~~~~D~~~~~~py~~~ 2020 (2417)
++|+|++|||||||||||+|++.+...++++++..|++.+|+++++.|+++|+|||+. .+|++.||+..+ +||+|+
T Consensus 231 ~~gvp~~KlvlGip~YGr~~~~~~~~~~~~g~p~~g~~~~g~~t~~~G~~~y~ei~~~---~g~~~~~D~~~~-~~y~y~ 306 (445)
T 1wb0_A 231 QKGTPASKLILGMPTYGRSFTLASSSDTRVGAPATGSGTPGPFTKEGGMLAYYEVCSW---KGATKQRIQDQK-VPYIFR 306 (445)
T ss_dssp HTTCCGGGEEEEEESEEEEEEESCTTCCSTTCBEEEECCCCTTTCCTTEEEHHHHTTC---TTCEEEEETTTT-EEEEEE
T ss_pred HcCCChhHEEEEecccceeeEccCCCCCCCCCcccCCCCCCCccCcCCcccHHHHhhc---CCcEEEeccccc-eeEEEe
Confidence 9999999999999999999999998888999999999999999999999999999975 589999999987 699999
Q ss_pred CCEEEEeCCHHHHHHHHHHhhcCCcceEEEEeccCccccC-cCCCCCchHHHHHHHHhcCCCCCCCCCCCCCCCCCCCCC
Q psy4449 2021 GDQWVGFDDQAMIHHKAEFVKYNDLGGAMIWALDLDDFKN-FCGCESYPLLKTINRVLRNYPGPGPNCFLKPVPPKHEDN 2099 (2417)
Q Consensus 2021 ~~~wv~Ydd~~Si~~K~~~~k~~gLgGvmiW~ld~DDf~g-~Cg~~~~pLl~ai~~~l~~~~~~~~~~~~~~~~~~~~~~ 2099 (2417)
+++||+|||++||+.|++||+++||||+|+|+|++|||+| .|+.+++|||++|++.|+.... .+.. |.++ .
T Consensus 307 ~~~~v~ydd~~Si~~K~~~~~~~gLgGv~~W~l~~Dd~~g~~c~~~~~~Ll~ai~~~l~~~~~---~~~~-~~~~---~- 378 (445)
T 1wb0_A 307 DNQWVGFDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQELSLPYL---PSGT-PELE---V- 378 (445)
T ss_dssp TTEEEECCCHHHHHHHHHHHHHTTCCEEEEECGGGSCTTCSSSSSCSSHHHHHHHHHC----------------------
T ss_pred CCEEEEeCCHHHHHHHHHHHHHCCCceEEEecccccccCCCcCCCCCchHHHHHHHHhcCCCC---CCCC-CCCC---C-
Confidence 9999999999999999999999999999999999999999 9999999999999999975321 1211 1000 0
Q ss_pred CCCCCcccccccCCccCCcccccCCCcccccc-CccccCCCCCCcceEccCCeEEEEeCCCCCccCcc--cccc
Q psy4449 2100 VPQTTGTQYEEDETLSDDTIVIDSKSNRCNRT-GELYQHEGDCAKFASCENGLIKIYDCPPGLHFNFV--RAFY 2170 (2417)
Q Consensus 2100 ~p~~~~~~~~~~~~~~~~~~~~~~~~~~C~~~-~~~~~~~~~c~~~y~C~~g~~~~~~C~~g~~f~~~--~C~w 2170 (2417)
|++++++ .++ +..+.++.+.|+.. .++|+||.||++||+|.+|..+++.||.||+||+. .|||
T Consensus 379 -~~~~~~~----~~~---~~~~~~~~~~C~~~~~G~~~~p~~C~~fy~C~~g~~~~~~Cp~Gl~f~~~~~~Cd~ 444 (445)
T 1wb0_A 379 -PKPGQPS----EPE---HGPSPGQDTFCQGKADGLYPNPRERSSFYSCAAGRLFQQSCPTGLVFSNSCKCCTW 444 (445)
T ss_dssp --------------------------------------------------------------------------
T ss_pred -CCCCCCC----CCC---CCCCCCCCCcCCCCCCcccCCCCCCCcccCCCCCCEEeCCCcCCCEECcccCCCCC
Confidence 1101000 000 11112345679742 35889999999999999999999999999999984 9998
|
| >1wb0_A Chitinase 1, chitotriosidase 1; cyclopentapeptide inhibitors, chitinase inhibitors, carbohyd metabolism, chitin degradation, chitin-binding; HET: VR0 MEA; 1.65A {Homo sapiens} SCOP: c.1.8.5 d.26.3.1 PDB: 1waw_A* 1guv_A 1lg2_A 1lg1_A 1lq0_A 1hki_A* 1hkj_A* 1hkm_A* 1hkk_A* | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* | Back alignment and structure |
|---|
| >3fy1_A Amcase, TSA1902, acidic mammalian chitinase; structure, crystallography, asthma,inhibitor, chitin degradation, methylallosamidin; HET: NA1 NAA AMI; 1.70A {Homo sapiens} PDB: 3fxy_A* 3rm4_A* 3rm8_A* 3rm9_A* 3rme_A* 2ybt_A* 2ybu_A* | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay1_A Chitinase-3-like protein 2; chilectin, lectin, chitooligosaccharide, pseudochitinase, HY; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1vf8_A YM1, secretory protein; chitinase, CHI-lectin, structural plasticity, functional versatility, immune system; 1.31A {Mus musculus} SCOP: c.1.8.5 d.26.3.1 PDB: 1e9l_A | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* | Back alignment and structure |
|---|
| >2pi6_A Chitinase-3-like protein 1; complex, signaling protein; HET: NAG MAN; 1.65A {Ovis aries} SCOP: c.1.8.5 d.26.3.1 PDB: 2dpe_A* 1sr0_A* 1zl1_A* 1zbk_A* 2dsu_A* 2dsv_A* 2dsw_A* 2fdm_A* 2g41_A* 2g8z_A* 2dt1_A* 1zbv_A* 1zu8_A* 2aos_A* 2b31_A* 1zbw_A* 2dt0_A* 2dsz_A* 2dt2_A* 2dt3_A* ... | Back alignment and structure |
|---|
| >1jnd_A Imaginal DISC growth factor-2; IDGF, chitinase, insulin recep heparin, hormone-growth factor complex; HET: NAG BMA MAN; 1.30A {Drosophila melanogaster} SCOP: c.1.8.5 d.26.3.1 PDB: 1jne_A* | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1itx_A Chitinase A1, glycosyl hydrolase; alpha-beta (TIM) barrel; 1.10A {Bacillus circulans} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1kfw_A Chitinase B; TIM barrel, hydrolase; 1.74A {Arthrobacter SP} SCOP: c.1.8.5 d.26.3.1 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* | Back alignment and structure |
|---|
| >3g6m_A Chitinase, crchi1; inhibitor, caffeine, glycosidase, hydrolas hydrolase inhibitor complex; HET: CFF; 1.65A {Bionectria ochroleuca} PDB: 3g6l_A* | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A | Back alignment and structure |
|---|
| >1goi_A Chitinase B; chitin degradation, hydrolase, glycosidase; 1.45A {Serratia marcescens} SCOP: b.72.2.1 c.1.8.5 d.26.3.1 PDB: 1o6i_A* 1e6r_A* 1e15_A 1gpf_A* 1ur8_A* 1w1p_A* 1w1t_A* 1w1v_A* 1w1y_A* 1e6p_A 1e6n_A 1h0g_A* 1h0i_A* 1ogb_A 1ogg_A* 1e6z_A* 1ur9_A* | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* | Back alignment and structure |
|---|
| >3aqu_A AT4G19810; stress response, TIM barrel, hydrolase, chitin; HET: FLC; 2.01A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3oa5_A CHI1; TIM barrel, hydrolase; HET: 2PE; 1.74A {Yersinia} PDB: 4a5q_A | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3alf_A Chitinase, class V; hydrolase; 1.20A {Nicotiana tabacum} PDB: 3alg_A* | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A | Back alignment and structure |
|---|
| >3qok_A Putative chitinase II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycosyl hydrolases family 18; 2.60A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* | Back alignment and structure |
|---|
| >1ll7_A Chitinase 1; beta-alpha barrel, hydrolase; 2.00A {Coccidioides immitis} SCOP: c.1.8.5 d.26.3.1 PDB: 1d2k_A 1ll4_A* 1ll6_A | Back alignment and structure |
|---|
| >1w9p_A Chitinase; peptide inhibitors, argifin, argadin, glycosidase, hydrolase; 1.7A {Aspergillus fumigatus} SCOP: c.1.8.5 d.26.3.1 PDB: 1w9u_A* 1w9v_A* 2a3a_A* 2a3b_A* 2a3c_A* 2a3e_A* 2iuz_A* 3ch9_A 3chc_A* 3chd_A* 3che_A* 3chf_A* 1wno_A* | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A | Back alignment and structure |
|---|
| >3cz8_A Putative sporulation-specific glycosylase YDHD; structural genomics, uncharacterized protein, protein struct initiative, PSI-2; 2.20A {Bacillus subtilis subsp} | Back alignment and structure |
|---|
| >3fnd_A Chitinase; TIM-barrel, structural genomics, PSI-2, P structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides thetaiotaomicron} PDB: 3co4_A | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3bxw_B Chitinase domain-containing protein 1; TIM barrel, lysosome, secreted, hydrolase; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1nar_A Narbonin; plant SEED protein; 1.80A {Vicia narbonensis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >3n12_A Chitinase A, chinctu2; zinc atoms, complex, hydrolase; 1.20A {Bacillus cereus} PDB: 3n11_A 3n15_A* 3n13_A* 3n17_A* 3n18_A* 3n1a_A* | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >4axn_A Chitinase C1; hydrolase; 1.68A {Serratia marcescens} | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2y8v_A CHIC, class III chitinase, putative; afchic, hydrolase; 1.99A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3ian_A Chitinase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 1.75A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} | Back alignment and structure |
|---|
| >3ebv_A Chinitase A; chitinase A, CHIA, glycosidase, structural genomics, unknown function, hydrolase, PSI-2, protein structure initiative; 1.50A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >3sim_A Protein, family 18 chitinase; family 18 plant chitinase, TIM barrel, chitin binding, glyco hydrolase, hydrolase; 2.10A {Crocus vernus} | Back alignment and structure |
|---|
| >4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A | Back alignment and structure |
|---|
| >4ac1_X Endo-N-acetyl-beta-D-glucosaminidase; hydrolase, glycoside hydrolase family 18, deglycosylation; HET: NAG; 1.30A {Hypocrea jecorina} | Back alignment and structure |
|---|
| >1edt_A Endo-beta-N-acetylglucosaminidase H, endo H; hydrolase (glucosidase); 1.90A {Streptomyces plicatus} SCOP: c.1.8.5 PDB: 1c90_A 1c8x_A 1c91_A 1c3f_A 1c92_A 1c8y_A 1c93_A | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* | Back alignment and structure |
|---|
| >2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} | Back alignment and structure |
|---|
| >2hvm_A Hevamine; hydrolase, chitinase/lysozyme; 1.80A {Hevea brasiliensis} SCOP: c.1.8.5 PDB: 1hvq_A* 1llo_A 1kr0_A* 1kr1_A* 1kqy_A* 1kqz_A* | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >2uy2_A Endochitinase; carbohydrate metabolism, polysaccharide degradation, glycopr chitin-binding, chitin degradation, CAZY, hydrolase; 1.60A {Saccharomyces cerevisiae} PDB: 2uy3_A* 2uy4_A* 2uy5_A* | Back alignment and structure |
|---|
| >2gsj_A Protein PPL-2; mimosoideae, chimerolectin, endochitinase, glycosyl hydrolase family 18, equilibrium sedimentation, X-RAY; 1.73A {Parkia platycephala} | Back alignment and structure |
|---|
| >2ebn_A Endo-beta-N-acetylglucosaminidase F1; hydrolase(glucosidase); 2.00A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >1cnv_A Concanavalin B; plant chitinase, chitin binding protein, SEED protein; 1.65A {Canavalia ensiformis} SCOP: c.1.8.5 | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* | Back alignment and structure |
|---|
| >2xtk_A CHIA1, class III chitinase CHIA1; hydrolase, GH18; HET: AZM; 2.00A {Aspergillus fumigatus} PDB: 2xuc_A 2xvp_A 2xvn_A* | Back alignment and structure |
|---|
| >1eok_A Endo-beta-N-acetylglucosaminidase F3; alpha/beta-barrel, hydrolase; 1.80A {Elizabethkingia meningoseptica} SCOP: c.1.8.5 PDB: 1eom_A* | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* | Back alignment and structure |
|---|
| >1ta3_A XIP-1, xylanase inhibitor protein I; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Triticum aestivum} SCOP: c.1.8.5 PDB: 1om0_A* 1te1_A* | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3mu7_A XAIP-II, xylanase and alpha-amylase inhibitor protein; TIM barell, amylase/xylanase inhibitory protein, hydrolase I; 1.29A {Scadoxus multiflorus} SCOP: c.1.8.0 PDB: 3o9n_A 3oih_A* 3hu7_A 3m7s_A* 3d5h_A* | Back alignment and structure |
|---|
| >3poh_A Endo-beta-N-acetylglucosaminidase F1; TIM barrel, structural genomics, joint center for structural genomics, JCSG; 1.55A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A | Back alignment and structure |
|---|
| >2dsk_A Chitinase; catalytic domain, active domain, crystalline CHIT barrel, hydrolase; 1.50A {Pyrococcus furiosus} PDB: 3a4w_A* 3a4x_A* 3afb_A | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 | Back alignment and structure |
|---|
| >1dqc_A Tachycitin; disulfide-rich, antimicrobial protein; NMR {Tachypleus tridentatus} SCOP: g.31.1.1 | Back alignment and structure |
|---|
| >2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >2vtf_A Endo-beta-N-acetylglucosaminidase; hydrolase, family 85, glycosidase, carbohydrat binding; HET: B3P PGE; 1.79A {Arthrobacter protophormiae} PDB: 3fhq_A* 3fha_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A | Back alignment and structure |
|---|
| >3gdb_A Endo-D, putative uncharacterized protein SPR0440; alpha-beta-barrels, cell WALL, peptidoglycan-anchor, secreted, hydrolase; HET: PGE; 1.87A {Streptococcus pneumoniae} PDB: 2xqx_A | Back alignment and structure |
|---|
| >2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 | Back alignment and structure |
|---|
| >2aam_A Hypothetical protein TM1410; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE UNL; 2.20A {Thermotoga maritima} SCOP: c.1.8.15 | Back alignment and structure |
|---|
| >3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 2417 | ||||
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 1e-66 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 8e-53 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 4e-49 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 1e-32 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 4e-32 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 1e-17 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 2e-17 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 2e-16 | |
| d1jnda1 | 327 | c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth f | 4e-06 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 2e-64 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 3e-39 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 6e-34 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 1e-32 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 1e-20 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 3e-12 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 1e-11 | |
| d1goia2 | 356 | c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic | 0.001 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 1e-63 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 9e-49 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 7e-44 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 2e-25 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 1e-18 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 0.003 | |
| d1edqa2 | 358 | c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalyt | 0.004 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 9e-63 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 2e-51 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 1e-44 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 2e-28 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 6e-27 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 2e-14 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 4e-14 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 4e-13 | |
| d1vf8a1 | 302 | c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin | 3e-05 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 6e-61 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 6e-52 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 3e-44 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 9e-26 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 4e-23 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 2e-04 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 2e-04 | |
| d1w9pa1 | 333 | c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergil | 0.004 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 2e-60 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 3e-50 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 5e-46 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 5e-29 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 2e-28 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 5e-15 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 7e-15 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 2e-14 | |
| d1wb0a1 | 297 | c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Huma | 2e-05 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 2e-59 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 2e-52 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 3e-41 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 2e-27 | |
| d1ll7a1 | 330 | c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus ( | 1e-19 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 5e-58 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 7e-44 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 1e-41 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 5e-20 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 7e-18 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 8e-08 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 6e-07 | |
| d1kfwa1 | 374 | c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitina | 9e-07 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 1e-57 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 8e-46 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 3e-42 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 8e-29 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 1e-23 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 8e-16 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 4e-15 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 5e-15 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 2e-13 | |
| d2pi6a1 | 292 | c.1.8.5 (A:1-239,A:308-361) Signal processing prot | 1e-06 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 1e-56 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 1e-47 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 3e-43 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 3e-23 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 1e-19 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 1e-08 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 6e-08 | |
| d1itxa1 | 347 | c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillu | 5e-07 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 2e-52 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 9e-41 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 5e-40 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 1e-20 | |
| d1edta_ | 265 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {St | 3e-15 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 1e-49 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 2e-39 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 4e-38 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 4e-18 | |
| d2ebna_ | 285 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 1e-15 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 2e-41 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 4e-31 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 1e-27 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 2e-14 | |
| d1nara_ | 289 | c.1.8.5 (A:) Seed storage protein {Vicia narbonens | 5e-11 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 2e-31 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 1e-19 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 7e-19 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 4e-08 | |
| d2hvma_ | 273 | c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para | 1e-04 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 1e-20 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 2e-16 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 2e-16 | |
| d1vf8a2 | 70 | d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mo | 5e-13 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 2e-20 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 1e-16 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 9e-15 | |
| d1wb0a2 | 68 | d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo | 4e-13 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 3e-20 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 1e-19 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 1e-10 | |
| d1eoka_ | 282 | c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Fl | 3e-07 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 9e-20 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 3e-17 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 1e-14 | |
| d2pi6a2 | 68 | d.26.3.1 (A:240-307) Signal processing protein (SP | 3e-14 | |
| d1jnda2 | 92 | d.26.3.1 (A:279-370) Imaginal disc growth factor-2 | 3e-18 | |
| d1jnda2 | 92 | d.26.3.1 (A:279-370) Imaginal disc growth factor-2 | 3e-13 | |
| d1jnda2 | 92 | d.26.3.1 (A:279-370) Imaginal disc growth factor-2 | 6e-13 | |
| d1jnda2 | 92 | d.26.3.1 (A:279-370) Imaginal disc growth factor-2 | 1e-07 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 5e-18 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 5e-11 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 1e-09 | |
| d1ta3a_ | 274 | c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I { | 6e-05 | |
| d1cnva_ | 283 | c.1.8.5 (A:) Seed storage protein {Jack bean (Cana | 3e-17 | |
| d1cnva_ | 283 | c.1.8.5 (A:) Seed storage protein {Jack bean (Cana | 8e-10 | |
| d1cnva_ | 283 | c.1.8.5 (A:) Seed storage protein {Jack bean (Cana | 1e-09 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 2e-11 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 7e-07 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 6e-06 | |
| d1itxa2 | 72 | d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circul | 9e-06 | |
| d1dqca_ | 73 | g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachyple | 2e-11 | |
| d1dqca_ | 73 | g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachyple | 3e-11 | |
| d1dqca_ | 73 | g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachyple | 4e-11 | |
| d1dqca_ | 73 | g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachyple | 0.001 | |
| d1edqa3 | 73 | d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc | 1e-08 | |
| d1edqa3 | 73 | d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc | 5e-05 | |
| d1edqa3 | 73 | d.26.3.1 (A:444-516) Chitinase A {Serratia marcesc | 0.001 | |
| d1kfwa2 | 61 | d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar | 3e-08 | |
| d1kfwa2 | 61 | d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar | 2e-05 | |
| d1kfwa2 | 61 | d.26.3.1 (A:328-388) Psychrophilic chitinase B {Ar | 0.001 |
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Imaginal disc growth factor-2 species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Score = 226 bits (578), Expect = 1e-66
Identities = 71/300 (23%), Positives = 134/300 (44%), Gaps = 36/300 (12%)
Query: 1712 KIVCYFTNWAWYRQSGGKYLPSDIDSDL--CTHVIYGFAVLDTDQLVIKPHDTWADLDNK 1769
+VCY+ + ++ R+ GK L D++ L C+H++YG+A L + L + D+
Sbjct: 2 NLVCYYDSSSYTREGLGKLLNPDLEIALQFCSHLVYGYAGLRGENLQAYSMNENLDIYKH 61
Query: 1770 FYEKVTALKKK--GVKVTLAIGGWNDS---AGNKYSRLV-NSQQARSKFIAHVVNFILEH 1823
+ +VT+LK+K +KV L++GG +D NKY L+ + + FI + +
Sbjct: 62 QFSEVTSLKRKYPHLKVLLSVGGDHDIDPDHPNKYIDLLEGEKVRQIGFIRSAYELVKTY 121
Query: 1824 NFDGLDLDWEYPKC---------------------WQVDCKQGPASDKQGFADLIKELRA 1862
FDGLDL +++PK A K+ F L+++++
Sbjct: 122 GFDGLDLAYQFPKNKPRKVHGDLGLAWKSIKKLFTGDFIVDPHAALHKEQFTALVRDVKD 181
Query: 1863 AFNPHDLLLSAAVSPSKAVIDNAYDIPVMSENLDWISVMTYDYHGQW--DKKTGHVAPMY 1920
+ LLS V P+ +DIP ++ +D++++ T+D+ ++ + AP+Y
Sbjct: 182 SLRADGFLLSLTVLPNVNSTWY-FDIPALNGLVDFVNLATFDFLTPARNPEEADYSAPIY 240
Query: 1921 ALPNDT--TPTFNANYSLHYWVSHGADRKKVIFGMPMYGQSFTLADKNKNGLNSQTYGGA 1978
NA++ + YW+S G K+ G+ + ++K + GG
Sbjct: 241 HPDGSKDRLAHLNADFQVEYWLSQGFPSNKINLGVA-TDDPDSASNK-AAYARVKNLGGV 298
|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 327 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 356 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} Length = 358 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 302 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} Length = 333 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} Length = 330 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 374 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 292 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 347 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} Length = 265 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} Length = 285 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} Length = 289 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} Length = 273 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} Length = 282 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} Length = 68 | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} Length = 274 | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Length = 283 | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Length = 283 | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} Length = 283 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} Length = 72 | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 73 | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 73 | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 73 | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} Length = 73 | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} Length = 73 | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} Length = 61 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 2417 | |||
| d1wb0a1 | 297 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d2pi6a1 | 292 | Signal processing protein (SPC-40, MGP-40) {Sheep | 100.0 | |
| d1jnda1 | 327 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 100.0 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 100.0 | |
| d1jnda1 | 327 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 100.0 | |
| d1wb0a1 | 297 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 100.0 | |
| d2pi6a1 | 292 | Signal processing protein (SPC-40, MGP-40) {Sheep | 100.0 | |
| d1vf8a1 | 302 | Chitinase-like lectin ym1, saccharide binding doma | 100.0 | |
| d1edqa2 | 358 | Chitinase A, catalytic domain {Serratia marcescens | 100.0 | |
| d1kfwa1 | 374 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 100.0 | |
| d1edqa2 | 358 | Chitinase A, catalytic domain {Serratia marcescens | 100.0 | |
| d1kfwa1 | 374 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 100.0 | |
| d1itxa1 | 347 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 100.0 | |
| d1itxa1 | 347 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 100.0 | |
| d1w9pa1 | 333 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 100.0 | |
| d1w9pa1 | 333 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 100.0 | |
| d1ll7a1 | 330 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 100.0 | |
| d1ll7a1 | 330 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 100.0 | |
| d1goia2 | 356 | Chitinase B, catalytic domain {Serratia marcescens | 100.0 | |
| d1goia2 | 356 | Chitinase B, catalytic domain {Serratia marcescens | 100.0 | |
| d1nara_ | 289 | Seed storage protein {Vicia narbonensis, Narbonin | 99.97 | |
| d1nara_ | 289 | Seed storage protein {Vicia narbonensis, Narbonin | 99.96 | |
| d1edta_ | 265 | Endo-beta-N-acetylglucosaminidase {Streptomyces pl | 99.96 | |
| d1edta_ | 265 | Endo-beta-N-acetylglucosaminidase {Streptomyces pl | 99.96 | |
| d2ebna_ | 285 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.95 | |
| d2hvma_ | 273 | Hevamine A (chitinase/lysozyme) {Para rubber tree | 99.94 | |
| d2ebna_ | 285 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.94 | |
| d2hvma_ | 273 | Hevamine A (chitinase/lysozyme) {Para rubber tree | 99.94 | |
| d1cnva_ | 283 | Seed storage protein {Jack bean (Canavalia ensifor | 99.91 | |
| d1ta3a_ | 274 | Xylanase inhibitor protein I, XIP-I {Wheat (Tritic | 99.91 | |
| d1cnva_ | 283 | Seed storage protein {Jack bean (Canavalia ensifor | 99.91 | |
| d1ta3a_ | 274 | Xylanase inhibitor protein I, XIP-I {Wheat (Tritic | 99.9 | |
| d1eoka_ | 282 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.75 | |
| d1eoka_ | 282 | Endo-beta-N-acetylglucosaminidase {Flavobacterium | 99.7 | |
| d1vf8a2 | 70 | Chitinase-like lectin ym1 {Mouse (Mus musculus) [T | 99.44 | |
| d1vf8a2 | 70 | Chitinase-like lectin ym1 {Mouse (Mus musculus) [T | 99.4 | |
| d1wb0a2 | 68 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 99.36 | |
| d2pi6a2 | 68 | Signal processing protein (SPC-40, MGP-40) {Sheep | 99.34 | |
| d2pi6a2 | 68 | Signal processing protein (SPC-40, MGP-40) {Sheep | 99.34 | |
| d1wb0a2 | 68 | Chitotriosidase {Human (Homo sapiens) [TaxId: 9606 | 99.34 | |
| d1jnda2 | 92 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 99.21 | |
| d1jnda2 | 92 | Imaginal disc growth factor-2 {Fruit fly (Drosophi | 99.11 | |
| d1dqca_ | 73 | Tachycitin {Horseshoe crab (Tachypleus tridentatus | 98.91 | |
| d1dqca_ | 73 | Tachycitin {Horseshoe crab (Tachypleus tridentatus | 98.91 | |
| d1itxa2 | 72 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 98.74 | |
| d1itxa2 | 72 | Chitinase A1 {Bacillus circulans [TaxId: 1397]} | 98.73 | |
| d1edqa3 | 73 | Chitinase A {Serratia marcescens [TaxId: 615]} | 98.56 | |
| d1edqa3 | 73 | Chitinase A {Serratia marcescens [TaxId: 615]} | 98.55 | |
| d1kfwa2 | 61 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 98.42 | |
| d1kfwa2 | 61 | Psychrophilic chitinase B {Arthrobacter sp., tad20 | 98.36 | |
| d1goia3 | 88 | Chitinase B {Serratia marcescens [TaxId: 615]} | 97.1 | |
| d1goia3 | 88 | Chitinase B {Serratia marcescens [TaxId: 615]} | 96.42 | |
| d1w9pa2 | 62 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 96.31 | |
| d1ll7a2 | 62 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 96.04 | |
| d1w9pa2 | 62 | Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | 95.47 | |
| d1ll7a2 | 62 | Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: | 95.43 | |
| d2aama1 | 285 | Hypothetical protein TM1410 {Thermotoga maritima [ | 90.76 | |
| d2aama1 | 285 | Hypothetical protein TM1410 {Thermotoga maritima [ | 88.73 | |
| d2bhua3 | 420 | Glycosyltrehalose trehalohydrolase, central domain | 87.33 |
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: (Trans)glycosidases family: Type II chitinase domain: Chitotriosidase species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.9e-56 Score=548.80 Aligned_cols=283 Identities=43% Similarity=0.894 Sum_probs=257.5
Q ss_pred EEEEEEecCcccccCCCCCCCCCCCCCCccEEEEEeEEecCCCcEEccCCCcchhhHHHHHHHHHHHhC--CCEEEEEEc
Q psy4449 1712 KIVCYFTNWAWYRQSGGKYLPSDIDSDLCTHVIYGFAVLDTDQLVIKPHDTWADLDNKFYEKVTALKKK--GVKVTLAIG 1789 (2417)
Q Consensus 1712 ~vvcY~~~W~~yr~~~~~~~~~~i~~~~cTHIiyaFa~i~~~~~~~~~~d~~~d~~~~~~~~i~~lk~~--glKvllsIG 1789 (2417)
||||||++|++||.+..+|.|++|++++||||+|+|+.++.++..+. +|. +..+++.+++||++ ++|||||||
T Consensus 2 kvvcYy~~w~~~~~~~~~~~~~~i~~~~~THi~yaf~~~~~~~~~~~---~~~--~~~~~~~~~~lk~~~p~lKvllSiG 76 (297)
T d1wb0a1 2 KLVCYFTNWAQYRQGEARFLPKDLDPSLCTHLIYAFAGMTNHQLSTT---EWN--DETLYQEFNGLKKMNPKLKTLLAIG 76 (297)
T ss_dssp EEEEEEETTGGGSCGGGCCCGGGCCTTTCSEEEEEEEEEETTEEECS---STT--HHHHHHHHHHGGGTCTTCEEEEEEE
T ss_pred eEEEEECcCcccCCCCCCCChhHCCcccCCEEEEEEEEccCCccccC---Ccc--cHHHHHHHHHHHHhCCCCeEEEEEe
Confidence 89999999999999999999999999999999999999987754433 333 34677889999887 699999999
Q ss_pred CCCCCCCcchhHhhcCHHHHHHHHHHHHHHHHHcCCCeEEEeecCCCCccCCCCCCCcchhhhHHHHHHHHHHhcC----
Q psy4449 1790 GWNDSAGNKYSRLVNSQQARSKFIAHVVNFILEHNFDGLDLDWEYPKCWQVDCKQGPASDKQGFADLIKELRAAFN---- 1865 (2417)
Q Consensus 1790 Gw~~s~~~~fs~~~~~~~~R~~Fi~siv~~l~~ygfDGiDiDwEyP~~~~~~~~~~~~~d~~~~~~llkeLr~~l~---- 1865 (2417)
||+.+ +..|+.|++++++|++||++|++||++|||||||||||||.. .++.+.|+.+|+.|+++||++|+
T Consensus 77 G~~~~-~~~fs~~~~~~~~R~~Fi~siv~~l~~y~fDGiDiDWE~p~~-----~~~~~~d~~n~~~l~~~Lr~~l~~~~~ 150 (297)
T d1wb0a1 77 GWNFG-TQKFTDMVATANNRQTFVNSAIRFLRKYSFDGLDLDWEYPGS-----QGSPAVDKERFTTLVQDLANAFQQEAQ 150 (297)
T ss_dssp CTTTC-SHHHHHHHTSHHHHHHHHHHHHHHHHHTTCCEEEEECSCTTS-----TTCCTTHHHHHHHHHHHHHHHHHHHHH
T ss_pred ccccc-cchHHHHhhhhHHHHHHHHHHHHHHHHcCCCceeEEEEeccc-----cCCChHHHHHHHHHHHHHHHHHhhhhh
Confidence 99875 478999999999999999999999999999999999999973 34567899999999999999996
Q ss_pred ---CCCcEEEEEECCChhhhcccCCccccccCcceEEEEeccCCCCCCCCCCCCCcCCCCCCCCC--CCccHHHHHHHHH
Q psy4449 1866 ---PHDLLLSAAVSPSKAVIDNAYDIPVMSENLDWISVMTYDYHGQWDKKTGHVAPMYALPNDTT--PTFNANYSLHYWV 1940 (2417)
Q Consensus 1866 ---~~~~~Ls~av~~~~~~~~~~yd~~~l~~~vD~i~vMtYD~~g~w~~~tg~~aPLy~~~~~~~--~~~nv~~~v~~~~ 1940 (2417)
...+++++++++....+..+|++.+|.+++||||||+||+||+|+..+||++|||....... ..++++.+|++|+
T Consensus 151 ~~~~~~~~~s~~~~~~~~~~~~~~~~~~i~~~vD~invmtYD~~g~~~~~tg~~aply~~~~~~~~~~~~~~d~~v~~~~ 230 (297)
T d1wb0a1 151 TSGKERLLLSAAVPAGQTYVDAGYEVDKIAQNLDFVNLMAYDFHGSWEKVTGHNSPLYKRQEESGAAASLNVDAAVQQWL 230 (297)
T ss_dssp HHCSCCCEEEEEECCCHHHHHHHCCHHHHHHHCSEEEECCCCSSCTTSSBCCCSSCSSCCTTCCGGGGGCSHHHHHHHHH
T ss_pred hcCCCceeEEEEccCchhHhhhccCHHHHHhhCCEEEEEecccCCCCCCCCCCCCcCCCCccccCCCCCCCHHHHHHHHH
Confidence 34689999999888777788999999999999999999999999999999999998766543 5689999999999
Q ss_pred HcCCCCCcEeeeccccceeeEeccCCCCCCCCccccCCCCCCccccCccchHHHHHHhhhcCCcEEEEcCCCceeeEEee
Q psy4449 1941 SHGADRKKVIFGMPMYGQSFTLADKNKNGLNSQTYGGAEAGENTRARGFLAYYEICDKIQKDGWVVVRDRKRRIGPYAFK 2020 (2417)
Q Consensus 1941 ~~G~p~~KLvlGiP~YG~~ftl~~~~~~~~~a~~~g~g~~g~~t~~~G~l~y~eic~~~~~~~~~~~~D~~~~~~py~~~ 2020 (2417)
++|+|++|||||||
T Consensus 231 ~~G~p~~KlvlGip------------------------------------------------------------------ 244 (297)
T d1wb0a1 231 QKGTPASKLILGMP------------------------------------------------------------------ 244 (297)
T ss_dssp HTTCCGGGEEEEEE------------------------------------------------------------------
T ss_pred HcCCCHHHeEEEec------------------------------------------------------------------
Confidence 99999999999987
Q ss_pred CCEEEEeCCHHHHHHHHHHhhcCCcceEEEEeccCccccCc-CCCCCchHHHHHHHHh
Q psy4449 2021 GDQWVGFDDQAMIHHKAEFVKYNDLGGAMIWALDLDDFKNF-CGCESYPLLKTINRVL 2077 (2417)
Q Consensus 2021 ~~~wv~Ydd~~Si~~K~~~~k~~gLgGvmiW~ld~DDf~g~-Cg~~~~pLl~ai~~~l 2077 (2417)
|||++||+.|++|++++||||||+|+|++|||+|. ||.++||||+||++.|
T Consensus 245 ------yd~~~si~~K~~~~~~~glgGv~~W~l~~DD~~G~~cg~~~~pLl~ai~~~l 296 (297)
T d1wb0a1 245 ------TDDVESFKTKVSYLKQKGLGGAMVWALDLDDFAGFSCNQGRYPLIQTLRQEL 296 (297)
T ss_dssp ------SCCHHHHHHHHHHHHHTTCCEEEEECGGGSCTTCSSSSSCSSHHHHHHHHHC
T ss_pred ------cCCHHHHHHHHHHHHhcCCceEEEEeCccccCCCCcCCCCCccHHHHHHHHh
Confidence 69999999999999999999999999999999996 9999999999999987
|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jnda1 c.1.8.5 (A:2-278,A:371-420) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wb0a1 c.1.8.5 (A:22-266,A:337-388) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pi6a1 c.1.8.5 (A:1-239,A:308-361) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1vf8a1 c.1.8.5 (A:1-245,A:316-372) Chitinase-like lectin ym1, saccharide binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1edqa2 c.1.8.5 (A:133-443,A:517-563) Chitinase A, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kfwa1 c.1.8.5 (A:10-327,A:389-444) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1itxa1 c.1.8.5 (A:33-337,A:410-451) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1w9pa1 c.1.8.5 (A:39-298,A:361-433) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1ll7a1 c.1.8.5 (A:36-292,A:355-427) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1goia2 c.1.8.5 (A:3-291,A:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} | Back information, alignment and structure |
|---|
| >d1nara_ c.1.8.5 (A:) Seed storage protein {Vicia narbonensis, Narbonin [TaxId: 3912]} | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d1edta_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Streptomyces plicatus, endoglycosidase H [TaxId: 1922]} | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d2ebna_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F1 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d2hvma_ c.1.8.5 (A:) Hevamine A (chitinase/lysozyme) {Para rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1cnva_ c.1.8.5 (A:) Seed storage protein {Jack bean (Canavalia ensiformis), Concanavalin B [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1ta3a_ c.1.8.5 (A:) Xylanase inhibitor protein I, XIP-I {Wheat (Triticum aestivum) [TaxId: 4565]} | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d1eoka_ c.1.8.5 (A:) Endo-beta-N-acetylglucosaminidase {Flavobacterium meningosepticum, endoglycosidase F3 [TaxId: 238]} | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vf8a2 d.26.3.1 (A:246-315) Chitinase-like lectin ym1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d2pi6a2 d.26.3.1 (A:240-307) Signal processing protein (SPC-40, MGP-40) {Sheep (Ovis aries) [TaxId: 9940]} | Back information, alignment and structure |
|---|
| >d1wb0a2 d.26.3.1 (A:267-336) Chitotriosidase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} | Back information, alignment and structure |
|---|
| >d1dqca_ g.31.1.1 (A:) Tachycitin {Horseshoe crab (Tachypleus tridentatus) [TaxId: 6853]} | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1itxa2 d.26.3.1 (A:338-409) Chitinase A1 {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1edqa3 d.26.3.1 (A:444-516) Chitinase A {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1kfwa2 d.26.3.1 (A:328-388) Psychrophilic chitinase B {Arthrobacter sp., tad20 [TaxId: 1667]} | Back information, alignment and structure |
|---|
| >d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1goia3 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d1w9pa2 d.26.3.1 (A:299-360) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} | Back information, alignment and structure |
|---|
| >d1ll7a2 d.26.3.1 (A:293-354) Chitinase 1 {Fungus (Coccidioides immitis) [TaxId: 5501]} | Back information, alignment and structure |
|---|
| >d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2aama1 c.1.8.15 (A:28-312) Hypothetical protein TM1410 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|