Psyllid ID: psy4681


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180------1190------1200------1210------1220------1230------1240------1250------1260------1270------1280------1290------1300------1310------1320------1330------1340------1350------1360------1370------1380------1390------1400------1410------1420------1430------1440------1450------1460------1470------1480------1490------1500------1510------1520------1530------1540------1550------1560------1570------1580------1590------1600------1610------1620------1630------1640------1650------1660------1670------1680------1690------1700------1710------1720------1730------1740------1750------1760------1770------1780------1790------1800------1810------1820------1830------1840------1850------1860------1870------1880------1890------1900------1910------1920------1930
MKLNLNKEKVRQLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRSEKNLTSEEWRQLVIKNARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMRIHTGERPVCCHICGKKLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKRENVPSTKDQSHKKRDQKIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSLKHLKRHKMKHLQENGELPPSKIQKCPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKHNKVYNKAQYQDYQIQDLSMDQYRELVQSKERKCPKCEKEFSTPRYMRKHLRKKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQQHMETHSGEKKICCHICGKKLRGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEHSDKLCGEDEESDELDDEEDTRNVTSDTKFPCRLCSQEFGTKKQRKKHERKDHETRGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQEFDTKEQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHISSVHLKREQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVYKI
ccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccHHHcccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccHHHHccccccccccccccccHHcccccccHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccHHcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccHHHHHHccccccccccccccccHHccHHHHHHHccccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccHHccccccccccccccccHHcccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccHHHHcccccccccccccccccccccccHHHHHHccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccccc
ccHHHHHHcccccccEcccccccEcccccHHHHHHHcccccccEcccccccEccccHHHHHHHHHccccccccccccEEcccccccEccccHHHHHHHHcccccccccccccHEHEEEcccccccEcccccccEccccHHHHHHHHHcccccccEcccccccEccccHHHHHHHHccccccccccEEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccccHHccHHHHHHHHHcHHcccccccEcccccccEccccHHHHHHHHHcccccccEcccccccEccccHHHHHEEEEEcccccccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHccccccccccccccEcccccccEccccHHHHHHHHcccccccccHHccHcHHHHHHHHcHHHHccccEEcccccccHHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccccHccccEccccccHEHcEEcccccccccccccHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccEEcccccccEccccHHHHHHHHcccccccccccccEEcccccccEccccHHHHHHHHcccccccccHHccHcHHHHHHHHHHHcccccccccHHccHcHHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccccEcccccccEccccHHHHHHHHHccHEcccccccEccccccccccccHHHHHHHHHcccccccEcccccccEccccHHHHHHHHEcccccccccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccccccccccccHHHHHHHHcccccccEcccccccEccccHHHHHcccccEcccccccEccccHHHHHHHHcccccccccccccEEcccccccEccccHHHHHHHHcccccccccHHccHcHHHHHHHHHHHcccccccccHHccHcHHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHcccccccccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccEEccccccEEccHHHHHHHHHHcccccccEcccccccEEcHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccccHccccccccEcccccccEccccHHHHHHHHccccccccccccccccccHHHHHHHHccccccccccccccEEcccccccEccccHHHHHHHHccccccccccHcccHHHHcccccccccccccccccccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHccccccccEcccccccEccccHHHHHHHEEEcccccccEccccccccccccHHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHccccccccEcccccccEccccHHHHHHHHHccccccccccccEEcccccccEcccccccEccccHHHHHHHHcccccccEcccccccEccccHHHHHHHHcccccccccccccc
mklnlnkeKVRQLNVEchhcamryssksqLLDHlnshtglkpyichICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHfrseknltsEEWRQLVIKNarkcpicgdryksgtdmrrhyrdlhdstrkcpcevcgkrfnsikrVKQHRKVVHMGIKQKKKFECAHCSKtylsrvgledhinnhtgekghiceicnrdfYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVktcplckktyQSAKGMRLHIREVhskvrphqckgcgkyfksQRHLVQHERRVHLGVKkikhsnfecfhcgakfisrthiadhmtshtgiknhvcsICQSTYTTARGlkrhnknhlreagvlrademykcdkcdKLFIEQSEMvqhrdwvhgdkcylckicgARVKSNLKAHMRihtgerpvcchicgkklrgKLKDHMlthtgerpfgcevcgstykYKYYLAVHMRkhtgerpyvcnycghsfaarpafnlhlkrhtergdvrhieCQHSLKIIEYKIYQWISIENWFKIKrenvpstkdqshkkrdqKIECNICGALFATKYTLqdhmnthtgnkykcdvcdngysslKHLKRHKMKhlqengelppskiqkcpichkiFIRNYMLRKHldfvhgnkyhscKVCGAEIKGSLKEHMIVhtgerkycchicgkkmrgKLKEHMlthtgerpyaceicggtfktkwYLGVhmrkhngerpymcsecgqsfaARSAFSLHLKkhagfkqtieceychntftfetglmgvvtrDEWEILLRDKVricpkcnkefysdrTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGirntgpnqllechycgitknnkTLLRDHIsahlgikpyccifceekyfsKKSLKRHEAkhnkvynkaqyqdyqiqDLSMDQYRELVQSkerkcpkcekefstprymrkhlrkkfkcdvcgngytsvKHLKRHKIkhmkesgelppsmihkcptcykifTENHALKKHldwvhgnkchicKVCGAKIKGNLQqhmethsgekkicchiCGKKLRGRLNEhmlthtgerpyacefcgssfkdksylRIHIRkhngerpftcsecgqsfAARSAFSLHLKKHAGSHILRRHIGytvfckecnigfyssthlhshgikvhglppficehcskpftskgnltvHVKYYHAKTLFECNICLKTFNFKTSYKRHLkqhddsvtyypctvcsknlsspyrlkTHMLIHANNrvftcevcgkgfiqKRYLEEHKRvhtgykpyacdlcskqftqksTLNIHRKLHLNIKDFICDLcgakfyefntyvthVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRenctnhimechsydvfewkdkgvikehinpLFLKKFAFalncpvcklyfdresdfhshmqsyhnshsycmkcnmyIFNSRLQLHKRKHTREEEQWTKVNIEYScdccemswsnpkdfgqhlnlvkcsycanaafcssKALTRHLVEehsdklcgedeesdelddeedtrnvtsdtkfpcrlcsqefgtkkqrkkherkdhetrgvfscdlcsytstrKYYLVKHKSRHIKEYTVFCKKcqlgflsknelnvhnikqhdaqphtcpvckkifvnkfnltthkklhlpmnrnhqcdtcgksftgnnhlkrHIYSVHLkrdtkfpcrlcsqefdTKEQRkkherkdhetqglfscdlcsytstqkYYLVKHKSRHIKDYNVFCKIcqlgflskneldvhnikqhdaqphtcpvckkIFVNKVTLAAHkkihlpidkncqcdvcgksfartfHLKSHISSVHLKREQRKkherkdhetqglfscdlcsytstqkYYLVKHKSRHIKDYNVFCKIcqlgflskneldvhnikqhdaqphtcpvyki
MKLNLNKEKVRQLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRseknltseEWRQLViknarkcpicgdryksgtdmrrhyrdlhdstrkcpcevcgkrfnsikrvkqhrkvvhmgikqkkkfecAHCSKTYLSRVGLEDHINnhtgekghiCEICNRDFYSDAMLKRHLVKHsrmiketseefvetgsitreEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVhskvrphqCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTtarglkrhnknhlreagvlrademYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMrihtgerpvcchICGKKLRGKLKDHMlthtgerpfgcevcgSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKRENvpstkdqshkkrdqkIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSLKHLKRHKMKHLqengelppskiqkcPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLrdkvricpkcnkefysdrtmrrHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKhnkvynkaqyqdyQIQDLSMDQYRELVQskerkcpkcekefstprymrkhlrkkfkcdvcgngYTSVKHLKRHKIKHmkesgelppsmiHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQQHmethsgekkiCCHICGKKLRGRLNEHMLthtgerpyaCEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHtreeeqwtkVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEhsdklcgedeesdelddeedtrnvtsdtkfpcrlcsqefgtkkqrkkherkdhetrgvfscdlcsytsTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTthkklhlpmnrnHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQEfdtkeqrkkherkdhetqglfscdlcsyTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQhdaqphtcpvCKKIFVNKVTLAAHKkihlpidkncqCDVCGKSFARTfhlkshissvhlkreqrkkherkdhetqglfscdlcsyTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIkqhdaqphtcpvyki
MKLNLNKEKVRQLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRSEKNLTSEEWRQLVIKNARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMRIHTGERPVCCHICGKKLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKRENVPSTKDQSHKKRDQKIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSlkhlkrhkmkhlQENGELPPSKIQKCPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKHNKVYNKAQYQDYQIQDLSMDQYRELVQSKERKCPKCEKEFSTPRYMRKHLRKKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQQHMETHSGEKKICCHICGKKLRGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEHSDKLCGedeesdelddeedTRNVTSDTKFPCRLCSQEFGTKKQRKKHERKDHETRGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQEFDTKEQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHISSVHLKREQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVYKI
***********QLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRSEKNLTSEEWRQLVIKNARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMRIHTGERPVCCHICGKKLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKR****************KIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSLKHL*****************KIQKCPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLK****KHNKVYNKAQYQDYQIQDLSMDQYR*******************PRYMRKHLRKKFKCDVCGNGYTSVKHLKRHKI***********SMIHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQQHMETHSGEKKICCHICGKKLRGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLV*********************************************************RGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCS********************GLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHISS*******************GLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIK**************
MKLNLNKEKVRQLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRSEKNLTSEEWRQLVIKNARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMRIHTGERPVCCHICGKKLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKRENVPSTKDQSHKKRDQKIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSLKHLKRHKMKHLQENGELPPSKIQKCPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKHNKVYNKAQYQDYQIQDLSMDQYRELVQSKERKCPKCEKEFSTPRYMRKHLRKKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQQHMETHSGEKKICCHICGKKLRGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEHSDKLCGEDEESDELDDEEDTRNVTSDTKFPCRLCSQEFGTKKQRKKHERKDHETRGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQEFDTKEQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHISSVHLKREQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVYKI
MKLNLNKEKVRQLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRSEKNLTSEEWRQLVIKNARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMRIHTGERPVCCHICGKKLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKREN*************QKIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSLKHLKRHKMKHLQENGELPPSKIQKCPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKHNKVYNKAQYQDYQIQDLSMDQYRELVQSKERKCPKCEKEFSTPRYMRKHLRKKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQ*********KKICCHICGKKLRGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEHS***********************SDTKFPCRLCSQEF***************TRGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQEF***************TQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHI*******************TQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVYKI
MKLNLNKEKVRQLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRSEKNLTSEEWRQLVIKNARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMRIHTGERPVCCHICGKKLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKRENVPSTKDQSHKKRDQKIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSLKHLKRHKMKHLQENGELPPSKIQKCPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKHNKVYNKAQYQDYQIQDLSMDQYRELVQSKERKCPKCEKEFSTPRYMRKHLRKKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQQHMETHSGEKKICCHICGKKLRGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEHSDKLCGEDEESDELDDEEDTRNVTSDTKFPCRLCSQEFGTKKQRKKHERKDHETRGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQEFDTKEQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHISSVHLKREQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCP*Y**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLNLNKEKVRQLNVECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVEDMYQCDICSKMFIEHHAMVKHRDWLHAIHFRSEKNLTSEEWRQLVIKNARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARVKSNLKAHMRIHTGERPVCCHICGKKLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKIIEYKIYQWISIENWFKIKRENVPSTKDQSHKKRDQKIECNICGALFATKYTLQDHMNTHTGNKYKCDVCDNGYSSLKHLKRHKMKHLQENGELPPSKIQKCPICHKIFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGSLKEHMIVHTGERKYCCHICGKKMRGKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKHNKVYNKAQYQDYQIQDLSxxxxxxxxxxxxxxxxxxxxxFSTPRYMRKHLRKKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKIKGNLQQHMETHSGEKKICCHICGKKLRGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFAFALNCPVCKLYFDRESDFHSHMQSYHNSHSYCMKCNMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEHSDKLCGEDEESDELDDEEDTRNVTSDTKFPCRLCSQEFGTKKQRKKHERKDHETRGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQEFDTKEQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHISSVHLKREQRKKHERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNIKQHDAQPHTCPVYKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1930 2.2.26 [Sep-21-2011]
A6NN141173 Zinc finger protein 729 O no N/A 0.480 0.791 0.319 1e-117
Q054811191 Zinc finger protein 91 OS no N/A 0.493 0.800 0.311 1e-116
P080451350 Zinc finger protein Xfin N/A N/A 0.554 0.792 0.289 1e-115
O433451167 Zinc finger protein 208 O no N/A 0.503 0.832 0.310 1e-115
A8MQ141090 Zinc finger protein 850 O no N/A 0.473 0.837 0.306 1e-109
A8MXY41036 Zinc finger protein 99 OS no N/A 0.446 0.832 0.315 8e-97
Q8TF20911 Zinc finger protein 721 O no N/A 0.419 0.889 0.311 4e-93
Q8NB50900 Zinc finger protein 62 ho no N/A 0.361 0.775 0.327 9e-89
P10076861 Zinc finger protein 26 OS no N/A 0.344 0.772 0.311 5e-88
Q8C827914 Zinc finger protein 62 OS no N/A 0.364 0.770 0.312 5e-86
>sp|A6NN14|ZN729_HUMAN Zinc finger protein 729 OS=Homo sapiens GN=ZNF729 PE=2 SV=3 Back     alignment and function desciption
 Score =  424 bits (1091), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 333/1041 (31%), Positives = 464/1041 (44%), Gaps = 113/1041 (10%)

Query: 352  HTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQH 411
            HT  K   C  C  ++     L RH + H+R+        +YKC++  K F   S + +H
Sbjct: 174  HTKKKTFKCIKCSKSFFMLSCLIRHKRIHIRQ-------NIYKCEERGKAFKSFSTLTKH 226

Query: 412  RDWVHGDKCYLCKICGARVK--SNLKAHMRIHTGERPVCCHICGKKLR--GKLKDHMLTH 467
            +     DK Y  K CG   K  S    H RIHTGE P  C  CGK       L DH   H
Sbjct: 227  KIIHTEDKPYKYKKCGNAFKFSSTFTKHKRIHTGETPFRCEECGKAFNQSSNLTDHKRIH 286

Query: 468  TGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERG 527
            TGE+ + CE CG  +K       H   HT E+PY C  CG +F    A   H   HT + 
Sbjct: 287  TGEKTYKCEECGKAFKGSSNFNAHKVIHTAEKPYKCEDCGKTFNHFSALRKHKIIHTGKK 346

Query: 528  DVRHIECQHSLKIIEYKIYQWISIENWFKIKRENVPSTKDQSHKKRDQKIECNICGALFA 587
              +  EC         K +   S      +++  +  T ++ +K       C  CG  F 
Sbjct: 347  PYKREECG--------KAFSQSST-----LRKHEIIHTGEKPYK-------CEECGKAFK 386

Query: 588  TKYTLQDHMNTHTGNK-YKCDVCDNGYSSLKHLKRHKMKHLQENGELPPSKIQKCPICHK 646
                L  H   HTG K YKC+ C   +S    LK+HK+ H    G+ P     KC  C K
Sbjct: 387  WSSKLTVHKVVHTGEKPYKCEECGKAFSQFSTLKKHKIIH---TGKKP----YKCEECGK 439

Query: 647  IFIRNYMLRKHLDFVHGNKYHSCKVCGAEIKGS--LKEHMIVHTGERKYCCHICGKKMR- 703
             F  +  L KH     G K + C+ CG   + S  L  H  +HTGE+ Y C  CGK    
Sbjct: 440  AFNSSSTLMKHKIIHTGEKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFNH 499

Query: 704  -GKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAF 762
               L+ H + HTG++PY CE CG  F     L  H   H GE+PY C ECG++F   S  
Sbjct: 500  FSDLRRHKIIHTGKKPYKCEECGKAFSQSSTLRNHQIIHTGEKPYKCEECGKAFKWSSKL 559

Query: 763  SLHLKKHAGFKQTIECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDR 822
            ++H   H G ++  +CE C   F   + L     R    I  R+K+  C +C K F +  
Sbjct: 560  TVHKVIHTG-EKPCKCEECGKAFKHFSAL-----RKHKVIHTREKLYKCEECGKAFNNSS 613

Query: 823  TMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITK 882
             + +H K +H   K + CEEC K F     L RH   IH G       +  +C  CG   
Sbjct: 614  ILAKH-KIIHTGKKPYKCEECGKAFRQSSHLTRH-KAIHTG------EKPYKCEECGKAF 665

Query: 883  NNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEAKHN------------------ 924
            ++ + LR H   H G KPY C  C + +    +L+RH+  H                   
Sbjct: 666  SHFSALRRHKIIHTGKKPYKCEECGKAFSHFSALRRHKIIHTGEKPYKCEECGKAFKWSS 725

Query: 925  -----KVYNKAQYQ------DYQIQDLSMDQYRELVQSKER--KCPKCEKEFSTPRYMRK 971
                 KV + A+            +  S  +  +++ ++E+  KC +C K F++   + K
Sbjct: 726  KLTVHKVIHTAEKPCKCEECGKSFKHFSALRKHKVIHTREKLYKCEECVKAFNSFSALMK 785

Query: 972  HL-----RKKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHA 1026
            H       K +KC+ CG  +     L  HK+ H   +GE P     KC  C K F    A
Sbjct: 786  HKVIHTGEKPYKCEECGKAFKWSSKLTVHKVIH---TGEKPC----KCEECGKAFKHFSA 838

Query: 1027 LKKHLDWVHGNKCHICKVCGAKI--KGNLQQHMETHSGEKKICCHICGKKLR--GRLNEH 1082
            L+KH     G K + C+ CG        L +H + H+GEK   C  CGK       L  H
Sbjct: 839  LRKHKIIHTGEKPYKCEECGKAFHQSSKLAKHKKIHTGEKPYKCEECGKAFNRLSHLTTH 898

Query: 1083 MLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKH 1142
             + HTG++PY CE CG +F   + L  H R H GE+P+ C ECG++F+  S  + H   H
Sbjct: 899  KIIHTGKKPYKCEECGKAFNQSANLTTHKRIHTGEKPYKCEECGRAFSQSSTLTAHKIIH 958

Query: 1143 AGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVH 1202
            AG    +        C+EC   F  S+ L +H I   G   + CE C K F+   +LT H
Sbjct: 959  AGEKPYK--------CEECGKAFSQSSTLTTHKIIHTGEKFYKCEECGKAFSQLSHLTTH 1010

Query: 1203 VKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLI 1262
             + +  +  ++C  C K F   ++   H + H     +Y C VCSK  S    L TH  I
Sbjct: 1011 KRIHSGEKPYKCEECGKAFKQSSTLTTHKRIHAGE-KFYKCEVCSKAFSRFSHLTTHKRI 1069

Query: 1263 HANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNI 1322
            H   + + CE CGK F     L  HK +HTG KPY C+ C K F Q STL+ H+ +H   
Sbjct: 1070 HTGEKPYKCEECGKAFNLSSQLTTHKIIHTGEKPYKCEECGKAFNQSSTLSKHKVIHTGE 1129

Query: 1323 KDFICDLCGAKFYEFNTYVTH 1343
            K +  + CG  F + +   TH
Sbjct: 1130 KPYKYEECGKAFNQSSHLTTH 1150




May be involved in transcriptional regulation.
Homo sapiens (taxid: 9606)
>sp|Q05481|ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens GN=ZNF91 PE=2 SV=2 Back     alignment and function description
>sp|P08045|XFIN_XENLA Zinc finger protein Xfin OS=Xenopus laevis PE=1 SV=1 Back     alignment and function description
>sp|O43345|ZN208_HUMAN Zinc finger protein 208 OS=Homo sapiens GN=ZNF208 PE=2 SV=1 Back     alignment and function description
>sp|A8MQ14|ZN850_HUMAN Zinc finger protein 850 OS=Homo sapiens GN=ZNF850 PE=3 SV=2 Back     alignment and function description
>sp|A8MXY4|ZNF99_HUMAN Zinc finger protein 99 OS=Homo sapiens GN=ZNF99 PE=2 SV=2 Back     alignment and function description
>sp|Q8TF20|ZN721_HUMAN Zinc finger protein 721 OS=Homo sapiens GN=ZNF721 PE=2 SV=2 Back     alignment and function description
>sp|Q8NB50|ZFP62_HUMAN Zinc finger protein 62 homolog OS=Homo sapiens GN=ZFP62 PE=2 SV=3 Back     alignment and function description
>sp|P10076|ZFP26_MOUSE Zinc finger protein 26 OS=Mus musculus GN=Zfp26 PE=2 SV=2 Back     alignment and function description
>sp|Q8C827|ZFP62_MOUSE Zinc finger protein 62 OS=Mus musculus GN=Zfp62 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1930
326667465 2943 PREDICTED: hypothetical protein LOC57172 0.873 0.572 0.282 0.0
3266806671782 PREDICTED: zinc finger protein 729-like 0.8 0.866 0.286 1e-176
392334558 3163 PREDICTED: uncharacterized protein LOC50 0.889 0.542 0.276 1e-174
395514022 3676 PREDICTED: uncharacterized protein LOC10 0.911 0.478 0.276 1e-173
3266682901881 PREDICTED: zinc finger protein 729-like 0.859 0.881 0.284 1e-169
3266663551861 PREDICTED: zinc finger protein 208-like 0.870 0.902 0.272 1e-164
3272889611749 PREDICTED: zinc finger protein 729-like 0.847 0.935 0.285 1e-162
3017898431697 PREDICTED: LOW QUALITY PROTEIN: zinc fin 0.751 0.854 0.288 1e-161
3266671871365 PREDICTED: zinc finger protein 729-like 0.627 0.887 0.308 1e-160
3266671101395 PREDICTED: zinc finger protein 729-like, 0.620 0.858 0.302 1e-160
>gi|326667465|ref|XP_700431.5| PREDICTED: hypothetical protein LOC571721 [Danio rerio] Back     alignment and taxonomy information
 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/2051 (28%), Positives = 856/2051 (41%), Gaps = 366/2051 (17%)

Query: 16   ECHHCAMRYSSKSQLLDHLNSHTGLKPYICHICKNSYVAAKGLKRHLKRHMQATGQLSVE 75
            +C  C   ++ K     H+  HT  KP+ CH C  S+   + LK H++ H   TG    +
Sbjct: 434  QCQQCGKSFNRKQNFQVHMRIHTKEKPFSCHQCGRSFNRKQNLKVHMRVH---TG----D 486

Query: 76   DMYQCDICSKMF-----IEHHAMVKHRDWLHAIH-----FRSEKNLTSEEWRQLVIKNAR 125
              YQC  C K F     ++ H  +  R+  +        F  + +LT  E R    +   
Sbjct: 487  KPYQCQQCGKSFSQKATLDLHMRIHSREKPYKCQHCGESFSQKAHLTGHE-RVHTKEKPY 545

Query: 126  KCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKK 185
             C  CG  +    +++ H R +H   +   C+ CGK FN    +  H +V      ++K 
Sbjct: 546  TCLQCGKCFSLKQNLKLHVR-IHSGEKPYQCQHCGKSFNQRSHLTGHTRV----HTKEKP 600

Query: 186  FECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSRMIKETSE 245
            + C  C K++  +  LE H   HTGEK   C+ C + F     LK H+  H+R       
Sbjct: 601  YNCQQCGKSFNQKQKLEFHTRIHTGEKPFSCQQCGKSFAQQTNLKVHMRVHTR------- 653

Query: 246  EFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQCKGCGKYF 305
                              +R  TC  C K +   + +++H+R VH+  +P+ C+ CGK F
Sbjct: 654  ------------------ERPYTCQDCGKRFFHKQNLKVHMR-VHTGEKPYVCQQCGKSF 694

Query: 306  KSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQS 365
                      RR+H G K      ++C  CG  F  +  +  HM  HTG+    C  C  
Sbjct: 695  IFLDFCFLLHRRIHTGEKP-----YQCRQCGKSFSQKIQLEGHMGVHTGVNPFTCQQCGK 749

Query: 366  TYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGDKCYLCKI 425
            ++   + LK H + H         ++ Y+C +C K F +Q  +  H     G   ++C+ 
Sbjct: 750  SFNRKQNLKVHIRVHT-------GEKPYQCQQCGKSFSQQKNLDSHLVIHTGANPFVCQQ 802

Query: 426  CGARV--KSNLKAHMRIHTGERPVCCHICGKKLRGK--LKDHMLTHTGERPFGCEVCGST 481
            CG     K NL+ HMRIHTGE+P  C  CG+    K  L+ HM  HTG++P  C+ CG +
Sbjct: 803  CGKSFNHKQNLQVHMRIHTGEKPYQCRQCGRSFSQKTHLEIHMRIHTGDKPNQCQQCGKS 862

Query: 482  YKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIECQHSLKII 541
            + +K  L VHMR HTGE+PY C +CG SF+ +     H++ H+    V+   CQ   K  
Sbjct: 863  FIHKQNLKVHMRVHTGEKPYHCQHCGKSFSQQTNLEGHMRIHS---GVKPFTCQECGKSF 919

Query: 542  EYKIYQWISIENWFKIKRENVPSTKDQSHKKRDQKIECNICGALFATKYTLQDHMNTHTG 601
             +K     +++   ++     P              +C  CG  F  K+ LQ H+  HTG
Sbjct: 920  VHKH----NLQLHLRVHTGEKP-------------FKCQHCGKGFVHKHNLQLHLRVHTG 962

Query: 602  NK-YKCDVCDNGYSSLKHLKRHKMKHLQENGELPPSKIQKCPICHKIFIRNYMLRKHLDF 660
             K +KC  C  G+S  K+L  H   H    GE P S    CP C K FI     + H+  
Sbjct: 963  EKPFKCQHCGKGFSLQKNLDGHVRIH---TGEKPFS----CPQCGKSFIDKQNFKVHMRV 1015

Query: 661  VHGNKYHSCKVCGA--EIKGSLKEHMIVHTGERKYCCHICGKKM--RGKLKEHMLTHTGE 716
              G K + C+ CG    +K SL  HM +HTG + + C  CGK    R KLK H  THTGE
Sbjct: 1016 HTGEKPYQCQQCGKGFSLKASLDCHMSIHTGLKPFVCQQCGKSFHQRPKLKLHRRTHTGE 1075

Query: 717  RPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSAFSLHLKKHAGFKQTI 776
            +P+ C+ CG +F  K  L VHMR H  E PY C  CG+SF  ++   +H   H G K   
Sbjct: 1076 KPFTCQHCGKSFAQKQNLKVHMRVHTRETPYTCQYCGRSFNQKTNLEIHRIIHTGEK-PF 1134

Query: 777  ECEYCHNTFTFETGLMGVVTRDEWEILLRDKVRICPKCNKEFYSDRTMRRHLKQVHIEIK 836
             C+ C  +F+ +  L     +    I   +K   C  C K F   + +  H++ +H   K
Sbjct: 1135 TCQQCGKSFSQKQTL-----KVHMRIHTGEKPFSCHHCGKTFTDKQNLMVHMR-IHTGDK 1188

Query: 837  TFSCEECDKIFATREKLQRHWNYIHQGIRNTGPNQLLECHYCGITKNNKTLLRDHISAHL 896
             + C  C K F+ +  L  H   IH G       +  +C  CG + N K  L+ H+S H 
Sbjct: 1189 PYICTVCGKNFSQKPSLDVHVG-IHTG------EKPYQCQQCGKSFNRKQNLQVHMSIHN 1241

Query: 897  GIKPYCCIFCEEKYFSKKSLKRHEAKHNKVYNKAQYQDYQIQDLSMDQYRELVQSKERKC 956
            G KPY C  C + +  K++L+ H   H                            K   C
Sbjct: 1242 GDKPYQCQQCGKSFNRKQNLQVHMRIH-------------------------TGEKPFSC 1276

Query: 957  PKCEKEFSTPRYMRKHLR-----KKFKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMI 1011
             +C K F   R +  H R     + + C  CG  +T  ++LK H   H   +G+ P    
Sbjct: 1277 HQCGKTFCQKRNLAIHRRIHTGERPYTCQQCGRSFTQKQNLKVHMRIH---TGDKP---- 1329

Query: 1012 HKCPTCYKIFTENHALKKHLDWVHGNKCHICKVCGAKI--KGNLQQHMETHSGEKKICCH 1069
            ++C  C K F +   LK H+    G+K + C+ C      K NL+ HM  H+GEK   CH
Sbjct: 1330 YQCQECGKSFIDKQHLKVHMRIHTGDKPYQCQQCERSFDRKENLKVHMRIHTGEKPFTCH 1389

Query: 1070 ICGKKL--RGRLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQ 1127
             CGK L  +  L  HM  HTG++PY C+ CG SF  K   ++H+R H  E+PF+C +CG+
Sbjct: 1390 QCGKSLNRKKNLQVHMRIHTGDKPYQCQQCGKSFNRKQNFQVHMRIHTKEKPFSCHQCGR 1449

Query: 1128 SFAARSAFSLHLKKHAGSHILRRHIGYTVFCKECNIGFYSSTHLHSHGIKVHGLP-PFIC 1186
            SF  +    +H++ H G    +        C++C   F     L  H +++H    P+ C
Sbjct: 1450 SFNRKQNLKVHMRVHTGDKPYQ--------CQQCGKSFSQKATLDLH-MRIHSREKPYKC 1500

Query: 1187 EHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVC 1246
            +HC + F+ K +LT H + +  +  + C  C K F+ K + K H++ H     Y+ C  C
Sbjct: 1501 QHCGESFSQKAHLTGHERVHTKEKPYTCLQCGKCFSLKQNLKLHVRIHSGEKPYH-CCDC 1559

Query: 1247 SKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQF 1306
             K+ S    L  H  IH   R FTC+ CGK F QK+ LE H R+HTG KP+ C  C K F
Sbjct: 1560 GKSFSQKPNLDVHRRIHTGERPFTCQQCGKSFNQKQKLEFHTRIHTGEKPFTCQQCGKSF 1619

Query: 1307 TQKSTLNIHRKLHLNIKDFICDLCGAKFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQF 1366
             Q++ L +H ++H   + + C  CG +F+       H+       P V            
Sbjct: 1620 AQQTNLKVHMRVHTRERPYTCQDCGKRFFHKQNLKVHMRVHTGEKPYV------------ 1667

Query: 1367 FVCESMQSAKSTCVLCKKVFSTRENCTNHIMECHSYDVFEWKDKGVIKEHINPLFLKKFA 1426
                        C  C K FS + N   H M  HS               +NP       
Sbjct: 1668 ------------CQQCGKSFSQKTNLDAH-MGTHSV--------------VNPFI----- 1695

Query: 1427 FALNCPVCKLYFDRESDFHSHMQSYHNSHSY-CMKCNMYIFN-SRLQLHKRKHTREEEQW 1484
                C  C   F  + +   HM+ +     Y C +C         L++H R HT E+   
Sbjct: 1696 ----CHQCGKSFGHKQNLKIHMRVHTGEKPYSCGQCGKSFRQYPSLKIHVRIHTGEKP-- 1749

Query: 1485 TKVNIEYSCDCCEMSWSNPKDFGQHLNLVKCSYCANAAFCSSKALTRHLVEEHSDKLCGE 1544
                  Y+C C        K F Q   L K     +         T+H V+E SD++  E
Sbjct: 1750 ------YTCQC-------GKSFTQKGQLKKHMLTHDE--------TQHYVKEDSDEMV-E 1787

Query: 1545 DEESDELDDEEDTRNVTSDTK--------------------------------FPCRLCS 1572
             ++ D +  E+ T+ +T +TK                                + CR C 
Sbjct: 1788 RDQYDFVTVEQSTKTMTQETKSKRIFTCCDCGKSFNYKQNLEVHRRIHTGEKPYQCRQCG 1847

Query: 1573 QEFGTKKQRKKHERKDHETRGVFSCDLCSYTSTRKYYLVKHKSRHIKEYTVFCKKCQLGF 1632
            + F  K Q + H    H     F+C  C  +  RK  L  H   H  E    C++C   F
Sbjct: 1848 KSFSQKIQLEGH-MGVHTGVNPFTCQQCGKSFNRKQNLKVHIRVHTGEKPYQCQQCGKSF 1906

Query: 1633 LSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTTHKKLHLPMNRNHQCDTC------- 1685
              +  L+ H +    A P  C  C K F +K NL  H ++H    + +QC  C       
Sbjct: 1907 SQQKNLDSHLVIHTGANPFVCQQCGKSFNHKQNLQVHMRIHTG-EKPYQCQQCGRSFSQK 1965

Query: 1686 ---------------------GKSFTGNNHLKRHIYSVHLKRDTKFPCR------LCSQE 1718
                                 GKSF    +L+ H  SVH   +  + C+      +  +E
Sbjct: 1966 THLEAHIGIHTGVNPFVCQHCGKSFNQEQNLRVHT-SVHTG-NKPYICQCGKNALVLKEE 2023

Query: 1719 FDTKEQRKKHERKDHE---------------TQGLFSCDLCSYTSTQKYYLVKHKSRHI- 1762
             D  +Q K    K H+               +  LFSC  C  + +QK  L  H S H  
Sbjct: 2024 SDELKQTKDQYEKHHDFVEENTKMMKTQKTTSNHLFSCRDCGKSFSQKQNLESHMSIHTG 2083

Query: 1763 -KDYN--------------------------VFCKICQLGFLSKNELDVHNIKQHDAQPH 1795
             K YN                          + C  C   F  K  L VH       +P+
Sbjct: 2084 EKPYNCQHSGKSFSQQKHFEGNVGIHTGEKPLACHQCGKSFNYKQNLKVHMRIHTGDKPN 2143

Query: 1796 TCPVCKKIFVNKVTLAAHKKIHLPIDKNCQCDVCGKSFARTFHLKSHISSVHLKREQRKK 1855
             C  C K F++K  L  H ++H   +K   C  CGKSF++  +L+ H+            
Sbjct: 2144 QCQQCGKSFIHKQNLKVHMRVHTG-EKPYHCQHCGKSFSQQTNLEGHM------------ 2190

Query: 1856 HERKDHETQGLFSCDLCSYTSTQKYYLVKHKSRHIKDYNVFCKICQLGFLSKNELDVHNI 1915
               + H     F+C  C  +   K+ L  H   H  +    C+ C   F  +  LD H  
Sbjct: 2191 ---RIHSGVKPFTCQECGKSFVHKHNLQLHMRVHTGEKPFKCQHCGKSFSLQKNLDGHVR 2247

Query: 1916 KQHDAQPHTCP 1926
                 +P +CP
Sbjct: 2248 IHTGEKPFSCP 2258




Source: Danio rerio

Species: Danio rerio

Genus: Danio

Family: Cyprinidae

Order: Cypriniformes

Class: Actinopterygii

Phylum: Chordata

Superkingdom: Eukaryota

>gi|326680667|ref|XP_003201586.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|392334558|ref|XP_003753211.1| PREDICTED: uncharacterized protein LOC501406 [Rattus norvegicus] Back     alignment and taxonomy information
>gi|395514022|ref|XP_003761220.1| PREDICTED: uncharacterized protein LOC100916702 [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|326668290|ref|XP_003198776.1| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326666355|ref|XP_003198248.1| PREDICTED: zinc finger protein 208-like [Danio rerio] Back     alignment and taxonomy information
>gi|327288961|ref|XP_003229193.1| PREDICTED: zinc finger protein 729-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|301789843|ref|XP_002930335.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger protein Xfin-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|326667187|ref|XP_001920997.3| PREDICTED: zinc finger protein 729-like [Danio rerio] Back     alignment and taxonomy information
>gi|326667110|ref|XP_003198489.1| PREDICTED: zinc finger protein 729-like, partial [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1930
RGD|15941731665 Zfp748 "zinc finger protein 74 0.766 0.888 0.265 4.4e-141
ZFIN|ZDB-GENE-071004-1051014 zgc:173573 "zgc:173573" [Danio 0.502 0.956 0.315 2e-143
UNIPROTKB|F1MJE71173 F1MJE7 "Uncharacterized protei 0.567 0.933 0.308 6.8e-143
ZFIN|ZDB-GENE-110913-157981 si:ch211-245n8.1 "si:ch211-245 0.476 0.937 0.326 6.1e-142
ZFIN|ZDB-GENE-071004-1041011 zgc:173517 "zgc:173517" [Danio 0.502 0.958 0.324 2.3e-140
ZFIN|ZDB-GENE-110913-38987 si:ch211-208f21.5 "si:ch211-20 0.487 0.952 0.306 8e-139
ZFIN|ZDB-GENE-110913-1481029 si:dkey-14o6.6 "si:dkey-14o6.6 0.503 0.944 0.311 2.4e-137
ZFIN|ZDB-GENE-110914-1661002 si:ch73-266f23.2 "si:ch73-266f 0.494 0.952 0.319 1.2e-135
ZFIN|ZDB-GENE-110914-1601003 si:dkey-240n22.7 "si:dkey-240n 0.492 0.947 0.312 1.2e-135
ZFIN|ZDB-GENE-080213-71017 zgc:174234 "zgc:174234" [Danio 0.506 0.960 0.300 9.3e-133
RGD|1594173 Zfp748 "zinc finger protein 748" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 1380 (490.8 bits), Expect = 4.4e-141, P = 4.4e-141
 Identities = 431/1622 (26%), Positives = 651/1622 (40%)

Query:   183 KKKFECAHCSKTYLSRVGLEDHINNHTGEKGHICEICNRDFYSDAMLKRHLVKHSR---- 238
             +K ++C  C K +     L  H   HTGEK + C++C + FY  + L  H   H+     
Sbjct:    75 EKPYKCEVCGKAFHVASLLSKHRTVHTGEKLYKCDVCGKAFYYPSRLSNHKRIHTGEKPY 134

Query:   239 MIKETSEEFVETGSITREEWYKMVLQRVKTCPLCKKTYQSAKGMRLHIREVHSKVRPHQC 298
               +   + F    S+++ +      +  K C  C K ++    +  H +++H+  +P++C
Sbjct:   135 QCEVCGKAFCFPPSLSKHKRIHTGEKPYK-CKECGKAFRFPSSLSAH-KKIHTGEKPYKC 192

Query:   299 KGCGKYFKSQRHLVQHERRVHLGVKKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNH 358
               CGK F     L +H + +H G K  K     C  CG  F   + ++ H   HTG K +
Sbjct:   193 DVCGKAFHYPSLLSKH-KIIHTGEKPYK-----CEVCGQAFHVASKLSHHKIIHTGEKPY 246

Query:   359 VCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKCDKLFIEQSEMVQHRDWVHGD 418
              C IC   +  +  L +H   H  +       + YKCD CDK F   S +  H     G+
Sbjct:   247 KCEICGKAFHYSSLLSKHKIIHTGK-------KPYKCDICDKAFYYPSRLSSHTKMHTGE 299

Query:   419 KCYLCKICGARV--KSNLKAHMRIHTGERPVCCHICGKKLR--GKLKDHMLTHTGERPFG 474
             K Y C++CG      S+L  H RIH G +P  C +CGK  R    L  H   HTGE+P+ 
Sbjct:   300 KPYKCEVCGKAFCSPSSLSKHKRIHKGVKPYKCEVCGKAFRFPSLLLIHKGIHTGEKPYK 359

Query:   475 CEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAARPAFNLHLKRHTERGDVRHIEC 534
             CE CG  + Y   L+ H R HTGE+PY C  CG  F    + + H   HT     +   C
Sbjct:   360 CEECGKAFYYPSLLSKHKRVHTGEKPYQCEVCGKGFHVSSSLSKHRIIHTGEKPYKCEVC 419

Query:   535 QHSLKIIE-YKIYQWISI-ENWFKI----KRENVPS--TKDQSHKKRDQKIECNICGALF 586
             + + +       ++ I   +  +K     K  + PS  +K +    R++   C++CG  F
Sbjct:   420 EKAFRFSSSLSKHKRIHTGKKPYKCEECGKAFHFPSLLSKHKISHTREKPYNCDLCGKAF 479

Query:   587 ATKYTLQDHMNTHTGNK-YKCDVCDNGYSSXXXXXXXXXXXXQENGELPPSKIQKCPICH 645
                  L  H   HTG K +KCDVC   +                 GE P     KC IC 
Sbjct:   480 YYPSLLSKHKMIHTGEKPHKCDVCGKAFHYPSKLSNHKKI---HTGEKP----YKCDICG 532

Query:   646 KIFIRNYMLRKHLDFVHGNKYHSCKVCGA--EIKGSLKEHMIVHTGERKYCCHICGKKMR 703
              +F     L +H     G   + C+VCG    +   L  H I+HTGE+ Y C +CGK   
Sbjct:   533 NVFRFPSSLSEHKRTHTGENPYKCEVCGKAFHVPSKLSHHKIIHTGEKPYKCEVCGKAFH 592

Query:   704 --GKLKEHMLTHTGERPYACEICGGTFKTKWYLGVHMRKHNGERPYMCSECGQSFAARSA 761
                 L +H + HTG++PY CE+CG  F     L  H + H G R     E  Q       
Sbjct:   593 YPSLLSKHKIIHTGKKPYKCEVCGKAFHYPSRLSKHKKIH-GAR-----EMSQGPVGSVV 646

Query:   762 FSLHLKKHAGFKQTIECEYCHNTFTFETGLM-------GVVTRDEWEILLRDKVRI---- 810
             F  +  + A  K  +    C + F+ + G         G +   E  +  RD V I    
Sbjct:   647 FRCNASQGAIVKTALPHCVCISAFSRKVGRFSGPAPHSGCIADMEEMLSFRD-VAIDFSA 705

Query:   811 ----C-PKCNKEFYSDRTMRRHLKQVHIEIKTFSCEECDKIFATREKLQRHWNYIHQGIR 865
                 C        Y D  +  +   V + +  FS          R++       +  G  
Sbjct:   706 EEWECLDPAQWNLYRDVMLENYSNLVFLGL-AFSKPYLVTFLEQRQEPSDEKKQV--GAT 762

Query:   866 NTGPN-QLLECHYCGITKNNKTLLRDHISAHLGIKPYCCIFCEEKYFSKKSLKRHEA--K 922
                P+ +  +C  CG   +  +LL +H   + G   Y C  C +   S   L  H     
Sbjct:   763 TMHPDIKPYKCKDCGKACDWNSLLLEHQRTNPGENAYKCEECGKASGSCSVLSEHRIIDT 822

Query:   923 HNKVYNKAQYQDYQIQDLSMDQYREL-VQSKERKCPKCEKEFSTPRYMRKHL-----RKK 976
               K Y   +             YR + +     KC +C K FST  Y+ +H      +K 
Sbjct:   823 EEKAYKCEECGKVMCTCSGNSSYRRICIGENPYKCEECGKAFSTYSYLAQHEVEHTGQKF 882

Query:   977 FKCDVCGNGYTSVKHLKRHKIKHMKESGELPPSMIHKCPTCYKIFTENHALKKHLDWVHG 1036
             + C+ CG  +    HL  H+  H +E+       + K   C +IF     L K   +   
Sbjct:   883 YNCEECGKMFYFPSHLTEHQKIHSQEN-------LFKIEVCSEIFCAPIELSKDQTFCTE 935

Query:  1037 NKCHICK--VCGAKIKGNLQQHMETHSGEKKICCHICGKKLRGRLNEHMLT-HTGERPYA 1093
              K +  +  V        L +H   H GEK   C  CG       +   +  H   + Y 
Sbjct:   936 EKPYRYEEYVKAFSACSLLSEHPRIHPGEKAFKCEECGNAFCTLHSVSKVNIHCEVKSYK 995

Query:  1094 CEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIG 1153
             CE CG +F     L  H   H  E+P+ C ECG+ F   S    +LK+H  +H   +   
Sbjct:   996 CEECGKAFASHLSLIQHKIGHTREKPYQCEECGKMFYCSS----NLKQHQITHSQEKP-- 1049

Query:  1154 YTVFCKECNIGFYSSTHLHSHGIKVH-GLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLF 1212
             Y   C+ C   F +   L  H +++H G  P+ CE C K F +   LT H   +  +  +
Sbjct:  1050 YK--CEVCGKVFRTCWQLSKH-LRIHSGEKPYKCEECGKAFYTLSYLTQHKLGHTGEKPY 1106

Query:  1213 ECNICLKTFNFKTSYKRHLKQHDDSVTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCE 1272
             +C  C KTF + +  K HL  H     Y  C  C K   +      H  IH   + + CE
Sbjct:  1107 KCEECGKTFYYPSVLKEHLAIHSGEKPYR-CDECGKEFCTRSGRSRHQRIHTGEKPYKCE 1165

Query:  1273 VCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLHLNIKDFICDLCGA 1332
              CGK F    YL  HK VHTG+KPY C+ C K+F   S L  H+++H     + C++CG 
Sbjct:  1166 QCGKAFSTHSYLSHHKIVHTGHKPYKCEECGKKFYYPSRLKEHQRIHSQENPYKCEICGK 1225

Query:  1333 KFYEFNTYVTHVHETHAILPRVIVTKFKVEDFQFFVCESM--QSAKST--CVLCKKVFST 1388
              F+ ++ +  H        P       K   +   + E +   S K    C  C K F T
Sbjct:  1226 AFHTYSYFTQHKLGHTGEKPYKCEECGKTFYYPSILKEHLVIHSGKKPYRCDECGKDFCT 1285

Query:  1389 RENCTNHIMECHSYDV-FEWKDKGVIKEHINPLFLKKFAFA----LNCPVC--KLYFDRE 1441
             R   + H    H+ +   + +  G +    + L   K   +      C  C  K Y+   
Sbjct:  1286 RSGHSRH-QRIHTGEKPHKCEVCGKVFSTHSYLTQHKVVHSGEKPYRCEECGKKFYYPSR 1344

Query:  1442 SDFHSHMQSYHNSHSYCMKC-NMYIFNSRLQLHKRKHTREEEQWTKVNIEYSCDCCEMSW 1500
                H  + S  N +  C  C N++     L  H+R H  E+         Y C+ C   +
Sbjct:  1345 LKEHQRVHSQGNPYK-CEICGNVFCTPKGLSKHQRFHMGEKP--------YKCEECGKMF 1395

Query:  1501 SNPKDFGQHL------NLVKCSYCANAAFCSSKALTRHLVEEHSDKL-----CGXXXXXX 1549
               P    +H       N  KC  C  A F +   LT+H +    +K      CG      
Sbjct:  1396 YYPSRLKEHQRIHSQENPYKCEICGKA-FYTHSYLTQHKLGHTGEKPYKCEECGKTFYYP 1454

Query:  1550 XXXXXXXTRNVTSDTK-FPCRLCSQEFGTKKQRKKHERKDHETRGVFSCDLCSYTSTRKY 1608
                       + S  K + C  C ++F T+  R +H+R  H     + C+ C    +   
Sbjct:  1455 SILKEHLA--IHSGKKPYKCDECGKDFCTRSGRSRHQRI-HTGEKPYKCEQCGKAFSTHS 1511

Query:  1609 YLVKHKSRHIKEYTVFCKKCQLGFLSKNELNVHNIKQHDAQPHTCPVCKKIFVNKFNLTT 1668
             YL +HK  H  E    C++C   F   + L  H       +P+ C  C K F        
Sbjct:  1512 YLSQHKVVHSGEKPYKCEECGKAFSYPSTLKQHQRIHSGEKPYRCEECGKAFRRSTYFHQ 1571

Query:  1669 HKKLHLPMNRNHQCDTCGKSFTGNNHLKRHIYSVHLKRDTKFPCRLCSQ---EFDTKEQR 1725
             H+++H    + +QC+ CGK+F   ++LK H   +H      + C +C     E D  +  
Sbjct:  1572 HQRIHTG-EKPYQCEECGKTFYYRSNLKGH-QIIH-SGVKPYKCDVCGSTISELDKSQDT 1628

Query:  1726 KK 1727
             KK
Sbjct:  1629 KK 1630


GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=ISO
GO:0005634 "nucleus" evidence=ISO
GO:0005737 "cytoplasm" evidence=ISO
GO:0030674 "protein binding, bridging" evidence=ISO
ZFIN|ZDB-GENE-071004-105 zgc:173573 "zgc:173573" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJE7 F1MJE7 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-157 si:ch211-245n8.1 "si:ch211-245n8.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-104 zgc:173517 "zgc:173517" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-38 si:ch211-208f21.5 "si:ch211-208f21.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-148 si:dkey-14o6.6 "si:dkey-14o6.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-166 si:ch73-266f23.2 "si:ch73-266f23.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110914-160 si:dkey-240n22.7 "si:dkey-240n22.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080213-7 zgc:174234 "zgc:174234" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1930
COG5236493 COG5236, COG5236, Uncharacterized conserved protei 3e-04
>gnl|CDD|227561 COG5236, COG5236, Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 45.0 bits (106), Expect = 3e-04
 Identities = 32/97 (32%), Positives = 40/97 (41%), Gaps = 14/97 (14%)

Query: 153 KCPCEVCGKRFNSIKRVKQHRKVVH------MGIKQKKKFECAHCSKTYLSRVGLEDHIN 206
           KCP   C +R  S+K +K+H K  H        I  KK F              L DH N
Sbjct: 153 KCPKSKCHRRCGSLKELKKHYKAQHGFVLCSECIGNKKDFWNEI---RLFRSSTLRDHKN 209

Query: 207 ---NHTGEKGH-ICEICNRDFYSDAMLKRHL-VKHSR 238
                 G KGH +C  C   FY D  L+RH  ++H  
Sbjct: 210 GGLEEEGFKGHPLCIFCKIYFYDDDELRRHCRLRHEA 246


Length = 493

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1930
KOG1074|consensus958 99.95
KOG1074|consensus958 99.94
KOG2462|consensus279 99.91
KOG2462|consensus279 99.9
KOG3608|consensus467 99.88
KOG3608|consensus467 99.88
KOG3623|consensus1007 99.82
KOG3623|consensus1007 99.81
KOG3576|consensus267 99.6
KOG3576|consensus267 99.53
PLN03086567 PRLI-interacting factor K; Provisional 98.98
PLN03086567 PRLI-interacting factor K; Provisional 98.87
KOG1146|consensus1406 98.74
PHA00733128 hypothetical protein 98.6
PHA00733128 hypothetical protein 98.57
PHA0276855 hypothetical protein; Provisional 98.5
PHA0276855 hypothetical protein; Provisional 98.49
KOG3993|consensus500 98.36
KOG3993|consensus500 98.31
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.23
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.19
KOG1146|consensus1406 98.19
PHA0061644 hypothetical protein 97.9
PHA0061644 hypothetical protein 97.86
PHA0073279 hypothetical protein 97.55
PHA0073279 hypothetical protein 97.44
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.44
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.3
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.98
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 96.84
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 96.21
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 96.16
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 95.92
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.91
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 95.86
COG5189423 SFP1 Putative transcriptional repressor regulating 95.77
KOG2785|consensus390 95.68
COG5189423 SFP1 Putative transcriptional repressor regulating 95.47
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 95.42
KOG2231|consensus 669 94.96
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.76
KOG2231|consensus669 94.75
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.71
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 94.48
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 94.37
smart0035526 ZnF_C2H2 zinc finger. 94.18
smart0035526 ZnF_C2H2 zinc finger. 93.87
PRK04860160 hypothetical protein; Provisional 93.71
PRK04860160 hypothetical protein; Provisional 93.55
COG5236493 Uncharacterized conserved protein, contains RING Z 93.53
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 93.46
COG5236493 Uncharacterized conserved protein, contains RING Z 93.41
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 92.89
KOG2482|consensus423 92.75
KOG2785|consensus 390 91.41
KOG2482|consensus423 91.37
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 90.38
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 88.99
COG5048467 FOG: Zn-finger [General function prediction only] 87.87
COG5048467 FOG: Zn-finger [General function prediction only] 86.69
KOG4173|consensus253 85.96
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 80.98
KOG2893|consensus341 80.69
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 80.52
>KOG1074|consensus Back     alignment and domain information
Probab=99.95  E-value=3.5e-29  Score=293.81  Aligned_cols=254  Identities=23%  Similarity=0.433  Sum_probs=166.8

Q ss_pred             CCCCCCCCCccCcchHHHHhhhhhcCCCCCcCCccccCcccChhHHHhHHhhhccCCCCCccccCc---cchhccCCchh
Q psy4681         124 ARKCPICGDRYKSGTDMRRHYRDLHDSTRKCPCEVCGKRFNSIKRVKQHRKVVHMGIKQKKKFECA---HCSKTYLSRVG  200 (1930)
Q Consensus       124 ~~~C~~C~~~f~~~~~l~~H~~~~h~~~~~~~C~~C~k~f~~~~~l~~H~~~~h~~~~~~~~~~C~---~C~k~f~~~~~  200 (1930)
                      +..|-+|.+..+-...|++||| .|++||||+|.+||+.|.++.+|+.|+-++.....-+-.|.|+   +|-+.|.....
T Consensus       605 PNqCiiC~rVlSC~saLqmHyr-tHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kftn~V~  683 (958)
T KOG1074|consen  605 PNQCIICLRVLSCPSALQMHYR-THTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFTNAVT  683 (958)
T ss_pred             ccceeeeeecccchhhhhhhhh-cccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccccccc
Confidence            3479999999999999999999 8999999999999999999999999998444333344678999   99999999999


Q ss_pred             hhhhhcccccC-Cc------------cccccccccccCHHHHHHHHhhcccccccchhhhhccCCchhHHHHHHhhcccc
Q psy4681         201 LEDHINNHTGE-KG------------HICEICNRDFYSDAMLKRHLVKHSRMIKETSEEFVETGSITREEWYKMVLQRVK  267 (1930)
Q Consensus       201 L~~H~~~H~~~-~~------------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  267 (1930)
                      |..|+++|+|. .+            -+|.+|.+.|.....+..++..|............+... +.+    .......
T Consensus       684 lpQhIriH~~~~~s~g~~a~e~~~~adq~~~~qk~~~~a~~f~~~~se~~~~~s~~~~~~~~~t~-t~~----~~~tp~~  758 (958)
T KOG1074|consen  684 LPQHIRIHLGGQISNGGTAAEGILAADQCSSCQKTFSDARSFSQQISEQPSPESEPDEQMDERTE-TEE----LDVTPPP  758 (958)
T ss_pred             ccceEEeecCCCCCCCcccccccchhcccchhhhcccccccchhhhhccCCcccCCccccccccc-ccc----cccCCCc
Confidence            99999999942 11            469999999999999999998774322111111000000 000    0011233


Q ss_pred             cCCcchhcccChHHHHHHH----------------------HhhcCCCCCc-cccccccccccHH----HHHHHHHH---
Q psy4681         268 TCPLCKKTYQSAKGMRLHI----------------------REVHSKVRPH-QCKGCGKYFKSQR----HLVQHERR---  317 (1930)
Q Consensus       268 ~C~~C~k~f~~~~~l~~H~----------------------~~~h~~~~~~-~C~~C~~~f~~~~----~l~~H~~~---  317 (1930)
                      .+..|+..+.....+..+-                      ...++.+++. .+..++..-...-    .|..-.-.   
T Consensus       759 ~e~~~~~~~~~e~~i~~~g~te~asa~~~~vg~~s~~~~~~~~~~T~~k~~~~~~~~~~~~~~~v~~~pvl~~~~~~~l~  838 (958)
T KOG1074|consen  759 PENSCGRELEGEMAISVRGSTEEASANLDEVGTVSAAGEAGEEDDTSEKPTQASSFPGEILAPSVNMDPVLWNQETSMLN  838 (958)
T ss_pred             cccccccccCcccccccccchhhhhcChhhhcCccccchhhhhcccCCCCcccccCCCcCCccccccCchhhcccccccc
Confidence            4566666665433222211                      1123445666 5666654433211    11110000   


Q ss_pred             ----------hccCc-------------------ccccCCccccccccccccccccccccccccCCCCceeCCCCCcccc
Q psy4681         318 ----------VHLGV-------------------KKIKHSNFECFHCGAKFISRTHIADHMTSHTGIKNHVCSICQSTYT  368 (1930)
Q Consensus       318 ----------~h~~~-------------------~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~  368 (1930)
                                ++.+.                   .........|..||+.|.+.++|..||++|+|+|||.|.+|++.|.
T Consensus       839 eg~~t~~n~~t~~~~~~sv~qs~~~p~l~p~l~~~~pvnn~h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFt  918 (958)
T KOG1074|consen  839 EGLATKTNEITPEGPADSVIQSGGVPTLEPSLGRPGPVNNAHVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFT  918 (958)
T ss_pred             cccccccccccCCCcchhhhhhccccccCCCCCCCCcccchhhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhh
Confidence                      00000                   0001123568888888888888888888888888888888888888


Q ss_pred             ChhHHhhhhhccccc
Q psy4681         369 TARGLKRHNKNHLRE  383 (1930)
Q Consensus       369 ~~~~L~~H~~~h~~~  383 (1930)
                      ++.+|+.||.+|++.
T Consensus       919 trgnLKvHMgtH~w~  933 (958)
T KOG1074|consen  919 TRGNLKVHMGTHMWV  933 (958)
T ss_pred             hhhhhhhhhcccccc
Confidence            888888888887655



>KOG1074|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1930
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-28
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-27
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 3e-24
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 5e-23
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-12
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-12
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-11
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-05
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 1e-04
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 3e-12
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 4e-04
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-12
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-04
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-12
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-12
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-07
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 9e-06
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 4e-11
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-11
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-11
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 6e-11
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 6e-11
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 1e-10
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 4e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 5e-04
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 5e-10
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 5e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 5e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-05
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-09
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 2e-05
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 9e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 6e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-08
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-06
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-04
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-08
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-07
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 6e-06
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-08
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 2e-05
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-07
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 9e-06
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-05
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-05
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 4e-07
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-05
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 4e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-07
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-05
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-04
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-07
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 5e-07
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 1e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 8e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 3e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-04
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 3e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-04
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 4e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 7e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 126 bits (316), Expect = 1e-28, Method: Compositional matrix adjust. Identities = 68/192 (35%), Positives = 102/192 (53%), Gaps = 12/192 (6%) Query: 337 AKFISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCD 396 ++F S + +A G K + C C +++ + L H + H ++ YKC Sbjct: 2 SEFGSSSSVAQ-AALEPGEKPYACPECGKSFSRSDHLAEHQRTHT-------GEKPYKCP 53 Query: 397 KCDKLFIEQSEMVQHRDWVHGDKCYLCKICGARV--KSNLKAHMRIHTGERPVCCHICGK 454 +C K F ++ ++ +H+ G+K Y C CG ++NL+AH R HTGE+P C CGK Sbjct: 54 ECGKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGK 113 Query: 455 KLR--GKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAA 512 L+ H THTGE+P+ C CG ++ + L H R HTGE+PY C CG SF+ Sbjct: 114 SFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSR 173 Query: 513 RPAFNLHLKRHT 524 R A N+H + HT Sbjct: 174 RDALNVHQRTHT 185
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1930
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-33
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 6e-32
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-31
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-30
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-25
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-25
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-20
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-13
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-09
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-08
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-07
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-06
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-04
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-26
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-23
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-22
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-20
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-19
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-17
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-16
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-13
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 9e-10
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-08
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-07
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-06
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-05
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-04
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 6e-04
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-22
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-20
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-20
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-19
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 9e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-15
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-14
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-13
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-09
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-07
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-06
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-05
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-25
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-23
1tf6_A190 Protein (transcription factor IIIA); complex (tran 6e-23
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 5e-21
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-19
1tf6_A190 Protein (transcription factor IIIA); complex (tran 2e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-09
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-07
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-05
1tf6_A190 Protein (transcription factor IIIA); complex (tran 7e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-24
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-22
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-22
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-18
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 6e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-17
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-15
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-14
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 8e-10
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-06
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-05
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-04
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-24
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-21
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-18
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-16
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-14
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-13
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-12
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-11
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-10
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 7e-05
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 4e-04
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-24
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-22
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-22
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-21
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-20
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-16
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-14
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-11
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-10
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-08
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-05
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-22
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-21
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-20
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-19
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-16
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 8e-15
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-14
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 5e-13
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-09
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-06
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-05
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-04
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 6e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-23
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-19
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-18
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-17
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-16
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-13
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 8e-12
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-09
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-08
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-07
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-04
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 7e-04
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-22
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-20
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 5e-16
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-15
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-14
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-13
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-10
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-06
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-21
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-20
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-14
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-10
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 6e-09
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-07
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-06
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 9e-05
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-04
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-20
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-19
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-17
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-16
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-15
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-12
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-06
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 5e-05
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 6e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-04
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 8e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 9e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-16
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-15
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-12
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-11
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-10
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-09
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-07
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-06
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 6e-05
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-04
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-04
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-18
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 7e-17
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-10
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-08
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 8e-07
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-06
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-05
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 7e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-16
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-15
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-14
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-09
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-08
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-07
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 4e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 9e-05
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-04
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-15
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 4e-11
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-09
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-08
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-07
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-06
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-05
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-04
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-16
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-14
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-10
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-07
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-06
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-05
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 4e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-17
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-16
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-15
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 9e-13
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-10
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-09
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-08
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-07
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-06
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-05
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 4e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-17
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-13
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-12
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-09
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 6e-06
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-05
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-04
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 7e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-17
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-16
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-10
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 4e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-07
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-06
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 7e-05
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-04
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-16
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-14
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-14
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-13
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-09
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-08
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-07
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-06
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-16
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-15
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-14
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-13
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-12
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-11
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 8e-07
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 7e-06
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-05
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-04
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-10
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-08
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-07
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-06
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 7e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 8e-05
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 3e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-04
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 6e-04
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-16
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-15
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 6e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 3e-13
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 9e-09
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-08
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-06
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-12
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-11
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-07
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-06
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-05
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-04
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-13
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 9e-10
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-07
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-06
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-05
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-04
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 6e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-13
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-11
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-10
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 3e-08
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-07
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 6e-05
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-12
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 5e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-06
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-04
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-08
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-07
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 5e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-09
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-05
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 1e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-11
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-11
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-09
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-07
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-05
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-09
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-08
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-07
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 5e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-09
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-06
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-06
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-06
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-06
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-06
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-10
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-06
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-04
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 7e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-06
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 5e-07
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 9e-05
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 2e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-07
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 8e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 5e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-10
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 3e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 7e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-04
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-06
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-06
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-10
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-07
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-08
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-06
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 9e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-04
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-07
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-04
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 1e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-08
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-07
2epa_A72 Krueppel-like factor 10; transforming growth facto 4e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-06
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 8e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 1e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-06
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-06
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-08
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-06
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-06
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 7e-07
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-06
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-06
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-06
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 9e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-06
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 6e-05
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-06
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-06
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-06
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-06
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-06
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-06
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 6e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 7e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-04
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-09
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-06
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-05
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-06
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-06
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-06
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-08
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-06
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 6e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-04
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 6e-04
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-06
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 4e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 7e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-05
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-04
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 8e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 3e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 6e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 3e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 2e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-04
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 8e-04
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 9e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  126 bits (319), Expect = 4e-33
 Identities = 67/191 (35%), Positives = 97/191 (50%), Gaps = 13/191 (6%)

Query: 339 FISRTHIADHMTSHTGIKNHVCSICQSTYTTARGLKRHNKNHLREAGVLRADEMYKCDKC 398
               +          G K + C  C  +++ +  L  H + H  E       + YKC +C
Sbjct: 3   EFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGE-------KPYKCPEC 55

Query: 399 DKLFIEQSEMVQHRDWVH-GDKCYLCKICGA--RVKSNLKAHMRIHTGERPVCCHICGK- 454
            K F ++ ++ +H+   H G+K Y C  CG     ++NL+AH R HTGE+P  C  CGK 
Sbjct: 56  GKSFSDKKDLTRHQR-THTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKS 114

Query: 455 -KLRGKLKDHMLTHTGERPFGCEVCGSTYKYKYYLAVHMRKHTGERPYVCNYCGHSFAAR 513
                 L+ H  THTGE+P+ C  CG ++  +  L  H R HTGE+PY C  CG SF+ R
Sbjct: 115 FSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRR 174

Query: 514 PAFNLHLKRHT 524
            A N+H + HT
Sbjct: 175 DALNVHQRTHT 185


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 98 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1930
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.93
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.92
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.87
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.85
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.81
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.8
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.78
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.78
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.78
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.78
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.78
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.78
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.77
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.61
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.61
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.6
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.6
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.6
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.59
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.59
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.58
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.58
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.57
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.57
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.55
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.55
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.54
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.53
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.53
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.51
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.48
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.46
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.46
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.43
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.42
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.41
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.41
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.38
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.38
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.37
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.36
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.35
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.35
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.33
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.32
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.31
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.31
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.3
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.29
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.28
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.28
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.28
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.25
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.25
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.24
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.23
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.23
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.21
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.21
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.2
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.19
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.18
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.17
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.15
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.12
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.12
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.1
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.02
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.02
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.01
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.0
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.99
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 98.98
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.95
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.95
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.95
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.95
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.95
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.95
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.94
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.94
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.94
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.94
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.94
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.93
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.93
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.93
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.93
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.93
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.93
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.93
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.93
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.93
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.92
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.92
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.92
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.91
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.91
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.91
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.9
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 98.9
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 98.9
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.9
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.9
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.9
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.9
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.89
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 98.88
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.88
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 98.88
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.88
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.87
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 98.87
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.86
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.85
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.85
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.85
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.84
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.84
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 98.84
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.83
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.82
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.82
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.81
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.8
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.8
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.8
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.8
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.8
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.79
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.79
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.78
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.78
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.78
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.78
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.78
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.78
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.77
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.77
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.77
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.77
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.76
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.76
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.76
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.76
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.76
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.76
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.76
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.76
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.75
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.75
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.75
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.75
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.74
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.74
2epa_A72 Krueppel-like factor 10; transforming growth facto 98.74
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.74
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.74
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.74
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.74
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.73
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.73
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.73
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.73
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.73
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.73
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.73
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.72
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.72
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.72
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.72
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.72
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.72
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.72
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.72
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.72
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.71
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.71
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.71
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.7
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.7
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.7
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.69
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.69
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.68
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.68
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.68
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.68
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.67
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.67
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.66
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.65
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.65
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.65
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.65
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.64
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.64
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.63
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.63
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.63
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.62
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.6
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.58
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.58
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.58
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.55
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.54
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.53
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.43
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.37
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.36
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.36
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.35
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.31
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.3
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.27
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.25
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.24
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.18
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.17
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.17
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.09
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.09
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.07
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.06
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.05
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.04
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.03
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.03
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.01
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.0
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.0
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.99
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.95
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.95
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.93
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.93
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.93
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 97.92
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 97.91
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.91
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.9
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 97.9
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 97.89
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 97.87
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.83
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 97.8
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.65
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.64
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.64
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.63
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.62
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.6
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.6
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.58
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.56
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.56
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.56
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.55
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.55
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.54
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.54
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.54
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.53
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.53
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.52
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.66
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.51
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.5
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.49
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 96.62
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.61
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 96.6
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.43
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.42
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.42
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.41
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.32
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.36
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.34
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.22
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.97
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 96.94
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.82
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 95.51
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.28
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.34
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 94.16
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 93.65
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 92.89
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 92.29
2e72_A49 POGO transposable element with ZNF domain; zinc fi 89.4
2e72_A49 POGO transposable element with ZNF domain; zinc fi 88.41
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=99.97  E-value=8.8e-32  Score=296.14  Aligned_cols=183  Identities=33%  Similarity=0.707  Sum_probs=81.8

Q ss_pred             HHHHHHhhccCCCcccCCcCccccCChhhHHhHhhhccCCCCccCchhhhhccChhHHHHHHhhhhCCcccccccCceee
Q psy4681        1078 RLNEHMLTHTGERPYACEFCGSSFKDKSYLRIHIRKHNGERPFTCSECGQSFAARSAFSLHLKKHAGSHILRRHIGYTVF 1157 (1930)
Q Consensus      1078 ~l~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~ 1157 (1930)
                      .|..|+.+|.++++|.|++|++.|.+...|..|++.|++++||.|++|++.|.+...|..|++.|.+             
T Consensus         8 ~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~-------------   74 (190)
T 2i13_A            8 SSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTG-------------   74 (190)
T ss_dssp             -----------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHC-------------
T ss_pred             cchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCC-------------
Confidence            4556666666666666666666666666666666666666666666666666666666666555443             


Q ss_pred             cCCCCCcccChhHHHhhhhhhcCCCCcccCCCCcccCChhhHHHHHhhhcCCCceeccccccccccchhhhhhhcccCCC
Q psy4681        1158 CKECNIGFYSSTHLHSHGIKVHGLPPFICEHCSKPFTSKGNLTVHVKYYHAKTLFECNICLKTFNFKTSYKRHLKQHDDS 1237 (1930)
Q Consensus      1158 C~~C~~~f~~~~~l~~H~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~ 1237 (1930)
                                             +++|.|++|++.|.+...|..|++.|+++++|.|++|++.|.+...|..|+++|+++
T Consensus        75 -----------------------~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~  131 (190)
T 2i13_A           75 -----------------------EKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGE  131 (190)
T ss_dssp             -----------------------CCCEECTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCC
T ss_pred             -----------------------CCCccCcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCC
Confidence                                   234555555555555555566655555555555555555554444444444444443


Q ss_pred             CCcccCCCCCcccCChhhHHhHHHHhcCCceeecccccccccchhhHHHHHHHhCCCCce
Q psy4681        1238 VTYYPCTVCSKNLSSPYRLKTHMLIHANNRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPY 1297 (1930)
Q Consensus      1238 ~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~ 1297 (1930)
                      . +|.|++|++.|.+...|..|+++|++++||.|++||+.|..+..|..|+++|+|++||
T Consensus       132 ~-~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          132 K-PYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             C-CEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHHTTC------
T ss_pred             C-CeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            3 4444444444444444555555554445555555555555555555555555544443



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1930
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 3e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-05
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 8e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-04
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-07
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-07
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 5e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.001
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.003
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.001
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.004
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-05
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 0.001
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 7e-04
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 0.002
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 7e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.001
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.003
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.004
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 6e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 7e-04
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.003
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.003
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.004
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 46.8 bits (112), Expect = 1e-07
 Identities = 16/32 (50%), Positives = 19/32 (59%)

Query: 1086 HTGERPYACEFCGSSFKDKSYLRIHIRKHNGE 1117
            H+GE+PY C  CG +F   S L  H R H GE
Sbjct: 2    HSGEKPYGCVECGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1930
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.44
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.43
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.06
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.04
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.01
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.0
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.99
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.89
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.87
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.86
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.83
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.82
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.78
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.75
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.73
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.72
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.72
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.71
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.7
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.69
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.68
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.66
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.65
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.64
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.57
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.47
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.43
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.42
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.4
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.37
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.34
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.34
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.31
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.1
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.05
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.03
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.02
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.97
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.96
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.96
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.87
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.73
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.73
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.67
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.66
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.58
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.47
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.39
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.37
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.28
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.24
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.19
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.15
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.92
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.8
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.73
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 96.71
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.62
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.53
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.53
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.5
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.47
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.45
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.07
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.07
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.04
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.04
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.02
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.01
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.95
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 95.91
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.87
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 95.83
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.82
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 95.81
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.68
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.62
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.35
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 95.2
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.14
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 94.72
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.46
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 94.45
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.13
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.69
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 93.17
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 92.97
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 91.52
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 91.35
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 91.27
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 91.21
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 90.66
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 90.52
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 88.52
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 88.08
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 87.43
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 87.32
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 87.19
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 86.76
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.97
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 82.8
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 80.23
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 80.09
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.44  E-value=2.7e-14  Score=113.60  Aligned_cols=53  Identities=38%  Similarity=0.911  Sum_probs=43.1

Q ss_pred             CceeecccccccccchhhHHHHHHHhCCCCceecccccccccChhhHHHHHhhc
Q psy4681        1266 NRVFTCEVCGKGFIQKRYLEEHKRVHTGYKPYACDLCSKQFTQKSTLNIHRKLH 1319 (1930)
Q Consensus      1266 ~~~~~C~~C~k~F~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~l~~H~~~h 1319 (1930)
                      ||||.|+ ||++|+.+..|..|+++|+|++||.|++||++|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            5788884 8888888888888888888888888888888888888888888765



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure