Psyllid ID: psy4830


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MKLHSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQNK
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHcccccccccccccccccccEcccccEEEEcEEEccccccccccccccEEEEccccHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHccccccccccHccccccccHHHHHHccc
mklhsgnkpyhctacdasfcrkpyleihmrthtgerpfqCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMrthtgerpyqcevcnkrfsqksslntHKRIHINYlhtedkpyhctgcdaafsrkqylEVNHTTVLAVmqpslgnntwSAKFLTSLFSHQVhmrthtgerpfqcavcskrftqksslnthkrvhtgerpyacdicdkrfaVKSYVTshrwshvgdkpfgctschltftsKSQFAVHLRTHhtvganhvcnvcgrsfvrdsyLIRHQNK
mklhsgnkpyhctacdasfCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRThtgerpyqcEVCNKRfsqksslnthKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRftqksslnthkrvhtgerpyacdicDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSfvrdsylirhqnk
MKLHSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQNK
*********YHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLI*****
MKLHSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQ**
********PYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQNK
M***SGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFV***********
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKLHSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query292 2.2.26 [Sep-21-2011]
Q96RE9604 Zinc finger protein 300 O yes N/A 0.979 0.473 0.405 3e-61
P51523738 Zinc finger protein 84 OS no N/A 0.952 0.376 0.435 5e-61
Q6P560627 Zinc finger protein 182 O no N/A 0.856 0.398 0.435 1e-60
P17025639 Zinc finger protein 182 O no N/A 0.856 0.391 0.435 1e-60
Q5R9S5620 Zinc finger protein 182 O no N/A 0.856 0.403 0.435 1e-60
Q6ZMW2699 Zinc finger protein 782 O no N/A 0.962 0.402 0.434 2e-60
Q6ZN57461 Zinc finger protein 2 hom no N/A 0.979 0.620 0.392 1e-59
Q9Y6Q3630 Zinc finger protein 37 ho no N/A 0.976 0.452 0.394 2e-59
Q14587 947 Zinc finger protein 268 O no N/A 0.948 0.292 0.428 3e-59
P51814 821 Zinc finger protein 41 OS no N/A 0.958 0.341 0.415 5e-59
>sp|Q96RE9|ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens GN=ZNF300 PE=2 SV=1 Back     alignment and function desciption
 Score =  235 bits (599), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 127/313 (40%), Positives = 170/313 (54%), Gaps = 27/313 (8%)

Query: 1   MKLHSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMH 60
            ++H+G KPY C AC  +F  K +L +H RTHTGE+P+ C  C K FSQKS+L  H+R+H
Sbjct: 288 QRIHTGKKPYDCGACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVH 347

Query: 61  IPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINY- 119
                Y C  C   F+ K  L +H R HTGE+PY+C  C K FSQKS L  H R H    
Sbjct: 348 TGEKPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHHRAHTGEK 407

Query: 120 ----------------------LHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSL 157
                                 +HT +KPY C  C+ AFSRK  L + H  V    +P  
Sbjct: 408 PYECTECGKAFCEKSHLIIHKRIHTGEKPYKCAQCEEAFSRKTEL-ITHQLVHTGEKPY- 465

Query: 158 GNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACD 217
              T   K  +      +H RTHTGE+P++C+ C K F QKS L  H+R+HTGE+PY C 
Sbjct: 466 -ECTECGKTFSRKSQLIIHQRTHTGEKPYKCSECGKAFCQKSHLIGHQRIHTGEKPYICT 524

Query: 218 ICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCG 277
            C K F+ KS++  H+  H G+KP+ C  C   F+ KS   +H R  HT    + C +CG
Sbjct: 525 ECGKAFSQKSHLPGHQRIHTGEKPYICAECGKAFSQKSDLVLHQRI-HTGERPYQCAICG 583

Query: 278 RSFVRDSYLIRHQ 290
           ++F++ S L  HQ
Sbjct: 584 KAFIQKSQLTVHQ 596




Has a transcriptional repressor activity.
Homo sapiens (taxid: 9606)
>sp|P51523|ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens GN=ZNF84 PE=1 SV=2 Back     alignment and function description
>sp|Q6P560|ZN182_MOUSE Zinc finger protein 182 OS=Mus musculus GN=Znf182 PE=2 SV=1 Back     alignment and function description
>sp|P17025|ZN182_HUMAN Zinc finger protein 182 OS=Homo sapiens GN=ZNF182 PE=1 SV=2 Back     alignment and function description
>sp|Q5R9S5|ZN182_PONAB Zinc finger protein 182 OS=Pongo abelii GN=ZNF182 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZMW2|ZN782_HUMAN Zinc finger protein 782 OS=Homo sapiens GN=ZNF782 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZN57|ZFP2_HUMAN Zinc finger protein 2 homolog OS=Homo sapiens GN=ZFP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y6Q3|ZFP37_HUMAN Zinc finger protein 37 homolog OS=Homo sapiens GN=ZFP37 PE=2 SV=3 Back     alignment and function description
>sp|Q14587|ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens GN=ZNF268 PE=1 SV=2 Back     alignment and function description
>sp|P51814|ZNF41_HUMAN Zinc finger protein 41 OS=Homo sapiens GN=ZNF41 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
157105982 567 zinc finger protein [Aedes aegypti] gi|1 0.876 0.451 0.573 6e-95
357609605 1280 zinc finger protein [Danaus plexippus] 0.856 0.195 0.592 7e-92
328715046392 PREDICTED: zinc finger protein 271-like 0.945 0.704 0.436 6e-64
193591726 536 PREDICTED: zinc finger protein 271-like 0.958 0.522 0.446 7e-64
328704791339 PREDICTED: zinc finger protein 271-like 0.955 0.823 0.432 2e-63
301765518 929 PREDICTED: zinc finger protein 268-like 0.948 0.298 0.425 2e-62
328702980 414 PREDICTED: zinc finger protein 271-like, 0.945 0.666 0.443 3e-62
328702988 599 PREDICTED: zinc finger protein 271-like 0.952 0.464 0.453 8e-62
344292677 635 PREDICTED: zinc finger protein 182 [Loxo 0.948 0.436 0.465 2e-61
432953118 406 PREDICTED: oocyte zinc finger protein Xl 0.945 0.679 0.433 2e-61
>gi|157105982|ref|XP_001649111.1| zinc finger protein [Aedes aegypti] gi|108879937|gb|EAT44162.1| AAEL004444-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  353 bits (905), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 171/298 (57%), Positives = 210/298 (70%), Gaps = 42/298 (14%)

Query: 1   MKLHSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMH 60
           MKLHSG KP+ CT CDA+FCRKPYLE+HMRTHTGERPF C VCLKRFSQKS+LNTHK++H
Sbjct: 84  MKLHSGTKPFACTVCDAAFCRKPYLEVHMRTHTGERPFSCDVCLKRFSQKSSLNTHKKIH 143

Query: 61  IPYIQ----YYCDACDATFTTKQNLEVHMRTHTGERPYQC--EVCNKRFSQKSSLNTHKR 114
           + Y      + C+ C A+F  K  LE+H+RTH+GERP+ C  E C+KRFSQKS+LN HKR
Sbjct: 144 MRYWSIHKPFQCNQCSASFGRKPYLEIHLRTHSGERPFACDREGCDKRFSQKSTLNIHKR 203

Query: 115 IHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQ 174
           +H        +P+ C  C A F RK YL++                              
Sbjct: 204 VH----DPNHRPFTCEHCPATFCRKPYLDI------------------------------ 229

Query: 175 VHMRTHTGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRW 234
            H+R+HTGERPF+C  C KRF+Q+S+LN HKR+HTGERPYACDIC+K FAVKSYVT+HRW
Sbjct: 230 -HIRSHTGERPFECVTCLKRFSQRSTLNIHKRIHTGERPYACDICNKTFAVKSYVTAHRW 288

Query: 235 SHVGDKPFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQNK 292
           SHV +KP  C  C +TFTSKSQFA+H+RT H+ G N  C +CGR+F+RDSYLIRH N+
Sbjct: 289 SHVSEKPLNCDRCSMTFTSKSQFAIHIRT-HSAGQNFECRLCGRTFIRDSYLIRHNNR 345




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357609605|gb|EHJ66538.1| zinc finger protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|328715046|ref|XP_001949223.2| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193591726|ref|XP_001944018.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328704791|ref|XP_003242604.1| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|301765518|ref|XP_002918203.1| PREDICTED: zinc finger protein 268-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information
>gi|328702980|ref|XP_001947926.2| PREDICTED: zinc finger protein 271-like, partial [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328702988|ref|XP_001943799.2| PREDICTED: zinc finger protein 271-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|344292677|ref|XP_003418052.1| PREDICTED: zinc finger protein 182 [Loxodonta africana] Back     alignment and taxonomy information
>gi|432953118|ref|XP_004085296.1| PREDICTED: oocyte zinc finger protein XlCOF6-like, partial [Oryzias latipes] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query292
UNIPROTKB|J9NXK0744 ZNF84 "Uncharacterized protein 0.941 0.369 0.437 1.5e-65
UNIPROTKB|I3LME5604 ZNF300 "Uncharacterized protei 0.958 0.463 0.439 8.5e-65
UNIPROTKB|F5H630737 ZNF84 "Zinc finger protein 84" 0.952 0.377 0.435 1.8e-64
UNIPROTKB|P51523738 ZNF84 "Zinc finger protein 84" 0.952 0.376 0.435 1.8e-64
UNIPROTKB|E2RKW7606 ZNF300 "Uncharacterized protei 0.958 0.462 0.432 2.9e-64
UNIPROTKB|D4A5T4717 Zfp39 "Protein Zfp39" [Rattus 0.945 0.384 0.450 4.7e-64
UNIPROTKB|G3V1K9567 ZNF782 "Zinc finger protein 78 0.958 0.493 0.435 6e-64
UNIPROTKB|H0Y892688 ZNF782 "Zinc finger protein 78 0.958 0.406 0.435 6e-64
UNIPROTKB|Q6ZMW2699 ZNF782 "Zinc finger protein 78 0.958 0.400 0.435 6e-64
UNIPROTKB|F5GWS1568 ZNF300 "Zinc finger protein 30 0.958 0.492 0.432 6e-64
UNIPROTKB|J9NXK0 ZNF84 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 667 (239.9 bits), Expect = 1.5e-65, P = 1.5e-65
 Identities = 127/290 (43%), Positives = 173/290 (59%)

Query:     4 HSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPY 63
             H+G KP+ C+ C  +F RK  L  H RTHTGE+P++C  C K FS+K +L  H+R+H   
Sbjct:   459 HTGEKPFVCSKCGKAFSRKSQLVRHQRTHTGEKPYECSECGKAFSEKLSLTNHQRIHTGE 518

Query:    64 IQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTE 123
               Y C  C   F  K +L  H RTHTGE+PY+C  C K F +KSSL TH+R H     T 
Sbjct:   519 KPYVCSECGKAFCQKSHLISHQRTHTGEKPYECTECGKAFGEKSSLATHQRTH-----TG 573

Query:   124 DKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQP---SLGNNTWSAKFLTSLFSHQVHMRTH 180
             +KPY C  C+ AFS+K  L   H  +    +P   SL    +  K  + L  HQ   RTH
Sbjct:   574 EKPYGCRDCEKAFSQKSQLNT-HQRIHTGEKPYECSLCRKAFFEK--SELIRHQ---RTH 627

Query:   181 TGERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDK 240
             TGE+P++C+ C K F +KSSL  H+R HTGE+P+ C +C K F+ KS++  H+ +H G+K
Sbjct:   628 TGEKPYECSECGKAFREKSSLINHQRTHTGEKPFECSVCGKTFSRKSHLIPHQRTHTGEK 687

Query:   241 PFGCTSCHLTFTSKSQFAVHLRTHHTVGANHVCNVCGRSFVRDSYLIRHQ 290
             P+GC+ C   F+ KSQ   H R H T    + C+ CG++F + S LI HQ
Sbjct:   688 PYGCSECRKAFSQKSQLVNHQRIH-TGEKPYQCHECGKAFSQKSQLINHQ 736


GO:0008270 "zinc ion binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
UNIPROTKB|I3LME5 ZNF300 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F5H630 ZNF84 "Zinc finger protein 84" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P51523 ZNF84 "Zinc finger protein 84" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RKW7 ZNF300 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|D4A5T4 Zfp39 "Protein Zfp39" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V1K9 ZNF782 "Zinc finger protein 782" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y892 ZNF782 "Zinc finger protein 782" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZMW2 ZNF782 "Zinc finger protein 782" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GWS1 ZNF300 "Zinc finger protein 300" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 9e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 7e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.001
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
cd11674 1166 cd11674, lambda-1, inner capsid protein lambda-1 o 0.002
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 38.5 bits (90), Expect = 9e-05
 Identities = 18/26 (69%), Positives = 20/26 (76%)

Query: 80  NLEVHMRTHTGERPYQCEVCNKRFSQ 105
           NL  HMRTHTGE+PY+C VC K FS 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|212564 cd11674, lambda-1, inner capsid protein lambda-1 or VP3 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 292
KOG2462|consensus279 100.0
KOG2462|consensus279 99.98
KOG1074|consensus 958 99.97
KOG3608|consensus467 99.97
KOG3608|consensus467 99.96
KOG1074|consensus958 99.95
KOG3623|consensus 1007 99.95
KOG3576|consensus267 99.82
KOG3576|consensus267 99.75
KOG3623|consensus1007 99.7
PHA00733128 hypothetical protein 99.48
PLN03086567 PRLI-interacting factor K; Provisional 99.45
PHA00733128 hypothetical protein 99.43
PLN03086567 PRLI-interacting factor K; Provisional 99.41
PHA0276855 hypothetical protein; Provisional 99.22
KOG3993|consensus500 99.2
PHA0276855 hypothetical protein; Provisional 99.2
KOG3993|consensus500 99.02
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 99.0
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.97
PHA0073279 hypothetical protein 98.79
PHA0061644 hypothetical protein 98.75
PHA0073279 hypothetical protein 98.74
PHA0061644 hypothetical protein 98.65
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.54
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.34
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 98.28
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 98.25
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 98.19
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.15
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 98.09
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 98.03
COG5189423 SFP1 Putative transcriptional repressor regulating 97.99
COG5189423 SFP1 Putative transcriptional repressor regulating 97.95
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.93
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.9
smart0035526 ZnF_C2H2 zinc finger. 97.42
smart0035526 ZnF_C2H2 zinc finger. 97.4
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.39
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 97.36
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.32
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.31
PRK04860160 hypothetical protein; Provisional 97.2
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.19
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 97.16
PRK04860160 hypothetical protein; Provisional 97.13
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 97.02
KOG2231|consensus 669 96.94
KOG2785|consensus 390 96.84
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.82
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.71
KOG1146|consensus 1406 96.46
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 96.33
KOG2231|consensus 669 96.3
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 95.92
KOG1146|consensus 1406 95.9
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.8
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 95.48
COG5048467 FOG: Zn-finger [General function prediction only] 95.37
KOG2785|consensus 390 95.31
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 95.22
COG5048467 FOG: Zn-finger [General function prediction only] 94.78
COG5236493 Uncharacterized conserved protein, contains RING Z 94.72
KOG2893|consensus 341 94.59
KOG4173|consensus253 94.27
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 94.2
KOG2482|consensus423 93.62
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.09
COG404965 Uncharacterized protein containing archaeal-type C 92.81
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 92.63
KOG2893|consensus 341 92.61
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 92.31
KOG4173|consensus253 92.13
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 91.85
COG404965 Uncharacterized protein containing archaeal-type C 91.68
COG288861 Predicted Zn-ribbon RNA-binding protein with a fun 91.25
TIGR0209838 MJ0042_CXXC MJ0042 family finger-like domain. This 90.34
PF1371736 zinc_ribbon_4: zinc-ribbon domain 89.95
COG1592166 Rubrerythrin [Energy production and conversion] 89.09
PF09986214 DUF2225: Uncharacterized protein conserved in bact 88.63
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 88.47
PF0289245 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc 88.16
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 87.51
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 87.48
PRK06266178 transcription initiation factor E subunit alpha; V 87.41
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 86.8
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 86.54
KOG2186|consensus 276 86.38
PRK00464154 nrdR transcriptional regulator NrdR; Validated 86.22
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 86.13
KOG2482|consensus423 85.97
smart0065944 RPOLCX RNA polymerase subunit CX. present in RNA p 85.85
smart0073426 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18 85.41
PHA0062659 hypothetical protein 85.15
COG1592166 Rubrerythrin [Energy production and conversion] 85.11
PRK1489059 putative Zn-ribbon RNA-binding protein; Provisiona 85.05
PF1371937 zinc_ribbon_5: zinc-ribbon domain 85.0
smart00531147 TFIIE Transcription initiation factor IIE. 84.8
smart00531147 TFIIE Transcription initiation factor IIE. 84.59
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 84.4
smart0083441 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_C 84.11
TIGR0260552 CxxC_CxxC_SSSS putative regulatory protein, FmdB f 83.95
PRK06266178 transcription initiation factor E subunit alpha; V 82.7
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 82.57
KOG2186|consensus276 80.57
smart0061450 ZnF_BED BED zinc finger. DNA-binding domain in chr 80.42
>KOG2462|consensus Back     alignment and domain information
Probab=100.00  E-value=8.8e-35  Score=217.92  Aligned_cols=105  Identities=36%  Similarity=0.789  Sum_probs=97.5

Q ss_pred             CCCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhh
Q psy4830         183 ERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLR  262 (292)
Q Consensus       183 ~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~  262 (292)
                      .+.+.|++|||.|.+...|..|+++|+  -+++|.+|||.|.+.+.|+.|+++|+|||||.|+.|++.|+++++|+.||+
T Consensus       159 ~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQ  236 (279)
T KOG2462|consen  159 KKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQ  236 (279)
T ss_pred             cccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccccccCCCCccCCcccchhcchHHHHHHHH
Confidence            356889999999999999999999997  589999999999999999999999999999999999999999999999999


Q ss_pred             hhcCCCCCcccCCCCCCccChHHHHhhh
Q psy4830         263 THHTVGANHVCNVCGRSFVRDSYLIRHQ  290 (292)
Q Consensus       263 ~hh~~~~~~~C~~C~~~f~~~~~l~~H~  290 (292)
                      +| .+.++|+|..|+|+|...+.|.+|.
T Consensus       237 TH-S~~K~~qC~~C~KsFsl~SyLnKH~  263 (279)
T KOG2462|consen  237 TH-SDVKKHQCPRCGKSFALKSYLNKHS  263 (279)
T ss_pred             hh-cCCccccCcchhhHHHHHHHHHHhh
Confidence            96 6778999999999999999999995



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain Back     alignment and domain information
>PF13717 zinc_ribbon_4: zinc-ribbon domain Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>PF02892 zf-BED: BED zinc finger; InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>PRK00464 nrdR transcriptional regulator NrdR; Validated Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>smart00659 RPOLCX RNA polymerase subunit CX Back     alignment and domain information
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger Back     alignment and domain information
>PHA00626 hypothetical protein Back     alignment and domain information
>COG1592 Rubrerythrin [Energy production and conversion] Back     alignment and domain information
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional Back     alignment and domain information
>PF13719 zinc_ribbon_5: zinc-ribbon domain Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein Back     alignment and domain information
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>smart00614 ZnF_BED BED zinc finger Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 7e-39
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-33
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-11
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 2e-16
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 6e-12
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-10
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-16
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 6e-16
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 2e-15
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 3e-15
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 7e-15
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 1e-13
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 1e-13
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 5e-13
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 8e-13
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 8e-13
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 1e-12
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-12
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 1e-12
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 2e-12
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 5e-12
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 8e-12
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 5e-12
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 6e-07
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 8e-12
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 6e-11
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 6e-11
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-10
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-09
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-10
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-10
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-10
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-10
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 1e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 1e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 8e-08
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 1e-09
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-09
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-07
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 2e-09
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-04
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-09
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 4e-09
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 8e-09
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-07
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 1e-06
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-07
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 3e-07
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 9e-07
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-06
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 9e-05
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-06
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-06
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-05
2ep2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-05
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-05
1x6h_A86 Solution Structures Of The C2h2 Type Zinc Finger Do 7e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 3e-05
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 1e-04
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 4e-05
2ep3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 5e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 6e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 7e-05
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 6e-05
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-05
2ely_A46 Solution Structure Of The Third Zf-C2h2 Domain From 9e-05
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 1e-04
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 1e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2ep1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2em6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2enh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 4e-04
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2ytg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2en9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2emi_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2emx_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2eq3_A46 Solution Structure Of The 17th C2h2 Type Zinc Finge 7e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 8e-04
2em1_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-04
2epz_A46 Solution Structure Of The 4th C2h2 Type Zinc Finger 9e-04
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 157 bits (397), Expect = 7e-39, Method: Compositional matrix adjust. Identities = 83/210 (39%), Positives = 107/210 (50%), Gaps = 36/210 (17%) Query: 3 LHSGNKPYHCTACDASFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIP 62 L G KPY C C SF R +L H RTHTGE+P++C C K FS K L H+R H Sbjct: 15 LEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTG 74 Query: 63 YIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHT 122 Y C C +F+ + NL H RTHTGE+PY C C K FSQ + L H+R HT Sbjct: 75 EKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRT-----HT 129 Query: 123 EDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTG 182 +KPY C C +FSR+ L H RTHTG Sbjct: 130 GEKPYKCPECGKSFSREDNL-------------------------------HTHQRTHTG 158 Query: 183 ERPFQCAVCSKRFTQKSSLNTHKRVHTGER 212 E+P++C C K F+++ +LN H+R HTG++ Sbjct: 159 EKPYKCPECGKSFSRRDALNVHQRTHTGKK 188
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EP2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 603- 635) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|1X6H|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Transcriptional Repressor Ctcf Length = 86 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2EP3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 631- 663) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2ELY|A Chain A, Solution Structure Of The Third Zf-C2h2 Domain From Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EP1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 435- 467) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EM6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 199- 231) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EMG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 463- 495) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2ENH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 556- 588) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 369- 401) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EN9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 415- 447) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMI|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 547- 579) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMX|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 273- 303) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EQ3|A Chain A, Solution Structure Of The 17th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|2EM1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 637- 667) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EPZ|A Chain A, Solution Structure Of The 4th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query292
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 8e-66
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-62
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-59
2i13_A 190 AART; DNA binding, zinc finger, DNA binding protei 8e-04
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-48
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-37
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-31
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 7e-42
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-38
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-38
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 5e-31
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-28
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 3e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-41
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 7e-40
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-37
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-35
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 6e-25
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-39
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-39
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-38
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 4e-32
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-32
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-37
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-33
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-30
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 1e-29
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-37
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 4e-36
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-30
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 2e-27
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-35
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-35
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-33
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 1e-22
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-34
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-31
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 3e-22
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-33
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-32
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-28
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 6e-28
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-30
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-29
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-25
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 9e-20
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 4e-08
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-28
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-27
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-25
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 4e-24
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 9e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 9e-28
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-26
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-25
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 8e-23
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-21
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 2e-13
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-26
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-25
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-24
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 3e-19
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-18
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-18
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-25
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-24
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-22
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 5e-21
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-17
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-04
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-25
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-23
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-21
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-18
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 3e-16
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-24
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-24
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 3e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-22
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-17
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 5e-10
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-24
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 6e-23
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-21
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-18
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 5e-17
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 2e-08
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-24
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 9e-23
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-20
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 8e-19
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 1e-18
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 2e-15
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-09
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-23
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-22
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 5e-21
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 3e-20
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 9e-14
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-23
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-21
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-17
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-15
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-22
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-21
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 1e-19
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 3e-17
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-21
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-18
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-16
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-14
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-07
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 4e-21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 8e-21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-20
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 9e-21
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-19
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-18
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 4e-16
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-13
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 5e-09
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 2e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-17
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-14
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-11
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-17
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-15
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-11
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-16
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-08
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-08
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 8e-16
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-15
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 4e-15
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-12
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-16
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-16
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-11
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-16
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-11
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-16
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-11
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-04
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-14
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 3e-13
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-11
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 1e-08
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 9e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-16
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-16
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-11
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-16
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-16
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-10
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-04
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-16
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-16
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-11
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-16
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-16
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-10
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-11
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-10
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-16
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-10
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-09
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-04
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-16
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-10
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 8e-04
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-10
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-05
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 9e-16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-13
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-10
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-04
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-13
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-11
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-11
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-04
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-15
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 1e-13
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 9e-10
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-04
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-11
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-10
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-06
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-04
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-11
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-15
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-05
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-15
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-13
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-10
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-04
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-13
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-10
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-04
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-10
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-10
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-04
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-10
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-13
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-10
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-04
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-14
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 8e-12
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-09
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-15
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 8e-11
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 1e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-10
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-15
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-13
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 9e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-08
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-04
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-04
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 6e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-10
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 7e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-10
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-15
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-11
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-10
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 6e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-15
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-10
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 1e-04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-14
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-10
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-04
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-13
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-10
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-06
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 5e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-13
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-04
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-15
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-10
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-08
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-04
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-15
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-14
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-13
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-11
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 3e-10
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 2e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-15
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 1e-12
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-10
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 3e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-15
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-15
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-08
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-04
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-10
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-04
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-14
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-10
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-15
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-10
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-04
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-15
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-15
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-15
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-08
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-04
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-04
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-10
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-15
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-10
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-15
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-12
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 5e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 4e-05
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-04
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-09
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-05
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-10
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-14
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-09
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-13
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-04
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-14
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-04
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-14
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 6e-10
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-08
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-04
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 1e-14
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 4e-14
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 2e-12
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 3e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-13
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-14
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-11
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-10
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-08
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-04
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-10
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-14
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-12
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-10
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 2e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 5e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-12
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-10
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 5e-14
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-09
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-08
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 1e-06
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-04
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-10
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 8e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-13
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-11
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 9e-08
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-07
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 3e-06
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-13
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-04
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-12
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-11
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-09
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-08
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-11
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 1e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-09
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-08
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-07
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 6e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 4e-05
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-11
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 9e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-10
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-08
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-07
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-05
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 3e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 3e-10
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-09
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 5e-08
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 8e-08
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 4e-06
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 5e-04
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 4e-08
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 9e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 4e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-08
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 5e-05
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 1e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-07
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 3e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 5e-06
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 1e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 3e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 5e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 3e-04
3ray_A237 PR domain-containing protein 11; structural genomi 3e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 6e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  203 bits (518), Expect = 8e-66
 Identities = 78/227 (34%), Positives = 112/227 (49%), Gaps = 42/227 (18%)

Query: 18  SFCRKPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHI---PYIQYYCDACDAT 74
           S               GE+P+ C  C K FS+   L  H+R H    PY    C  C  +
Sbjct: 2   SEFGSSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYK---CPECGKS 58

Query: 75  FTTKQNLEVHMRTHTGERPYQCEVCNKRFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDA 134
           F+ K++L  H RTHTGE+PY+C  C K FSQ+++L  H+R      HT +KPY C  C  
Sbjct: 59  FSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRT-----HTGEKPYACPECGK 113

Query: 135 AFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHTGERPFQCAVCSKR 194
           +FS+  +L                               + H RTHTGE+P++C  C K 
Sbjct: 114 SFSQLAHL-------------------------------RAHQRTHTGEKPYKCPECGKS 142

Query: 195 FTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKP 241
           F+++ +L+TH+R HTGE+PY C  C K F+ +  +  H+ +H G K 
Sbjct: 143 FSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQRTHTGKKT 189


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>3ray_A PR domain-containing protein 11; structural genomics consortium, SGC, histone methylation, Zn transcriptional regulation, chromatin, transcription; 1.73A {Homo sapiens} Length = 237 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 100.0
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.98
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.97
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.97
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.95
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.95
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.94
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.94
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.94
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.94
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.94
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.93
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.93
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.9
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.9
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.9
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.9
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.89
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.88
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.88
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.88
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.87
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.86
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.86
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.86
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.85
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.85
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.84
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.84
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.84
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.83
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.83
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.83
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.82
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.82
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.81
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.8
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.79
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.79
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.78
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.77
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.77
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.77
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.77
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.75
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.75
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.74
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.74
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.73
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.73
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.73
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.73
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.72
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.71
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.7
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.7
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.7
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.7
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.7
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.69
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.69
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.68
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.68
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.68
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.68
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.67
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.66
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.65
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.65
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.64
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.64
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.63
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.62
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.61
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.59
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.57
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.56
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.55
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.51
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.51
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.49
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.49
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.49
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.49
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.49
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.49
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.49
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.49
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.49
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.49
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.48
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.48
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.48
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.48
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.48
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.48
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.48
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.48
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.48
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.47
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.47
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.47
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.47
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.47
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.47
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.46
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.46
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.46
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.46
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.46
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.46
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.46
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.46
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.46
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.46
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.46
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.46
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.46
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.45
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.45
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.45
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.45
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.45
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.45
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.45
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.45
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.45
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.44
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.44
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.44
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.44
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.44
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.43
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.43
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.43
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.43
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.43
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.43
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.42
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.42
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.42
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.41
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.41
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.41
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.4
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.4
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.39
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.39
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.39
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.39
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.39
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.38
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.38
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.38
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.38
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.37
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.37
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.37
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.37
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.37
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.37
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.36
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.36
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.36
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.36
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.36
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.36
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.36
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.35
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.35
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.35
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.35
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.35
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.35
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.35
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.35
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.35
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.35
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.34
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.34
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.33
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.33
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.33
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.33
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.33
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.32
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.32
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.32
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.32
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.32
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.32
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.32
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.31
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.31
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.31
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.31
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.31
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.3
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.3
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.3
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.3
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.29
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.29
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.28
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.28
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.28
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.27
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.27
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.27
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.26
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 99.26
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.26
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.25
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.24
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.23
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.23
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 99.22
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.21
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.21
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.17
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 99.11
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.04
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.03
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.02
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.01
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 99.0
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 99.0
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.96
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.93
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.93
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.93
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.92
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.91
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.9
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.87
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.86
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.84
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.83
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.82
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.81
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.8
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.76
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.71
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.71
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.7
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.69
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.68
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.68
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.68
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.66
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.63
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.63
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.58
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.57
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.56
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.56
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.54
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.54
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.53
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.53
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.53
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.53
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.53
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.52
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.52
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.51
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.51
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.51
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.51
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.5
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.5
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.49
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.49
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.49
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.49
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.46
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.85
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.46
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.45
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.83
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.44
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.44
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.4
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.7
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.69
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.16
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.1
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.02
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.82
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.7
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 97.39
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 97.36
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.98
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.71
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.29
2e72_A49 POGO transposable element with ZNF domain; zinc fi 96.17
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 95.76
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 94.91
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 93.12
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 93.02
2k5c_A95 Uncharacterized protein PF0385; structural genomic 91.83
2yuc_A76 TNF receptor-associated factor 4; ZF-TRAF, cystein 91.68
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 90.67
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 90.63
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 90.23
2elu_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 89.98
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 89.65
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 89.52
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 88.63
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 87.54
2jvx_A28 NF-kappa-B essential modulator; CCHC classical zin 87.38
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 86.45
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 86.37
2gmg_A105 Hypothetical protein PF0610; winged-helix like pro 86.12
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 84.39
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 83.82
2i5o_A39 DNA polymerase ETA; zinc finger, DNA polymerase,PO 83.64
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 82.99
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 82.76
2djr_A76 Zinc finger BED domain-containing protein 2; C2H2 81.84
2yrk_A55 Zinc finger homeobox protein 4; structure genomics 81.48
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 80.18
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=1.3e-44  Score=274.89  Aligned_cols=185  Identities=39%  Similarity=0.823  Sum_probs=126.7

Q ss_pred             hhHHHHHHhhhcCCCCcccccchhhcCChhHHHHHHhhcCCCcceecccccccCCChhHHHHHHHhcCCCCceecCcccc
Q psy4830          22 KPYLEIHMRTHTGERPFQCVVCLKRFSQKSALNTHKRMHIPYIQYYCDACDATFTTKQNLEVHMRTHTGERPYQCEVCNK  101 (292)
Q Consensus        22 ~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~  101 (292)
                      ...|..|+..|.++++|.|++|++.|.+...|..|++.|.+..+|.|++|++.|.+...|..|+++|.++++|.|++|++
T Consensus         6 ~~~l~~h~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~   85 (190)
T 2i13_A            6 SSSSVAQAALEPGEKPYACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYKCPECGK   85 (190)
T ss_dssp             -------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCC
T ss_pred             hccchhhhhhcCCCCCCcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCccCcccCC
Confidence            45677788888888888888888888888888888888888788888888888888888888888888888888888888


Q ss_pred             ccCChHHHHHHHHHhhcccCCCCCCccCCCchhhhchhHHHhhhhhhhhcccCCCCCCCcchhhhhcchhhhhhhcccCC
Q psy4830         102 RFSQKSSLNTHKRIHINYLHTEDKPYHCTGCDAAFSRKQYLEVNHTTVLAVMQPSLGNNTWSAKFLTSLFSHQVHMRTHT  181 (292)
Q Consensus       102 ~f~~~~~l~~H~~~h~~~~~~~~~~~~C~~C~~~f~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~h~~~~~  181 (292)
                      .|.+...|..|+++|.                                                                
T Consensus        86 ~f~~~~~l~~H~~~h~----------------------------------------------------------------  101 (190)
T 2i13_A           86 SFSQRANLRAHQRTHT----------------------------------------------------------------  101 (190)
T ss_dssp             EESCHHHHHHHHHHHH----------------------------------------------------------------
T ss_pred             ccCCHHHHHHHHHhcC----------------------------------------------------------------
Confidence            8888888888776542                                                                


Q ss_pred             CCCCccccccccccCCchHHHHHHhhhcCCCCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHh
Q psy4830         182 GERPFQCAVCSKRFTQKSSLNTHKRVHTGERPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHL  261 (292)
Q Consensus       182 ~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~  261 (292)
                      ++++|.|++|++.|.+...|..|+++|++++||.|++|++.|.+...|..|+++|++++||.|++|+++|.+..+|..|+
T Consensus       102 ~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~~~~~C~~C~~~f~~~~~L~~H~  181 (190)
T 2i13_A          102 GEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRDALNVHQ  181 (190)
T ss_dssp             TCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCCCCEECTTTCCEESSHHHHHHHH
T ss_pred             CCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCCCCeECCCCCCccCCHHHHHHHH
Confidence            34568888888888888888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             hhhcCCCCCc
Q psy4830         262 RTHHTVGANH  271 (292)
Q Consensus       262 ~~hh~~~~~~  271 (292)
                      ++| .+++||
T Consensus       182 ~~H-~~~k~~  190 (190)
T 2i13_A          182 RTH-TGKKTS  190 (190)
T ss_dssp             TTC-------
T ss_pred             Hhc-CCCCCC
Confidence            886 455554



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2yuc_A TNF receptor-associated factor 4; ZF-TRAF, cysteine-rich domain associated with ring and TRAF domains protein 1, malignant 62; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>2elu_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2elw_A Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2jvx_A NF-kappa-B essential modulator; CCHC classical zinc finger, NEMO zinc finger, beta-BETA- alpha fold, coiled coil, cytoplasm, disease mutation; NMR {Synthetic} PDB: 2jvy_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>2gmg_A Hypothetical protein PF0610; winged-helix like protein with metal binding site, structura genomics, PSI, protein structure initiative; NMR {Pyrococcus furiosus} SCOP: a.4.5.82 Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>2i5o_A DNA polymerase ETA; zinc finger, DNA polymerase,POL ETA, UBZ, ubiquitin-binding zinc finger, translesion synthesis, ubiquitin-binding domain; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2djr_A Zinc finger BED domain-containing protein 2; C2H2 type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yrk_A Zinc finger homeobox protein 4; structure genomics, ZF-C2H2 domain, ZFH-4, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.37.1.4 Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 292
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-10
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 5e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 1e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-07
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 8e-04
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 0.003
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-07
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-06
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 0.002
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 2e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 6e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 8e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 4e-06
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-04
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 0.002
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-07
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-06
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-04
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-07
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-06
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-04
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 1e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-08
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 4e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 5e-08
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-07
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-06
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 2e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-04
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 8e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 6e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 4e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 7e-05
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-07
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-06
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-05
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-04
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 4e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-05
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-06
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-04
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-06
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.002
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 1e-04
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 6e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.002
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 0.003
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-05
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-04
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.002
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-05
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 4e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 6e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.002
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 0.003
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 24
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.2 bits (131), Expect = 6e-11
 Identities = 17/32 (53%), Positives = 23/32 (71%)

Query: 180 HTGERPFQCAVCSKRFTQKSSLNTHKRVHTGE 211
           H+GE+P+ C  C K F++ S L  H+RVHTGE
Sbjct: 2   HSGEKPYGCVECGKAFSRSSILVQHQRVHTGE 33


>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query292
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.78
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.77
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.51
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.49
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.47
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.43
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.42
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.42
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.41
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.4
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.39
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.36
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.32
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.3
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.28
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.27
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.26
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.24
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.24
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.23
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.23
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.21
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.19
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.18
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.17
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 99.14
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.09
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.08
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 99.0
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.99
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.98
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.95
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.94
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.91
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.81
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.79
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.76
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.73
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.71
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.71
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.67
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.62
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.61
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.6
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.59
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.47
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.46
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.35
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.21
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.21
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 98.19
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.15
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.1
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 98.04
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.01
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.99
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.98
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.97
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.91
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.88
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.87
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.85
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.84
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.82
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.8
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.76
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.69
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.67
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.67
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 97.66
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.65
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.63
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.53
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.4
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.38
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.33
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.33
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.32
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.32
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.27
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.21
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.13
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.12
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 97.12
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.11
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.03
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.99
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.68
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.6
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.54
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 96.5
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 96.47
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.41
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.39
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 96.13
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.34
d1y0jb136 U-shaped transcription factor, different fingers { 95.16
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.15
d1y0jb136 U-shaped transcription factor, different fingers { 95.04
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 94.72
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 94.48
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 94.44
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 94.01
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.96
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 93.89
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 93.87
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.87
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 93.74
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 93.51
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 93.49
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 93.32
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.93
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 92.58
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 92.49
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 92.43
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 92.13
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 91.99
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 91.09
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 89.26
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.16
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 88.22
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 86.45
d2ghfa236 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 86.11
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 85.6
d1wjpa341 Zinc finger protein 295, ZNF295 {Human (Homo sapie 83.56
d1wjpa226 Zinc finger protein 295, ZNF295 {Human (Homo sapie 83.36
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 83.05
d2ghfa158 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 81.73
d2yrka148 Zinc finger homeobox protein 4, ZFHX4 {Human (Homo 80.93
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.78  E-value=2.3e-20  Score=107.40  Aligned_cols=51  Identities=33%  Similarity=0.730  Sum_probs=25.1

Q ss_pred             CCccccccccccccchhhhhhhccccCCcceeCCccccccCChhHHHHHhhh
Q psy4830         212 RPYACDICDKRFAVKSYVTSHRWSHVGDKPFGCTSCHLTFTSKSQFAVHLRT  263 (292)
Q Consensus       212 ~~~~C~~C~k~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  263 (292)
                      +||+|+ ||+.|..+..|..|+++|+|++||.|++||++|.+.++|..|+++
T Consensus         2 K~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~   52 (53)
T d2csha1           2 KLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKI   52 (53)
T ss_dssp             CCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTT
T ss_pred             cCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhc
Confidence            444442 444444444444444445555555555555555555555555444



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1wjpa3 g.37.1.1 (A:67-107) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjpa2 g.37.1.1 (A:43-66) Zinc finger protein 295, ZNF295 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yrka1 g.37.1.4 (A:8-55) Zinc finger homeobox protein 4, ZFHX4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure