Psyllid ID: psy5057

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-------
MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYCNL
cEEEEEccccEEEEccccccEEEEEEccEEEEEEEEccccEEEEEEcccccEEEEHHccccccEEEEEEEccEEEEEEEHHHHHHHc
cccEEcccccEEEEEccccccEEEEEccEEEEEEEcccccEEEEEEccccccEEEEEEcccccEEEEEEEcccEEEEEcHHHHHHHc
mfekpveagdivirqgddgdffyVIESgryeasveidgeDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYCNL
mfekpveagdivirqgddgdffYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKatstgslwamdRKTFYCNL
MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYCNL
*********DIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYC**
*FEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYCNL
MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYCNL
*FEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYCNL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRKTFYCNL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query87 2.2.26 [Sep-21-2011]
P81900 377 cAMP-dependent protein ki no N/A 0.908 0.209 0.614 9e-24
P31322 418 cAMP-dependent protein ki yes N/A 0.873 0.181 0.590 4e-22
P12369 416 cAMP-dependent protein ki yes N/A 0.781 0.163 0.590 5e-22
P31324 416 cAMP-dependent protein ki yes N/A 0.781 0.163 0.590 5e-22
P13861 404 cAMP-dependent protein ki yes N/A 0.816 0.175 0.602 6e-22
P31323 418 cAMP-dependent protein ki no N/A 0.873 0.181 0.590 6e-22
P12367 401 cAMP-dependent protein ki no N/A 0.816 0.177 0.602 9e-22
P12368 401 cAMP-dependent protein ki no N/A 0.816 0.177 0.602 9e-22
P00515 401 cAMP-dependent protein ki no N/A 0.862 0.187 0.590 3e-21
Q26619 369 cAMP-dependent protein ki yes N/A 0.908 0.214 0.602 3e-20
>sp|P81900|KAPR2_DROME cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster GN=Pka-R2 PE=1 SV=2 Back     alignment and function desciption
 Score =  108 bits (270), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 63/83 (75%), Gaps = 4/83 (4%)

Query: 1   MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYN 60
           MFE+ V+ GD +IRQGDDGD FYVIESG Y+  +     DK ++ Y   G FGELALLYN
Sbjct: 140 MFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYIN----DKHINTYNHTGLFGELALLYN 195

Query: 61  MPRAATIKATSTGSLWAMDRKTF 83
           MPRAAT++A ++G LWAMDR+TF
Sbjct: 196 MPRAATVQAETSGLLWAMDRQTF 218
Type II regulatory chains mediate membrane association by binding to anchoring proteins, including the MAP2 kinase. The regulatory subunit may play an essential role in the regulation of neuronal activity in the brain. Has a role in circadian locomotor rhythm, and behavioral response to cocaine and ethanol.
Drosophila melanogaster (taxid: 7227)
>sp|P31322|KAP3_BOVIN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus GN=PRKAR2B PE=2 SV=2 Back     alignment and function description
>sp|P12369|KAP3_RAT cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus GN=Prkar2b PE=1 SV=3 Back     alignment and function description
>sp|P31324|KAP3_MOUSE cAMP-dependent protein kinase type II-beta regulatory subunit OS=Mus musculus GN=Prkar2b PE=1 SV=3 Back     alignment and function description
>sp|P13861|KAP2_HUMAN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens GN=PRKAR2A PE=1 SV=2 Back     alignment and function description
>sp|P31323|KAP3_HUMAN cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens GN=PRKAR2B PE=1 SV=3 Back     alignment and function description
>sp|P12367|KAP2_MOUSE cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Mus musculus GN=Prkar2a PE=1 SV=2 Back     alignment and function description
>sp|P12368|KAP2_RAT cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Rattus norvegicus GN=Prkar2a PE=1 SV=3 Back     alignment and function description
>sp|P00515|KAP2_BOVIN cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Bos taurus GN=PRKAR2A PE=1 SV=2 Back     alignment and function description
>sp|Q26619|KAPR_STRPU cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
345492835 392 PREDICTED: cAMP-dependent protein kinase 0.908 0.201 0.674 6e-26
156554114 378 PREDICTED: cAMP-dependent protein kinase 0.908 0.208 0.674 7e-26
380029297 383 PREDICTED: cAMP-dependent protein kinase 0.954 0.216 0.666 1e-25
193688312 385 PREDICTED: cAMP-dependent protein kinase 0.954 0.215 0.690 1e-25
325303150 236 TPA_inf: cAMP-dependent protein kinase t 0.954 0.351 0.690 4e-25
66517761 383 PREDICTED: cAMP-dependent protein kinase 0.954 0.216 0.654 4e-25
443726104 369 hypothetical protein CAPTEDRAFT_154190 [ 0.977 0.230 0.629 6e-25
307202639 375 cAMP-dependent protein kinase type II re 0.954 0.221 0.630 6e-25
91085999 383 PREDICTED: similar to cAMP-dependent pro 0.954 0.216 0.678 6e-25
270009933 411 hypothetical protein TcasGA2_TC009259 [T 0.954 0.201 0.678 7e-25
>gi|345492835|ref|XP_003426938.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 6 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  121 bits (303), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 68/83 (81%), Gaps = 4/83 (4%)

Query: 1   MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYN 60
           MFEK V+AG+ +IRQGDDGD FYVIE GR+E  V+    D L+H Y++ G+FGELALLYN
Sbjct: 155 MFEKTVQAGEFIIRQGDDGDNFYVIEKGRFEVYVK----DTLIHTYDNSGAFGELALLYN 210

Query: 61  MPRAATIKATSTGSLWAMDRKTF 83
           MPRAAT+KA S G+LWAMDR+TF
Sbjct: 211 MPRAATVKAISPGTLWAMDRQTF 233

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|156554114|ref|XP_001601087.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 1 [Nasonia vitripennis] gi|345492826|ref|XP_003426934.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 2 [Nasonia vitripennis] gi|345492828|ref|XP_003426935.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 3 [Nasonia vitripennis] gi|345492831|ref|XP_003426936.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 4 [Nasonia vitripennis] gi|345492833|ref|XP_003426937.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like isoform 5 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380029297|ref|XP_003698313.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like [Apis florea] Back     alignment and taxonomy information
>gi|193688312|ref|XP_001944873.1| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|325303150|tpg|DAA34327.1| TPA_inf: cAMP-dependent protein kinase type II regulatory subunit [Amblyomma variegatum] Back     alignment and taxonomy information
>gi|66517761|ref|XP_392905.2| PREDICTED: cAMP-dependent protein kinase type II regulatory subunit isoform 1 [Apis mellifera] gi|46847760|emb|CAG27571.1| cAMP-dependent protein kinase type II regulatory chain [Apis mellifera carnica] Back     alignment and taxonomy information
>gi|443726104|gb|ELU13397.1| hypothetical protein CAPTEDRAFT_154190 [Capitella teleta] Back     alignment and taxonomy information
>gi|307202639|gb|EFN81960.1| cAMP-dependent protein kinase type II regulatory subunit [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|91085999|ref|XP_972435.1| PREDICTED: similar to cAMP-dependent protein kinase R2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270009933|gb|EFA06381.1| hypothetical protein TcasGA2_TC009259 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query87
UNIPROTKB|F1NC65 293 PRKAR2B "Uncharacterized prote 0.954 0.283 0.602 1.6e-22
FB|FBgn0022382 377 Pka-R2 "cAMP-dependent protein 0.908 0.209 0.614 2.1e-22
UNIPROTKB|H7C1L0200 PRKAR2A "cAMP-dependent protei 0.954 0.415 0.602 1.5e-21
UNIPROTKB|Q9BUB1 382 PRKAR2A "Protein kinase, cAMP- 0.954 0.217 0.602 1.7e-21
RGD|3394 416 Prkar2b "protein kinase, cAMP 0.954 0.199 0.590 1.9e-21
MGI|MGI:97760 416 Prkar2b "protein kinase, cAMP 0.954 0.199 0.590 1.9e-21
UNIPROTKB|E2RRA1 417 PRKAR2B "Uncharacterized prote 0.954 0.199 0.590 1.9e-21
UNIPROTKB|P31322 418 PRKAR2B "cAMP-dependent protei 0.954 0.198 0.590 2e-21
UNIPROTKB|F6Q9S4 418 PRKAR2B "cAMP-dependent protei 0.954 0.198 0.590 2e-21
ZFIN|ZDB-GENE-040426-2427 431 prkar2ab "protein kinase, cAMP 0.965 0.194 0.583 2.3e-21
UNIPROTKB|F1NC65 PRKAR2B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 1.6e-22, P = 1.6e-22
 Identities = 50/83 (60%), Positives = 63/83 (75%)

Query:     1 MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYN 60
             MFEK VE G+ VI QGDDGD FYVI+ G Y+  V+ DG  + +  Y+++GSFGELAL+YN
Sbjct:    53 MFEKLVEGGEHVIDQGDDGDNFYVIDRGTYDIYVKCDGVGRCVGTYDNRGSFGELALMYN 112

Query:    61 MPRAATIKATSTGSLWAMDRKTF 83
              PRAATI ATS G++W +DR TF
Sbjct:   113 TPRAATIIATSPGAIWGLDRVTF 135
GO:0005952 "cAMP-dependent protein kinase complex" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005813 "centrosome" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0006631 "fatty acid metabolic process" evidence=IEA
GO:0007612 "learning" evidence=IEA
GO:0008603 "cAMP-dependent protein kinase regulator activity" evidence=IEA
GO:0031625 "ubiquitin protein ligase binding" evidence=IEA
FB|FBgn0022382 Pka-R2 "cAMP-dependent protein kinase R2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|H7C1L0 PRKAR2A "cAMP-dependent protein kinase type II-alpha regulatory subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BUB1 PRKAR2A "Protein kinase, cAMP-dependent, regulatory, type II, alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|3394 Prkar2b "protein kinase, cAMP dependent regulatory, type II beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97760 Prkar2b "protein kinase, cAMP dependent regulatory, type II beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRA1 PRKAR2B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|P31322 PRKAR2B "cAMP-dependent protein kinase type II-beta regulatory subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F6Q9S4 PRKAR2B "cAMP-dependent protein kinase type II-beta regulatory subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2427 prkar2ab "protein kinase, cAMP-dependent, regulatory, type II, alpha, B" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P31324KAP3_MOUSENo assigned EC number0.59030.78160.1634yesN/A
P31322KAP3_BOVINNo assigned EC number0.59030.87350.1818yesN/A
Q26619KAPR_STRPUNo assigned EC number0.60240.90800.2140yesN/A
P07278KAPR_YEASTNo assigned EC number0.50610.88500.1850yesN/A
P13861KAP2_HUMANNo assigned EC number0.60240.81600.1757yesN/A
P12369KAP3_RATNo assigned EC number0.59030.78160.1634yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 3e-20
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 9e-18
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 1e-17
COG0664 214 COG0664, Crp, cAMP-binding proteins - catabolite g 1e-14
TIGR03896 317 TIGR03896, cyc_nuc_ocin, bacteriocin-type transpor 0.004
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 77.4 bits (191), Expect = 3e-20
 Identities = 31/84 (36%), Positives = 47/84 (55%), Gaps = 1/84 (1%)

Query: 1   MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVE-IDGEDKLMHAYEDKGSFGELALLY 59
           + E+   AG+++IRQGD  D  Y++ SG  E      DG ++++        FGELALL 
Sbjct: 17  LEERRFPAGEVIIRQGDPADSLYIVLSGSVEVYKLDEDGREQIVGFLGPGDLFGELALLG 76

Query: 60  NMPRAATIKATSTGSLWAMDRKTF 83
           N PR+AT++A +   L  + R  F
Sbjct: 77  NGPRSATVRALTDSELLVLPRSDF 100

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|234384 TIGR03896, cyc_nuc_ocin, bacteriocin-type transport-associated protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 87
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.86
PRK10402 226 DNA-binding transcriptional activator YeiL; Provis 99.82
PRK11753 211 DNA-binding transcriptional dual regulator Crp; Pr 99.82
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 99.81
COG0664 214 Crp cAMP-binding proteins - catabolite gene activa 99.79
cd00038115 CAP_ED effector domain of the CAP family of transc 99.79
PRK13918 202 CRP/FNR family transcriptional regulator; Provisio 99.78
PRK09391 230 fixK transcriptional regulator FixK; Provisional 99.76
TIGR03697 193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.74
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.74
PRK11161 235 fumarate/nitrate reduction transcriptional regulat 99.74
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.71
PLN02868 413 acyl-CoA thioesterase family protein 99.66
KOG1113|consensus 368 99.63
KOG0498|consensus 727 99.6
KOG0614|consensus 732 99.56
KOG0500|consensus 536 99.46
COG2905 610 Predicted signal-transduction protein containing c 99.41
KOG0614|consensus 732 99.33
KOG1113|consensus368 99.31
KOG2968|consensus 1158 99.25
KOG0501|consensus 971 99.16
KOG0499|consensus 815 99.08
PRK11832 207 putative DNA-binding transcriptional regulator; Pr 98.89
PF04831153 Popeye: Popeye protein conserved region; InterPro: 98.89
KOG2968|consensus 1158 98.68
KOG3542|consensus 1283 97.63
KOG3542|consensus 1283 96.04
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 95.82
smart00835146 Cupin_1 Cupin. This family represents the conserve 95.68
COG1917131 Uncharacterized conserved protein, contains double 94.57
PRK13290125 ectC L-ectoine synthase; Reviewed 94.54
COG3718 270 IolB Uncharacterized enzyme involved in inositol m 94.05
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 93.73
TIGR03404 367 bicupin_oxalic bicupin, oxalate decarboxylase fami 93.61
PF00190144 Cupin_1: Cupin; InterPro: IPR006045 This family re 92.5
TIGR02272335 gentisate_1_2 gentisate 1,2-dioxygenase. This fami 92.42
PF1297391 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_ 91.98
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 91.88
TIGR03404367 bicupin_oxalic bicupin, oxalate decarboxylase fami 90.93
PRK13264177 3-hydroxyanthranilate 3,4-dioxygenase; Provisional 88.59
PRK04190191 glucose-6-phosphate isomerase; Provisional 87.93
PRK11171 266 hypothetical protein; Provisional 87.66
PF04962 261 KduI: KduI/IolB family; InterPro: IPR021120 The Kd 86.5
COG2140209 Thermophilic glucose-6-phosphate isomerase and rel 85.75
PLN00212493 glutelin; Provisional 84.08
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 83.91
PRK09943185 DNA-binding transcriptional repressor PuuR; Provis 83.35
TIGR02451215 anti_sig_ChrR anti-sigma factor, putative, ChrR fa 82.42
KOG2378|consensus 573 81.89
COG3823 262 Glutamine cyclotransferase [Posttranslational modi 81.86
TIGR03214 260 ura-cupin putative allantoin catabolism protein. T 80.42
PF05726104 Pirin_C: Pirin C-terminal cupin domain; InterPro: 80.28
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information 
Probab=99.86  E-value=4.4e-21  Score=96.79  Aligned_cols=85  Identities=31%  Similarity=0.497  Sum_probs=78.4

Q ss_pred             eEEecCCCEEEecCCCCCeEEEEEeceEEEEEee-CCCceEEEEecCCCeEehhhhhcCCCceeEEEEecceeEEEEchh
Q psy5057           3 EKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEI-DGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDRK   81 (87)
Q Consensus         3 ~~~~~~g~~l~~~g~~~~~~~~i~~G~v~~~~~~-~~~~~~~~~~~~g~~~g~~~~~~~~~~~~~~~a~~~~~~~~~~~~   81 (87)
                      .++|++|++|+++|++.+++|+|++|.++++... +++...+..+.+|++||..+++.+.++..+++|.++|+++.+|++
T Consensus         1 ~~~~~~g~~i~~~g~~~~~~~~i~~G~v~~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~~~~~~~~a~~~~~~~~i~~~   80 (91)
T PF00027_consen    1 EKTYKKGEVIYRQGDPCDHIYIILSGEVKVSSINEDGKEQIIFFLGPGDIFGEIELLTGKPSPFTVIALTDSEVLRIPRE   80 (91)
T ss_dssp             -EEESTTEEEEETTSBESEEEEEEESEEEEEEETTTSEEEEEEEEETTEEESGHHHHHTSBBSSEEEESSSEEEEEEEHH
T ss_pred             CeEECCCCEEEeCCCcCCEEEEEEECceEEEeceecceeeeecceeeeccccceeecCCCccEEEEEEccCEEEEEEeHH
Confidence            4789999999999999999999999999999988 566677999999999999999999999999999999999999999


Q ss_pred             hhhccC
Q psy5057          82 TFYCNL   87 (87)
Q Consensus        82 ~~~~~~   87 (87)
                      .|.+++
T Consensus        81 ~~~~~~   86 (91)
T PF00027_consen   81 DFLQLL   86 (91)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            998763

The best studied of these proteins is the prokaryotic catabolite gene activator (also known as the cAMP receptor protein) (gene crp) where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure. There are six invariant amino acids in this domain, three of which are glycine residues that are thought to be essential for maintenance of the structural integrity of the beta-barrel. cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain. The cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain. The cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section. Vertebrate cyclic nucleotide-gated ion-channels also contain this domain. Two such cations channels have been fully characterised, one is found in rod cells where it plays a role in visual signal transduction.; PDB: 1O7F_A 2BYV_E 3E97_A 3U10_A 2H6B_A 3SHR_A 2OZ6_A 1WGP_A 3LA2_A 3LA3_B ....
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>smart00835 Cupin_1 Cupin Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>COG3718 IolB Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PF00190 Cupin_1: Cupin; InterPro: IPR006045 This family represents the conserved barrel domain of the 'cupin' superfamily ('cupa' is the Latin term for a small barrel) Back     alignment and domain information
>TIGR02272 gentisate_1_2 gentisate 1,2-dioxygenase Back     alignment and domain information
>PF12973 Cupin_7: ChrR Cupin-like domain; PDB: 3O14_B 2Z2S_F 2Q1Z_B 3EBR_A Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>TIGR03404 bicupin_oxalic bicupin, oxalate decarboxylase family Back     alignment and domain information
>PRK13264 3-hydroxyanthranilate 3,4-dioxygenase; Provisional Back     alignment and domain information
>PRK04190 glucose-6-phosphate isomerase; Provisional Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PF04962 KduI: KduI/IolB family; InterPro: IPR021120 The KduI/IolB family of enzymes includes 5-keto 4-deoxyuronate isomerase (KduI) and 5-deoxy-glucuronate isomerase (IolB) Back     alignment and domain information
>COG2140 Thermophilic glucose-6-phosphate isomerase and related metalloenzymes [Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN00212 glutelin; Provisional Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09943 DNA-binding transcriptional repressor PuuR; Provisional Back     alignment and domain information
>TIGR02451 anti_sig_ChrR anti-sigma factor, putative, ChrR family Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PF05726 Pirin_C: Pirin C-terminal cupin domain; InterPro: IPR008778 This entry represents C-terminal domain of Pirin proteins from both eukaryotes and prokaryotes Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
1cx4_A 305 Crystal Structure Of A Deletion Mutant Of The Type 3e-23
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 3e-23
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 4e-23
2qvs_B 310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 6e-23
3tnq_A 416 Structure And Allostery Of The Pka Riib Tetrameric 1e-22
3tnp_B 416 Structure And Allostery Of The Pka Riib Tetrameric 1e-22
3of1_A 246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 4e-16
2qcs_B 291 A Complex Structure Between The Catalytic And Regul 1e-13
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 1e-13
1ne4_A 283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 1e-13
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 1e-13
1rl3_A 288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 1e-13
4din_B 381 Novel Localization And Quaternary Structure Of The 1e-13
3ocp_A139 Crystal Structure Of Camp Bound Cgmp-Dependent Prot 3e-10
3shr_A 299 Crystal Structure Of Cgmp-Dependent Protein Kinase 7e-10
4f7z_A 999 Conformational Dynamics Of Exchange Protein Directl 1e-04
3cf6_E 694 Structure Of Epac2 In Complex With Cyclic-Amp And R 1e-04
2byv_E 999 Structure Of The Camp Responsive Exchange Factor Ep 1e-04
1u12_A138 M. Loti Cyclic Nucleotide Binding Domain Mutant Len 2e-04
2k0g_A142 Solution Structure Of A Bacterial Cyclic Nucleotide 2e-04
1vp6_A138 M.Loti Ion Channel Cylic Nucleotide Binding Domain 2e-04
3cl1_A140 M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gm 2e-04
1o7f_A469 Crystal Structure Of The Regulatory Domain Of Epac2 3e-04
3beh_A355 Structure Of A Bacterial Cyclic Nucleotide Regulate 7e-04
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure 
Iteration: 1

 Score =  103 bits (256), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (75%)
Query: 1   MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYN 60
           MFEK V+ G+ VI QGDDGD FYVI+ G ++  V+ DG  + +  Y+++GSFGELAL+YN
Sbjct: 57  MFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYN 116
Query: 61  MPRAATIKATSTGSLWAMDRKTF 83
            PRAATI ATS G+LW +DR TF
Sbjct: 117 TPRAATITATSPGALWGLDRVTF 139
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|3OCP|A Chain A, Crystal Structure Of Camp Bound Cgmp-Dependent Protein Kinase(92-227) Length = 139 Back     alignment and structure
>pdb|3SHR|A Chain A, Crystal Structure Of Cgmp-Dependent Protein Kinase Reveals Novel Site Of Interchain Communication Length = 299 Back     alignment and structure
>pdb|4F7Z|A Chain A, Conformational Dynamics Of Exchange Protein Directly Activated By Camp Length = 999 Back     alignment and structure
>pdb|3CF6|E Chain E, Structure Of Epac2 In Complex With Cyclic-Amp And Rap Length = 694 Back     alignment and structure
>pdb|2BYV|E Chain E, Structure Of The Camp Responsive Exchange Factor Epac2 In Its Auto-Inhibited State Length = 999 Back     alignment and structure
>pdb|1U12|A Chain A, M. Loti Cyclic Nucleotide Binding Domain Mutant Length = 138 Back     alignment and structure
>pdb|2K0G|A Chain A, Solution Structure Of A Bacterial Cyclic Nucleotide- Activated K+ Channel Binding Domain In Complex With Camp Length = 142 Back     alignment and structure
>pdb|1VP6|A Chain A, M.Loti Ion Channel Cylic Nucleotide Binding Domain Length = 138 Back     alignment and structure
>pdb|3CL1|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gmp Bound Length = 140 Back     alignment and structure
>pdb|1O7F|A Chain A, Crystal Structure Of The Regulatory Domain Of Epac2 Length = 469 Back     alignment and structure
>pdb|3BEH|A Chain A, Structure Of A Bacterial Cyclic Nucleotide Regulated Ion Channel Length = 355 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query87
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 2e-39
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 3e-35
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 1e-33
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 4e-32
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 5e-21
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 6e-29
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 4e-24
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 2e-27
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 1e-22
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 9e-27
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 4e-23
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 9e-25
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 2e-24
4din_B381 CAMP-dependent protein kinase type I-beta regulat 2e-22
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 6e-23
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 7e-22
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 9e-20
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 6e-19
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 5e-18
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 5e-16
2pqq_A149 Putative transcriptional regulator; APC7345, strep 1e-15
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 3e-13
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 5e-13
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 7e-13
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 1e-12
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 4e-12
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 4e-12
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 1e-11
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 2e-11
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 3e-11
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 4e-11
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 4e-10
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 1e-10
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 1e-10
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 2e-10
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 2e-10
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 2e-10
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 3e-10
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 4e-10
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 4e-10
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 8e-10
3ukn_A212 Novel protein similar to vertebrate potassium VOL 3e-09
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 6e-09
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 8e-09
1o5l_A 213 Transcriptional regulator, CRP family; TM1171, str 1e-08
3b02_A 195 Transcriptional regulator, CRP family; structural 1e-08
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 2e-08
1zyb_A 232 Transcription regulator, CRP family; NP_813211.1, 3e-08
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 2e-07
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 2e-07
1ft9_A 222 Carbon monoxide oxidation system transcription reg 3e-07
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
 Score =  127 bits (320), Expect = 2e-39
 Identities = 49/83 (59%), Positives = 63/83 (75%)

Query: 1   MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYN 60
           MFEK V+ G+ VI QGDDGD FYVI+ G ++  V+ DG  + +  Y+++GSFGELAL+YN
Sbjct: 61  MFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYN 120

Query: 61  MPRAATIKATSTGSLWAMDRKTF 83
            PRAATI ATS G+LW +DR TF
Sbjct: 121 TPRAATITATSPGALWGLDRVTF 143
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Length = 694 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.88
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.87
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.86
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.86
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.86
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 99.86
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.85
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 99.85
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.85
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.85
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 99.85
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 99.85
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.84
1zyb_A 232 Transcription regulator, CRP family; NP_813211.1, 99.84
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 99.84
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 99.84
1o5l_A 213 Transcriptional regulator, CRP family; TM1171, str 99.83
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 99.83
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 99.83
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.83
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 99.83
3b02_A 195 Transcriptional regulator, CRP family; structural 99.83
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 99.83
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.83
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.82
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.82
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.81
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.81
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.81
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.81
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.81
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.8
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.8
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 99.8
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.8
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.79
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.79
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.78
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.78
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.78
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 99.78
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.77
2qcs_B 291 CAMP-dependent protein kinase type I-alpha regula 99.77
1ft9_A 222 Carbon monoxide oxidation system transcription reg 99.77
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.77
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.76
4din_B 381 CAMP-dependent protein kinase type I-beta regulat 99.75
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.72
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.72
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.71
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.67
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.59
3rns_A 227 Cupin 2 conserved barrel domain protein; structura 96.02
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 94.9
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 94.66
1dgw_A178 Canavalin; duplicated swiss-roll beta barrels, loo 94.44
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 94.37
3h8u_A125 Uncharacterized conserved protein with double-STR 93.76
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 93.63
3lwc_A119 Uncharacterized protein; structural genomics, unkn 93.61
2vqa_A 361 SLL1358 protein, MNCA; periplasmic binding protein 93.32
2vqa_A361 SLL1358 protein, MNCA; periplasmic binding protein 93.04
1j58_A385 YVRK protein; cupin, decarboxyklase, oxalate, mang 92.87
1j58_A 385 YVRK protein; cupin, decarboxyklase, oxalate, mang 92.85
2cav_A 445 Protein (canavalin); vicilin, 7S SEED protein, dom 92.84
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 92.82
1fxz_A476 Glycinin G1; proglycinin, legumin, SEED storage pr 92.8
1yfu_A174 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxid 92.5
3c3v_A510 Arachin ARAH3 isoform; peanut allergen, allergy, g 92.38
2d5f_A493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 92.23
1uij_A 416 Beta subunit of beta conglycinin; double-stranded 92.08
1zvf_A176 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll b 92.03
3fz3_A531 Prunin; TREE NUT allergen, allergy, amandin, almon 91.75
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 91.73
2qjv_A 270 Uncharacterized IOLB-like protein; structural geno 91.7
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 91.68
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 91.5
3rns_A227 Cupin 2 conserved barrel domain protein; structura 91.49
2b8m_A117 Hypothetical protein MJ0764; structural genomics, 91.22
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 91.14
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 91.1
2qnk_A 286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 90.65
2ea7_A 434 7S globulin-1; beta barrel, cupin superfamily, pla 90.62
3jzv_A166 Uncharacterized protein RRU_A2000; structural geno 90.51
3ksc_A496 LEGA class, prolegumin; PEA prolegumin, 11S SEED s 90.5
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 90.37
1vj2_A126 Novel manganese-containing cupin TM1459; structura 90.34
2e9q_A459 11S globulin subunit beta; cucubitin, pumpkin SEED 90.33
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 90.23
2phl_A 397 Phaseolin; plant SEED storage protein(vicilin); HE 90.14
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 90.06
1lr5_A163 Auxin binding protein 1; beta jellyroll, double st 90.04
4b29_A217 Dimethylsulfoniopropionate lyase; hydrolase, dimet 90.02
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 89.96
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 89.75
3s7i_A 418 Allergen ARA H 1, clone P41B; bicupin, vicilin, st 89.68
2vpv_A166 Protein MIF2, MIF2P; nucleus, mitosis, centromere, 89.46
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 89.32
3kgl_A466 Cruciferin; 11S SEED globulin, rapeseed, SEED stor 88.79
1o4t_A133 Putative oxalate decarboxylase; double-stranded be 88.76
1fi2_A201 Oxalate oxidase, germin; beta-jellyroll, oxidoredu 88.74
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 88.73
3es4_A116 Uncharacterized protein DUF861 with A RMLC-like C; 88.55
3bcw_A123 Uncharacterized protein; structural genomics, join 88.48
3nw4_A368 Gentisate 1,2-dioxygenase; beta-barrel, oxidoreduc 88.39
3kgz_A156 Cupin 2 conserved barrel domain protein; metallopr 88.3
3qac_A465 11S globulin SEED storage protein; 11S SEED storag 87.98
2e9q_A 459 11S globulin subunit beta; cucubitin, pumpkin SEED 87.7
1v70_A105 Probable antibiotics synthesis protein; structural 87.17
1fxz_A 476 Glycinin G1; proglycinin, legumin, SEED storage pr 86.69
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 86.53
2o1q_A145 Putative acetyl/propionyl-COA carboxylase, alpha; 86.52
2opk_A112 Hypothetical protein; putative mannose-6-phosphate 86.04
4e2q_A 266 Ureidoglycine aminohydrolase; BI-cupin, manganese 85.44
3h7j_A 243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 85.41
3cew_A125 Uncharacterized cupin protein; all beta-protein, j 85.31
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 84.58
1sfn_A246 Conserved hypothetical protein; structural genomic 84.42
2phl_A397 Phaseolin; plant SEED storage protein(vicilin); HE 84.32
1sfn_A 246 Conserved hypothetical protein; structural genomic 84.02
1x82_A190 Glucose-6-phosphate isomerase; cupin superfamily, 83.94
2d40_A 354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 82.4
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 82.25
1y9q_A192 Transcriptional regulator, HTH_3 family; transcrip 82.07
2q1z_B195 Anti-sigma factor CHRR, transcriptional activator; 81.53
2d40_A354 Z3393, putative gentisate 1,2-dioxygenase; gentisi 81.49
3myx_A238 Uncharacterized protein pspto_0244; protein of unk 81.15
3bu7_A 394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 80.99
2oa2_A148 BH2720 protein; 10175341, structural genomics, joi 80.98
1juh_A350 Quercetin 2,3-dioxygenase; cupin, glycoprotein, be 80.98
2o8q_A134 Hypothetical protein; cpuin-like fold, structural 80.73
1y3t_A 337 Hypothetical protein YXAG; BI cupin, dioxygenase, 80.29
2d5f_A 493 Glycinin A3B4 subunit; soybean, globulin, 11S,SEED 80.21
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
Probab=99.88  E-value=1.4e-21  Score=106.89  Aligned_cols=86  Identities=57%  Similarity=0.960  Sum_probs=81.1

Q ss_pred             CeeEEecCCCEEEecCCCCCeEEEEEeceEEEEEeeCCCceEEEEecCCCeEehhhhhcCCCceeEEEEecceeEEEEch
Q psy5057           1 MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDR   80 (87)
Q Consensus         1 ~~~~~~~~g~~l~~~g~~~~~~~~i~~G~v~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~~~~~~~~a~~~~~~~~~~~   80 (87)
                      ++.+.|++|++|+++|++++++|+|++|.++++...+|++..+..+.+|++||+.+++.+.++..++.|.++|+++.+++
T Consensus        61 ~~~~~~~~g~~i~~~G~~~~~~y~i~~G~v~~~~~~~g~~~~~~~~~~G~~fGe~~~~~~~~~~~~v~A~~~~~~~~i~~  140 (161)
T 3idb_B           61 MFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDR  140 (161)
T ss_dssp             CEEEEECTTCEEECTTSCCCEEEEEEESEEEEEEEETTEEEEEEEEESCCEECGGGGTCCCCCSSEEEESSSEEEEEEEH
T ss_pred             cceeEeCCCCEEEeCCCCCcEEEEEEeCEEEEEEcCCCCeEEEEEcCCCCEechHHHHcCCCcccEEEECCCeEEEEEeH
Confidence            46789999999999999999999999999999995589999999999999999999999999999999999999999999


Q ss_pred             hhhhcc
Q psy5057          81 KTFYCN   86 (87)
Q Consensus        81 ~~~~~~   86 (87)
                      +.|.++
T Consensus       141 ~~~~~l  146 (161)
T 3idb_B          141 VTFRRI  146 (161)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
Confidence            999875
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1dgw_A Canavalin; duplicated swiss-roll beta barrels, loops with alpha helices merohedral/ hemihedral twinning, plant protein; 1.70A {Canavalia ensiformis} SCOP: b.82.1.2 PDB: 1dgr_A 1cau_A 1cav_A 1caw_A 1cax_A Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>2vqa_A SLL1358 protein, MNCA; periplasmic binding protein, metal-binding protein, cupin, BI-cupin, oxalate decarboxylase; 2.95A {Synechocystis SP} Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>1j58_A YVRK protein; cupin, decarboxyklase, oxalate, manganese, formate, metal BI protein; 1.75A {Bacillus subtilis} SCOP: b.82.1.2 PDB: 1l3j_A 1uw8_A 2uyb_A 2uy9_A 2uy8_A 2v09_A 2uya_A 3s0m_A Back     alignment and structure
>2cav_A Protein (canavalin); vicilin, 7S SEED protein, domain duplication, swiss roll, PL protein; 2.00A {Canavalia ensiformis} SCOP: b.82.1.2 b.82.1.2 PDB: 2cau_A 1cau_B 1cav_B 1caw_B 1cax_B Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>1yfu_A 3-hydroxyanthranilate-3,4-dioxygenase; cupin, oxidoreductase; 1.90A {Cupriavidus metallidurans} SCOP: b.82.1.20 PDB: 1yfw_A* 1yfx_A* 1yfy_A* Back     alignment and structure
>3c3v_A Arachin ARAH3 isoform; peanut allergen, allergy, glycinin; 1.73A {Arachis hypogaea} Back     alignment and structure
>1uij_A Beta subunit of beta conglycinin; double-stranded beta helix, SEED storage protein, sugar binding protein; 2.50A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ipk_A 1ipj_A* Back     alignment and structure
>1zvf_A 3-hydroxyanthranilate 3,4-dioxygenase; jellyroll beta-barrel, oxidoreductase; 2.41A {Saccharomyces cerevisiae} SCOP: b.82.1.20 Back     alignment and structure
>3fz3_A Prunin; TREE NUT allergen, allergy, amandin, almond, 11S SEED storage protein, allergen; 2.40A {Prunus dulcis} PDB: 3ehk_A Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2b8m_A Hypothetical protein MJ0764; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.70A {Methanocaldococcus jannaschii} SCOP: b.82.1.18 Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>2ea7_A 7S globulin-1; beta barrel, cupin superfamily, plant protein; 1.80A {Vigna angularis} PDB: 2eaa_A* 2cv6_A 1uik_A Back     alignment and structure
>3jzv_A Uncharacterized protein RRU_A2000; structural genomics, cupin-2 fold, unknown function, PSI-2, structure initiative; HET: MSE; 2.30A {Rhodospirillum rubrum} Back     alignment and structure
>3ksc_A LEGA class, prolegumin; PEA prolegumin, 11S SEED storage protein, pisum sativum L., SEED storage protein, storage protein, plant protein; 2.61A {Pisum sativum} Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>1vj2_A Novel manganese-containing cupin TM1459; structural genomics, joint for structural genomics, JCSG; 1.65A {Thermotoga maritima} SCOP: b.82.1.10 Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1lr5_A Auxin binding protein 1; beta jellyroll, double stranded beta helix, germin-like PROT protein binding; HET: NAG BMA MAN; 1.90A {Zea mays} SCOP: b.82.1.2 PDB: 1lrh_A* Back     alignment and structure
>4b29_A Dimethylsulfoniopropionate lyase; hydrolase, dimethylsulfide, sulphur cycle; 1.72A {Roseovarius nubinhibens ism} Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>3s7i_A Allergen ARA H 1, clone P41B; bicupin, vicilin, storage SEED protein; 2.35A {Arachis hypogaea} PDB: 3s7e_A 3smh_A Back     alignment and structure
>2vpv_A Protein MIF2, MIF2P; nucleus, mitosis, centromere, cell cycle, DNA-binding, kinetochore, cell division, phosphoprotein, jelly-roll fold; 2.7A {Saccharomyces cerevisiae} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3kgl_A Cruciferin; 11S SEED globulin, rapeseed, SEED storage protein, storage protein, plant protein; 2.98A {Brassica napus} Back     alignment and structure
>1o4t_A Putative oxalate decarboxylase; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; 1.95A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>1fi2_A Oxalate oxidase, germin; beta-jellyroll, oxidoreductase; 1.60A {Hordeum vulgare} SCOP: b.82.1.2 PDB: 2et1_A 2ete_A* 2et7_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>3es4_A Uncharacterized protein DUF861 with A RMLC-like C; 17741406, protein of unknown function (DUF861) with A RMLC-L fold; HET: MSE; 1.64A {Agrobacterium tumefaciens str} Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3nw4_A Gentisate 1,2-dioxygenase; beta-barrel, oxidoreductase; HET: GTQ; 2.00A {Pseudaminobacter salicylatoxidans} PDB: 3nvc_A* 3nst_A* 3njz_A* 2phd_A* 3nkt_A* 3nl1_A* 4fag_A* 4fbf_A 4fah_A Back     alignment and structure
>3kgz_A Cupin 2 conserved barrel domain protein; metalloprotein, structural genomics, PSI-2, protein structur initiative; 1.85A {Rhodopseudomonas palustris} Back     alignment and structure
>3qac_A 11S globulin SEED storage protein; 11S SEED storage protein (globulins) family, SEED storage PR plant protein; 2.27A {Amaranthus hypochondriacus} Back     alignment and structure
>2e9q_A 11S globulin subunit beta; cucubitin, pumpkin SEED storage globulin, plant protein; 2.20A {Cucurbita maxima} PDB: 2evx_A Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>1fxz_A Glycinin G1; proglycinin, legumin, SEED storage protein, plant protein; 2.80A {Glycine max} SCOP: b.82.1.2 b.82.1.2 PDB: 1ud1_A 1ucx_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2o1q_A Putative acetyl/propionyl-COA carboxylase, alpha; putative acetylacetone dioxygenase, structural genomics; HET: MSE PG4; 1.50A {Methylibium petroleiphilum} SCOP: b.82.1.21 Back     alignment and structure
>2opk_A Hypothetical protein; putative mannose-6-phosphate isomerase, structural genomics, center for structural genomics, JCSG; 2.10A {Ralstonia eutropha} Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>3cew_A Uncharacterized cupin protein; all beta-protein, jelly-roll (cupin-2), structural genomics, protein structure initiative; 2.31A {Bacteroides fragilis} Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>2phl_A Phaseolin; plant SEED storage protein(vicilin); HET: NAG; 2.20A {Phaseolus vulgaris} SCOP: b.82.1.2 b.82.1.2 PDB: 1phs_A* Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>1x82_A Glucose-6-phosphate isomerase; cupin superfamily, hyperthermophIle, phosphoglucose isomerase, extremeophIle; HET: PA5; 1.50A {Pyrococcus furiosus} SCOP: b.82.1.7 PDB: 1x7n_A* 1x8e_A 1qxr_A* 1qxj_A* 1qy4_A* 2gc1_A* 2gc0_A* 2gc2_A* 2gc3_A* 3sxw_A 1j3q_A 1j3p_A 1j3r_A* Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>1y9q_A Transcriptional regulator, HTH_3 family; transcriptional regulaator, strucutral genomics, protein structure initiative, PSI; 1.90A {Vibrio cholerae} SCOP: a.35.1.8 b.82.1.15 Back     alignment and structure
>2d40_A Z3393, putative gentisate 1,2-dioxygenase; gentisic acid, bicupin, tetramer, montreal- bacterial structural genomics initiative, BSGI; 2.41A {Escherichia coli} SCOP: b.82.1.23 Back     alignment and structure
>3myx_A Uncharacterized protein pspto_0244; protein of unknown function (DUF861), cupin_3 (PF05899), STR genomics; HET: MSE; 1.30A {Pseudomonas syringae PV} Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>2oa2_A BH2720 protein; 10175341, structural genomics, joint center for STRU genomics, JCSG, protein structure initiative, PSI-2, unknow function; HET: MSE; 1.41A {Bacillus halodurans} Back     alignment and structure
>1juh_A Quercetin 2,3-dioxygenase; cupin, glycoprotein, beta sandwich, oxidoreduct; HET: NAG BMA MAN; 1.60A {Aspergillus japonicus} SCOP: b.82.1.5 PDB: 1gqh_A* 1h1i_A* 1h1m_A* 1gqg_A* Back     alignment and structure
>2o8q_A Hypothetical protein; cpuin-like fold, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.55A {Burkholderia xenovorans} Back     alignment and structure
>1y3t_A Hypothetical protein YXAG; BI cupin, dioxygenase, oxidoreductase; 2.40A {Bacillus subtilis} SCOP: b.82.1.5 PDB: 2h0v_A* Back     alignment and structure
>2d5f_A Glycinin A3B4 subunit; soybean, globulin, 11S,SEED storage protein, plant; 1.90A {Glycine max} PDB: 2d5h_A 1od5_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 87
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 5e-16
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 2e-14
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 7e-11
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 1e-10
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 6e-10
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 8e-10
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 1e-08
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 1e-08
d2zcwa2112 b.82.3.2 (A:6-117) Transcriptional regulator TTHA1 7e-07
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 1e-06
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 6e-06
d1o5la1129 b.82.3.2 (A:1-129) CRP-like transcriptional regula 1e-05
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 65.6 bits (159), Expect = 5e-16
 Identities = 49/83 (59%), Positives = 63/83 (75%)

Query: 1   MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYN 60
           MFEK V+ G+ VI QGDDGD FYVI+ G ++  V+ DG  + +  Y+++GSFGELAL+YN
Sbjct: 39  MFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYN 98

Query: 61  MPRAATIKATSTGSLWAMDRKTF 83
            PRAATI ATS G+LW +DR TF
Sbjct: 99  TPRAATITATSPGALWGLDRVTF 121
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 129 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query87
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.88
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.88
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.88
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.87
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.87
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.87
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.87
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.87
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.86
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.85
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.84
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.84
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.82
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.81
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.8
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.8
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.8
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 97.3
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 96.56
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 96.34
d1fxza2174 Seed storage 7S protein {Soybean (Glycine max), pr 96.23
g1dgw.1168 Seed storage 7S protein {Jack bean (Canavalia ensi 95.96
d1od5a2173 Seed storage 7S protein {Soybean (Glycine max), gl 95.89
d2phla2162 Seed storage 7S protein {French bean (Phaseolus vu 95.25
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 95.06
d1dgwa_178 Seed storage 7S protein {Jack bean (Canavalia ensi 94.97
d1uija1170 Seed storage 7S protein {Soybean (Glycine max), be 94.72
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 94.7
d1uika1203 Seed storage 7S protein {Soybean (Glycine max), be 94.65
d1j58a_ 372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 94.03
d2et1a1201 Germin {Barley (Hordeum vulgare) [TaxId: 4513]} 93.25
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 93.25
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 93.16
d1j58a_372 Oxalate decarboxylase OxdC (YvrK) {Bacillus subtil 92.43
d1x82a_190 Glucose-6-phosphate isomerase, GPI {Archaeon Pyroc 92.42
d2phla1200 Seed storage 7S protein {French bean (Phaseolus vu 92.02
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 91.55
d1lr5a_160 Auxin binding protein {Maize (Zea mays) [TaxId: 45 90.77
d2phda1351 Gentisate 1,2-dioxygenase {Pseudaminobacter salicy 90.37
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 90.15
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 88.93
d1juha_ 348 Quercetin 2,3-dioxygenase {Aspergillus japonicus [ 87.05
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 85.52
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 83.08
d2d40a1 308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 83.05
d1yfua1174 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia m 82.41
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 81.99
d1uika2185 Seed storage 7S protein {Soybean (Glycine max), be 81.01
d2bnma2122 Hydroxypropylphosphonic acid epoxidase Fom4, C-ter 80.79
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.88  E-value=3.1e-22  Score=106.10  Aligned_cols=87  Identities=56%  Similarity=0.960  Sum_probs=81.4

Q ss_pred             CeeEEecCCCEEEecCCCCCeEEEEEeceEEEEEeeCCCceEEEEecCCCeEehhhhhcCCCceeEEEEecceeEEEEch
Q psy5057           1 MFEKPVEAGDIVIRQGDDGDFFYVIESGRYEASVEIDGEDKLMHAYEDKGSFGELALLYNMPRAATIKATSTGSLWAMDR   80 (87)
Q Consensus         1 ~~~~~~~~g~~l~~~g~~~~~~~~i~~G~v~~~~~~~~~~~~~~~~~~g~~~g~~~~~~~~~~~~~~~a~~~~~~~~~~~   80 (87)
                      ++.+.+++|++|+++|++++.+|+|.+|.++++...+|....+..+.+|++||+.+++.+.++..+++|.++|.++.+++
T Consensus        39 ~~~~~~~~g~~I~~~G~~~~~~y~I~~G~v~v~~~~~~~~~~~~~l~~g~~fg~~~l~~~~~~~~s~~a~~~~~~~~i~~  118 (136)
T d1cx4a1          39 MFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDR  118 (136)
T ss_dssp             CEEEEECTTCEEECTTSCCCEEEEEEECEEEEEEEETTEEEEEEEEESSCEECHHHHHHCCCCCSEEEESSCEEEEEEEH
T ss_pred             eEEEEECCCCEEEECCCcchhhhhhhhheeEEeeccccceeeeeccCCccccchHHHhCCCcceEEEEECCCEEEEEEeH
Confidence            46789999999999999999999999999999877788888899999999999999999999999999999999999999


Q ss_pred             hhhhccC
Q psy5057          81 KTFYCNL   87 (87)
Q Consensus        81 ~~~~~~~   87 (87)
                      +.|.+++
T Consensus       119 ~~f~~ll  125 (136)
T d1cx4a1         119 VTFRRII  125 (136)
T ss_dssp             HHHHHHH
T ss_pred             HHHHHHH
Confidence            9998763
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fxza2 b.82.1.2 (A:297-470) Seed storage 7S protein {Soybean (Glycine max), proglycinin [TaxId: 3847]} Back     information, alignment and structure
>d1od5a2 b.82.1.2 (A:321-493) Seed storage 7S protein {Soybean (Glycine max), glycinin A3B4 [TaxId: 3847]} Back     information, alignment and structure
>d2phla2 b.82.1.2 (A:220-381) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dgwa_ b.82.1.2 (A:) Seed storage 7S protein {Jack bean (Canavalia ensiformis), canavalin/vinculin [TaxId: 3823]} Back     information, alignment and structure
>d1uija1 b.82.1.2 (A:6-175) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin beta subunit [TaxId: 3847]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2et1a1 b.82.1.2 (A:1-201) Germin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j58a_ b.82.1.2 (A:) Oxalate decarboxylase OxdC (YvrK) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x82a_ b.82.1.7 (A:) Glucose-6-phosphate isomerase, GPI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2phla1 b.82.1.2 (A:11-210) Seed storage 7S protein {French bean (Phaseolus vulgaris), phaseolin [TaxId: 3885]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1lr5a_ b.82.1.2 (A:) Auxin binding protein {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2phda1 b.82.1.23 (A:17-367) Gentisate 1,2-dioxygenase {Pseudaminobacter salicylatoxidans [TaxId: 93369]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1juha_ b.82.1.5 (A:) Quercetin 2,3-dioxygenase {Aspergillus japonicus [TaxId: 34381]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yfua1 b.82.1.20 (A:1-174) 3-hydroxyanthranilate-3,4-dioxygenase {Ralstonia metallidurans [TaxId: 119219]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1uika2 b.82.1.2 (A:351-535) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Back     information, alignment and structure
>d2bnma2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]} Back     information, alignment and structure