Psyllid ID: psy5074


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMGYTAL
cHHHHHHHHcccHHHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHEEccccccccHHHHHHHHHcccccc
cHHHHHHHHHcccEEEEEcHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccEEEEHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHEccccccccHHHHHHHHHHccccc
mglmtfqrFSGVSALIYYTVDIFrnagtriapstaSIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFknqgydmqdyswipifsVCTIVAIFRigigpipwfmmAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVytrvpetknkSFEAIQAELAMGYTAL
mglmtfqrfsGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMGYTAL
MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQvvvsllssllIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMGYTAL
****TFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETK***FEAI***********
MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELA******
MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMGYTAL
MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMGYT**
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
iiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMGYTAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query204 2.2.26 [Sep-21-2011]
Q17NV8806 Facilitated trehalose tra N/A N/A 0.965 0.244 0.406 3e-45
B4P624856 Facilitated trehalose tra N/A N/A 0.965 0.230 0.401 9e-44
Q291H8868 Facilitated trehalose tra yes N/A 0.965 0.226 0.401 2e-43
B4GAP7869 Facilitated trehalose tra N/A N/A 0.965 0.226 0.401 2e-43
B0WC46517 Facilitated trehalose tra N/A N/A 0.965 0.381 0.416 3e-43
B3MG58866 Facilitated trehalose tra N/A N/A 0.965 0.227 0.395 4e-43
B4KR05863 Facilitated trehalose tra N/A N/A 0.965 0.228 0.385 1e-42
B4LPX5911 Facilitated trehalose tra N/A N/A 0.965 0.216 0.385 2e-42
B4QBN2857 Facilitated trehalose tra N/A N/A 0.965 0.229 0.401 4e-42
A5LGM7504 Facilitated trehalose tra N/A N/A 0.965 0.390 0.401 1e-41
>sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 Back     alignment and function desciption
 Score =  181 bits (459), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 80/197 (40%), Positives = 128/197 (64%)

Query: 1   MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRR 60
           +GLM FQ+ SG++A+I+YTV IF++AG+ I  +  +IIVG V  + + ++++LIDRLGR+
Sbjct: 590 LGLMFFQQLSGINAVIFYTVQIFQDAGSTIDENLCTIIVGVVNFIATFIATMLIDRLGRK 649

Query: 61  FLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMM 120
            LL  S++ M    + L  +F  KN G D+    W+P+ +    V  F +G GPIPW MM
Sbjct: 650 MLLYISDVAMIITLMTLGGFFYVKNSGQDVSQVGWLPLAAFVIYVLGFSLGFGPIPWLMM 709

Query: 121 AEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYT 180
            EI+P + +  ++S+   ++WSC F+V+K F D+I+ +G+  T+ + G IC +G  FV  
Sbjct: 710 GEILPGKIRGSAASVATAFNWSCTFIVTKTFADIINAIGTHGTFWMFGSICVIGLAFVIF 769

Query: 181 RVPETKNKSFEAIQAEL 197
            VPET+ KS E I+ ++
Sbjct: 770 YVPETQGKSLEDIERKM 786




High-capacity facilitative transporter for trehalose. Does not transport maltose, sucrose or lactose. Mediates the bidirectional transfer of trehalose. Responsible for the transport of trehalose synthesized in the fat body and the incorporation of trehalose into other tissues that require a carbon source, thereby regulating trehalose levels in the hemolymph.
Aedes aegypti (taxid: 7159)
>sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 Back     alignment and function description
>sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 Back     alignment and function description
>sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 Back     alignment and function description
>sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 Back     alignment and function description
>sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
291461581 475 sugar transporter 11 [Nilaparvata lugens 0.970 0.416 0.449 1e-43
157104959 806 sugar transporter [Aedes aegypti] gi|122 0.965 0.244 0.406 2e-43
328723539 667 PREDICTED: facilitated trehalose transpo 0.965 0.295 0.436 1e-42
193674084 646 PREDICTED: facilitated trehalose transpo 0.965 0.304 0.436 2e-42
50293089 494 gastric caeca sugar transporter [Locusta 0.960 0.396 0.443 4e-42
195485674 856 GE12373 [Drosophila yakuba] gi|300681125 0.965 0.230 0.401 5e-42
300681254 868 RecName: Full=Facilitated trehalose tran 0.965 0.226 0.401 1e-41
300681218 869 RecName: Full=Facilitated trehalose tran 0.965 0.226 0.401 1e-41
198457127 894 GA15593 [Drosophila pseudoobscura pseudo 0.965 0.220 0.401 1e-41
195150333 897 GL11419 [Drosophila persimilis] gi|19410 0.965 0.219 0.401 1e-41
>gi|291461581|dbj|BAI83425.1| sugar transporter 11 [Nilaparvata lugens] Back     alignment and taxonomy information
 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 89/198 (44%), Positives = 128/198 (64%)

Query: 1   MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQVVVSLLSSLLIDRLGRR 60
           +G+M FQ+ SGV+A+I+Y+  IF +AG+ ++   ASI++G VQV+ +  S+LL++R GRR
Sbjct: 265 LGMMVFQQLSGVNAVIFYSGQIFESAGSSLSSQAASIVIGVVQVLATYCSTLLVERTGRR 324

Query: 61  FLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMM 120
           FLLL S+  MA C ++L  YF +K Q  D+  + W+P+ S+   + +F +G GPIPW +M
Sbjct: 325 FLLLLSDSVMAICLIVLGGYFHYKEQNVDLSTWGWVPLVSLSLFIVVFSLGFGPIPWIIM 384

Query: 121 AEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYT 180
            EI+P   K  SSSL    SW   F+V+K F +L    GSA T+ L   IC +G +FVYT
Sbjct: 385 GEIVPSNLKGISSSLGAGTSWILAFVVTKYFENLELAFGSAGTFWLFAGICVVGTLFVYT 444

Query: 181 RVPETKNKSFEAIQAELA 198
            +PETK K  E I  EL 
Sbjct: 445 LLPETKGKDIETILDELG 462




Source: Nilaparvata lugens

Species: Nilaparvata lugens

Genus: Nilaparvata

Family: Delphacidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157104959|ref|XP_001648649.1| sugar transporter [Aedes aegypti] gi|122069442|sp|Q17NV8.1|TRET1_AEDAE RecName: Full=Facilitated trehalose transporter Tret1 gi|108884141|gb|EAT48366.1| AAEL000567-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|328723539|ref|XP_003247868.1| PREDICTED: facilitated trehalose transporter Tret1-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|193674084|ref|XP_001950990.1| PREDICTED: facilitated trehalose transporter Tret1-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|50293089|gb|AAT72921.1| gastric caeca sugar transporter [Locusta migratoria] Back     alignment and taxonomy information
>gi|195485674|ref|XP_002091187.1| GE12373 [Drosophila yakuba] gi|300681125|sp|B4P624.1|TRET1_DROYA RecName: Full=Facilitated trehalose transporter Tret1 gi|194177288|gb|EDW90899.1| GE12373 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|300681254|sp|Q291H8.3|TRET1_DROPS RecName: Full=Facilitated trehalose transporter Tret1 Back     alignment and taxonomy information
>gi|300681218|sp|B4GAP7.2|TRET1_DROPE RecName: Full=Facilitated trehalose transporter Tret1 Back     alignment and taxonomy information
>gi|198457127|ref|XP_001360559.2| GA15593 [Drosophila pseudoobscura pseudoobscura] gi|198135870|gb|EAL25134.2| GA15593 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195150333|ref|XP_002016109.1| GL11419 [Drosophila persimilis] gi|194109956|gb|EDW31999.1| GL11419 [Drosophila persimilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query204
UNIPROTKB|B0WC46517 Tret1 "Facilitated trehalose t 0.965 0.381 0.406 1.1e-39
UNIPROTKB|A5LGM7504 Tret1 "Facilitated trehalose t 0.975 0.394 0.4 1.4e-39
UNIPROTKB|Q17NV8806 Tret1 "Facilitated trehalose t 0.975 0.246 0.405 2.2e-39
UNIPROTKB|Q7PIR5793 Tret1 "Facilitated trehalose t 0.975 0.250 0.395 2e-38
FB|FBgn0033644488 Tret1-2 "Trehalose transporter 0.965 0.403 0.405 5.5e-38
UNIPROTKB|B4QBN3488 Tret1-2 "Facilitated trehalose 0.965 0.403 0.400 7e-38
UNIPROTKB|B4HNS1488 Tret1-2 "Facilitated trehalose 0.975 0.407 0.395 1.1e-37
UNIPROTKB|A9ZSY3505 Tret1 "Facilitated trehalose t 0.980 0.396 0.395 3e-37
UNIPROTKB|B4P624856 Tret1 "Facilitated trehalose t 0.965 0.230 0.400 3e-37
UNIPROTKB|Q291H8868 Tret1 "Facilitated trehalose t 0.975 0.229 0.395 4e-37
UNIPROTKB|B0WC46 Tret1 "Facilitated trehalose transporter Tret1" [Culex quinquefasciatus (taxid:7176)] Back     alignment and assigned GO terms
 Score = 423 (154.0 bits), Expect = 1.1e-39, P = 1.1e-39
 Identities = 80/197 (40%), Positives = 121/197 (61%)

Query:     1 MGLMTFQRFSGVSALIYYTVDIFRNAGTRIAPSTASIIVGAVQXXXXXXXXXXIDRLGRR 60
             +GLM FQ+ SG++A+I+YTV IF++AG+ I  +  +IIVG V           IDRLGR+
Sbjct:   301 LGLMFFQQLSGINAVIFYTVQIFQDAGSTIDENLCTIIVGVVNFIATFIATLLIDRLGRK 360

Query:    61 FLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMM 120
              LL  S+I M    + L  +F  KN G D+    W+P+ S    V  F +G GPIPW MM
Sbjct:   361 MLLYISDIAMIITLMTLGGFFYVKNNGGDVSHIGWLPLASFVIFVLGFSLGFGPIPWLMM 420

Query:   121 AEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVYT 180
              EI+P + +  ++S+   ++WSC F+V+K F D+I ++G+   + + G +C +G VFV  
Sbjct:   421 GEILPGKIRGSAASVATAFNWSCTFVVTKTFADIIASIGTHGAFWMFGSVCVVGLVFVIM 480

Query:   181 RVPETKNKSFEAIQAEL 197
              VPET+ KS E I+ ++
Sbjct:   481 YVPETQGKSLEDIERKM 497




GO:0015574 "trehalose transmembrane transporter activity" evidence=ISS
GO:0015771 "trehalose transport" evidence=ISS
GO:0044459 "plasma membrane part" evidence=ISS
UNIPROTKB|A5LGM7 Tret1 "Facilitated trehalose transporter Tret1" [Polypedilum vanderplanki (taxid:319348)] Back     alignment and assigned GO terms
UNIPROTKB|Q17NV8 Tret1 "Facilitated trehalose transporter Tret1" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms
UNIPROTKB|Q7PIR5 Tret1 "Facilitated trehalose transporter Tret1" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms
FB|FBgn0033644 Tret1-2 "Trehalose transporter 1-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|B4QBN3 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila simulans (taxid:7240)] Back     alignment and assigned GO terms
UNIPROTKB|B4HNS1 Tret1-2 "Facilitated trehalose transporter Tret1-2 homolog" [Drosophila sechellia (taxid:7238)] Back     alignment and assigned GO terms
UNIPROTKB|A9ZSY3 Tret1 "Facilitated trehalose transporter Tret1" [Bombyx mori (taxid:7091)] Back     alignment and assigned GO terms
UNIPROTKB|B4P624 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila yakuba (taxid:7245)] Back     alignment and assigned GO terms
UNIPROTKB|Q291H8 Tret1 "Facilitated trehalose transporter Tret1" [Drosophila pseudoobscura pseudoobscura (taxid:46245)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
TIGR00879481 TIGR00879, SP, MFS transporter, sugar porter (SP) 5e-30
pfam00083449 pfam00083, Sugar_tr, Sugar (and other) transporter 1e-24
PRK10077479 PRK10077, xylE, D-xylose transporter XylE; Provisi 3e-22
>gnl|CDD|233165 TIGR00879, SP, MFS transporter, sugar porter (SP) family Back     alignment and domain information
 Score =  114 bits (288), Expect = 5e-30
 Identities = 64/194 (32%), Positives = 104/194 (53%), Gaps = 2/194 (1%)

Query: 1   MGLMTFQRFSGVSALIYYTVDIFRNAG-TRIAPSTASIIVGAVQVVVSLLSSLLIDRLGR 59
           + L  FQ+F+G++A++YY+  IF NAG +       SIIVGAV    + ++  L+DR GR
Sbjct: 289 VVLQWFQQFTGINAIMYYSPTIFENAGVSTDHAFLVSIIVGAVNFAFTFVAIFLVDRFGR 348

Query: 60  RFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFM 119
           R LLL     MA C  +L         G   +    + I  +   +A F +G GP+PW +
Sbjct: 349 RPLLLIGAAGMAICLFVLGILGASFVTG-SSKSSGNVAIVFILLFIAFFAMGWGPVPWVI 407

Query: 120 MAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGSAATYGLLGLICTLGAVFVY 179
           ++EI PL  +    S+ +  +W   F+V  +F  +++++G    +   G +  LG +FVY
Sbjct: 408 VSEIFPLSLRPKGISIAVAANWLANFIVGFLFPTMLESIGVGGVFIFFGGLNVLGLIFVY 467

Query: 180 TRVPETKNKSFEAI 193
             +PETK ++ E I
Sbjct: 468 FFLPETKGRTLEEI 481


This model represent the sugar porter subfamily of the major facilitator superfamily (pfam00083) [Transport and binding proteins, Carbohydrates, organic alcohols, and acids]. Length = 481

>gnl|CDD|215702 pfam00083, Sugar_tr, Sugar (and other) transporter Back     alignment and domain information
>gnl|CDD|182225 PRK10077, xylE, D-xylose transporter XylE; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 204
KOG0569|consensus485 99.94
PRK10077479 xylE D-xylose transporter XylE; Provisional 99.89
KOG0254|consensus513 99.87
TIGR00887502 2A0109 phosphate:H+ symporter. This model represen 99.83
TIGR02332 412 HpaX 4-hydroxyphenylacetate permease. This protein 99.83
TIGR00893 399 2A0114 d-galactonate transporter. 99.83
PRK03545 390 putative arabinose transporter; Provisional 99.82
TIGR00879481 SP MFS transporter, sugar porter (SP) family. This 99.81
PRK11663 434 regulatory protein UhpC; Provisional 99.81
PRK10473 392 multidrug efflux system protein MdtL; Provisional 99.81
TIGR00710 385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.8
PRK10213 394 nepI ribonucleoside transporter; Reviewed 99.8
PRK14995 495 methyl viologen resistance protein SmvA; Provision 99.8
COG2814 394 AraJ Arabinose efflux permease [Carbohydrate trans 99.8
TIGR00711 485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.8
TIGR00903 368 2A0129 major facilitator 4 family protein. This fa 99.8
PRK10091 382 MFS transport protein AraJ; Provisional 99.8
PRK15403 413 multidrug efflux system protein MdtM; Provisional 99.79
TIGR00900 365 2A0121 H+ Antiporter protein. 99.79
TIGR00891 405 2A0112 putative sialic acid transporter. 99.79
PF07690 352 MFS_1: Major Facilitator Superfamily; InterPro: IP 99.79
PRK10054 395 putative transporter; Provisional 99.79
TIGR00881 379 2A0104 phosphoglycerate transporter family protein 99.78
TIGR01299742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.78
PRK11102 377 bicyclomycin/multidrug efflux system; Provisional 99.78
PRK11551 406 putative 3-hydroxyphenylpropionic transporter MhpT 99.77
TIGR00895 398 2A0115 benzoate transport. 99.77
PRK15402 406 multidrug efflux system translocase MdfA; Provisio 99.77
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2. This mode 99.77
PRK12307 426 putative sialic acid transporter; Provisional 99.77
PF00083451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.77
PRK10504 471 putative transporter; Provisional 99.76
PLN00028 476 nitrate transmembrane transporter; Provisional 99.76
PRK09874 408 drug efflux system protein MdtG; Provisional 99.75
TIGR00886 366 2A0108 nitrite extrusion protein (nitrite facilita 99.75
PRK11043 401 putative transporter; Provisional 99.74
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.74
TIGR00890 377 2A0111 Oxalate/Formate Antiporter. 99.74
PRK10642490 proline/glycine betaine transporter; Provisional 99.73
PRK11646 400 multidrug resistance protein MdtH; Provisional 99.73
PRK10077 479 xylE D-xylose transporter XylE; Provisional 99.73
PRK03699 394 putative transporter; Provisional 99.73
PRK03893 496 putative sialic acid transporter; Provisional 99.73
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transp 99.72
TIGR00899 375 2A0120 sugar efflux transporter. This family of pr 99.72
TIGR00887 502 2A0109 phosphate:H+ symporter. This model represen 99.72
PRK11273 452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.71
cd06174 352 MFS The Major Facilitator Superfamily (MFS) is a l 99.71
TIGR00712 438 glpT glycerol-3-phosphate transporter. This model 99.7
TIGR00892 455 2A0113 monocarboxylate transporter 1. 99.7
KOG1330|consensus 493 99.7
PRK10406 432 alpha-ketoglutarate transporter; Provisional 99.7
PRK10642 490 proline/glycine betaine transporter; Provisional 99.7
PRK09705 393 cynX putative cyanate transporter; Provisional 99.7
PRK09556467 uhpT sugar phosphate antiporter; Reviewed 99.7
PRK10489417 enterobactin exporter EntS; Provisional 99.69
PRK11195 393 lysophospholipid transporter LplT; Provisional 99.69
TIGR00897 402 2A0118 polyol permease family. This family of prot 99.68
PRK05122 399 major facilitator superfamily transporter; Provisi 99.68
PRK15462 493 dipeptide/tripeptide permease D; Provisional 99.68
PRK09556 467 uhpT sugar phosphate antiporter; Reviewed 99.68
TIGR00894 465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.68
TIGR00889418 2A0110 nucleoside transporter. This family of prot 99.68
PRK12382 392 putative transporter; Provisional 99.67
KOG0253|consensus528 99.67
TIGR00924 475 yjdL_sub1_fam amino acid/peptide transporter (Pept 99.67
PRK10207 489 dipeptide/tripeptide permease B; Provisional 99.67
PRK15075 434 citrate-proton symporter; Provisional 99.67
TIGR00898 505 2A0119 cation transport protein. 99.67
PRK11902 402 ampG muropeptide transporter; Reviewed 99.67
TIGR00879 481 SP MFS transporter, sugar porter (SP) family. This 99.67
PRK10489 417 enterobactin exporter EntS; Provisional 99.66
TIGR00901 356 2A0125 AmpG-related permease. 99.66
TIGR00885 410 fucP L-fucose:H+ symporter permease. This family d 99.66
PRK12307426 putative sialic acid transporter; Provisional 99.66
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT 99.65
TIGR00898505 2A0119 cation transport protein. 99.65
PRK09952 438 shikimate transporter; Provisional 99.65
TIGR00880141 2_A_01_02 Multidrug resistance protein. 99.65
PRK09705393 cynX putative cyanate transporter; Provisional 99.65
PRK15034 462 nitrate/nitrite transport protein NarU; Provisiona 99.65
PRK11663434 regulatory protein UhpC; Provisional 99.65
PRK09952438 shikimate transporter; Provisional 99.64
PRK03893496 putative sialic acid transporter; Provisional 99.63
TIGR00890377 2A0111 Oxalate/Formate Antiporter. 99.63
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisio 99.62
PRK15075434 citrate-proton symporter; Provisional 99.62
PRK09584 500 tppB putative tripeptide transporter permease; Rev 99.62
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a l 99.62
KOG0252|consensus538 99.62
PF06609 599 TRI12: Fungal trichothecene efflux pump (TRI12); I 99.62
PRK05122399 major facilitator superfamily transporter; Provisi 99.62
TIGR00896 355 CynX cyanate transporter. This family of proteins 99.61
COG2223 417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.61
KOG0255|consensus 521 99.61
PRK03633 381 putative MFS family transporter protein; Provision 99.6
PRK11010 491 ampG muropeptide transporter; Validated 99.6
PRK15011 393 sugar efflux transporter B; Provisional 99.6
PRK15011393 sugar efflux transporter B; Provisional 99.59
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.59
KOG2532|consensus 466 99.58
TIGR00897402 2A0118 polyol permease family. This family of prot 99.56
PTZ00207 591 hypothetical protein; Provisional 99.56
PRK10133 438 L-fucose transporter; Provisional 99.56
TIGR00806 511 rfc RFC reduced folate carrier. Proteins of the RF 99.56
PRK12382392 putative transporter; Provisional 99.56
TIGR00712438 glpT glycerol-3-phosphate transporter. This model 99.55
KOG2615|consensus 451 99.55
PRK09528420 lacY galactoside permease; Reviewed 99.55
TIGR00883 394 2A0106 metabolite-proton symporter. This model rep 99.55
PRK09528 420 lacY galactoside permease; Reviewed 99.54
TIGR00899375 2A0120 sugar efflux transporter. This family of pr 99.52
PRK03545390 putative arabinose transporter; Provisional 99.52
PRK11128 382 putative 3-phenylpropionic acid transporter; Provi 99.52
PRK03633381 putative MFS family transporter protein; Provision 99.52
TIGR00893399 2A0114 d-galactonate transporter. 99.51
TIGR00805 633 oat sodium-independent organic anion transporter. 99.51
TIGR00902 382 2A0127 phenyl proprionate permease family protein. 99.51
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transp 99.51
TIGR02718 390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.51
TIGR02332412 HpaX 4-hydroxyphenylacetate permease. This protein 99.51
PRK03699394 putative transporter; Provisional 99.5
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.5
TIGR00903368 2A0129 major facilitator 4 family protein. This fa 99.5
TIGR00882 396 2A0105 oligosaccharide:H+ symporter. 99.5
KOG0254|consensus 513 99.5
TIGR01301 477 GPH_sucrose GPH family sucrose/H+ symporter. This 99.49
TIGR00883394 2A0106 metabolite-proton symporter. This model rep 99.49
KOG0569|consensus 485 99.49
TIGR00891405 2A0112 putative sialic acid transporter. 99.48
PF11700477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 99.47
PRK11010491 ampG muropeptide transporter; Validated 99.47
PRK10504471 putative transporter; Provisional 99.46
PRK09874408 drug efflux system protein MdtG; Provisional 99.45
TIGR00892455 2A0113 monocarboxylate transporter 1. 99.45
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.45
PRK15034462 nitrate/nitrite transport protein NarU; Provisiona 99.44
TIGR00792 437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.43
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.43
TIGR00902382 2A0127 phenyl proprionate permease family protein. 99.42
KOG3764|consensus 464 99.42
TIGR00792437 gph sugar (Glycoside-Pentoside-Hexuronide) transpo 99.42
COG2814394 AraJ Arabinose efflux permease [Carbohydrate trans 99.4
KOG2533|consensus 495 99.39
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion tr 99.39
PLN00028476 nitrate transmembrane transporter; Provisional 99.38
KOG2504|consensus 509 99.37
PRK10091382 MFS transport protein AraJ; Provisional 99.36
TIGR02718390 sider_RhtX_FptX siderophore transporter, RhtX/FptX 99.35
TIGR00895398 2A0115 benzoate transport. 99.35
TIGR00900365 2A0121 H+ Antiporter protein. 99.35
TIGR00881379 2A0104 phosphoglycerate transporter family protein 99.34
COG2270438 Permeases of the major facilitator superfamily [Ge 99.32
PF03825400 Nuc_H_symport: Nucleoside H+ symporter 99.3
PF06813250 Nodulin-like: Nodulin-like; InterPro: IPR010658 Th 99.3
TIGR00894465 2A0114euk Na(+)-dependent inorganic phosphate cotr 99.3
PF05977 524 MFS_3: Transmembrane secretion effector; InterPro: 99.28
TIGR00711485 efflux_EmrB drug resistance transporter, EmrB/QacA 99.27
PRK15402406 multidrug efflux system translocase MdfA; Provisio 99.27
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.26
TIGR00882396 2A0105 oligosaccharide:H+ symporter. 99.25
PRK11128382 putative 3-phenylpropionic acid transporter; Provi 99.25
PRK11902402 ampG muropeptide transporter; Reviewed 99.25
PRK14995495 methyl viologen resistance protein SmvA; Provision 99.24
TIGR00896355 CynX cyanate transporter. This family of proteins 99.24
PF00083 451 Sugar_tr: Sugar (and other) transporter; InterPro: 99.24
PRK09848448 glucuronide transporter; Provisional 99.23
PRK09669 444 putative symporter YagG; Provisional 99.22
KOG0252|consensus 538 99.22
TIGR01272310 gluP glucose/galactose transporter. Disruption of 99.21
KOG4686|consensus459 99.2
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.2
TIGR00710385 efflux_Bcr_CflA drug resistance transporter, Bcr/C 99.19
TIGR00889 418 2A0110 nucleoside transporter. This family of prot 99.17
PRK11043401 putative transporter; Provisional 99.17
KOG2504|consensus509 99.16
PRK10429 473 melibiose:sodium symporter; Provisional 99.16
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.15
PRK10054395 putative transporter; Provisional 99.14
TIGR00788 468 fbt folate/biopterin transporter. The only functio 99.14
KOG0255|consensus521 99.13
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.13
PRK11646400 multidrug resistance protein MdtH; Provisional 99.13
PRK09669444 putative symporter YagG; Provisional 99.12
COG3104 498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 99.12
COG0738 422 FucP Fucose permease [Carbohydrate transport and m 99.11
PRK10429473 melibiose:sodium symporter; Provisional 99.11
PF13347 428 MFS_2: MFS/sugar transport protein 99.1
PF01306412 LacY_symp: LacY proton/sugar symporter; InterPro: 99.1
PRK10133438 L-fucose transporter; Provisional 99.09
COG2211467 MelB Na+/melibiose symporter and related transport 99.07
PRK11462 460 putative transporter; Provisional 99.06
TIGR00901356 2A0125 AmpG-related permease. 99.05
KOG0253|consensus 528 99.05
PRK11195393 lysophospholipid transporter LplT; Provisional 99.04
PF05631 354 DUF791: Protein of unknown function (DUF791); Inte 99.03
PF13347428 MFS_2: MFS/sugar transport protein 99.03
PRK11462460 putative transporter; Provisional 99.03
KOG2532|consensus466 99.02
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.02
COG2807395 CynX Cyanate permease [Inorganic ion transport and 99.01
PF07690352 MFS_1: Major Facilitator Superfamily; InterPro: IP 98.99
TIGR00885410 fucP L-fucose:H+ symporter permease. This family d 98.98
KOG2816|consensus 463 98.96
PF03825 400 Nuc_H_symport: Nucleoside H+ symporter 98.92
TIGR00886366 2A0108 nitrite extrusion protein (nitrite facilita 98.86
COG2807 395 CynX Cyanate permease [Inorganic ion transport and 98.82
PRK09848 448 glucuronide transporter; Provisional 98.8
COG0738422 FucP Fucose permease [Carbohydrate transport and m 98.8
KOG2533|consensus495 98.8
TIGR00788468 fbt folate/biopterin transporter. The only functio 98.79
COG2211 467 MelB Na+/melibiose symporter and related transport 98.77
PF11700 477 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR0 98.76
TIGR00926 654 2A1704 Peptide:H+ symporter (also transports b-lac 98.74
PF03092 433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.73
TIGR01301477 GPH_sucrose GPH family sucrose/H+ symporter. This 98.72
KOG3762|consensus618 98.7
PRK11652394 emrD multidrug resistance protein D; Provisional 98.69
PF01306 412 LacY_symp: LacY proton/sugar symporter; InterPro: 98.69
KOG2325|consensus 488 98.65
PF1283277 MFS_1_like: MFS_1 like family 98.62
PF06609599 TRI12: Fungal trichothecene efflux pump (TRI12); I 98.58
PF03209 403 PUCC: PUCC protein; InterPro: IPR004896 This prote 98.53
TIGR00924475 yjdL_sub1_fam amino acid/peptide transporter (Pept 98.53
PRK15403413 multidrug efflux system protein MdtM; Provisional 98.52
PF05978156 UNC-93: Ion channel regulatory protein UNC-93; Int 98.48
PRK10207489 dipeptide/tripeptide permease B; Provisional 98.47
KOG2563|consensus 480 98.44
PRK09584500 tppB putative tripeptide transporter permease; Rev 98.4
COG0477 338 ProP Permeases of the major facilitator superfamil 98.37
KOG2563|consensus480 98.25
PTZ00207591 hypothetical protein; Provisional 98.07
PF03092433 BT1: BT1 family; InterPro: IPR004324 Members of th 98.03
TIGR00769 472 AAA ADP/ATP carrier protein family. These proteins 97.99
PRK15462493 dipeptide/tripeptide permease D; Provisional 97.93
TIGR01272 310 gluP glucose/galactose transporter. Disruption of 97.91
PF0677985 DUF1228: Protein of unknown function (DUF1228); In 97.89
PF01770 412 Folate_carrier: Reduced folate carrier; InterPro: 97.82
COG2270 438 Permeases of the major facilitator superfamily [Ge 97.78
PF03209403 PUCC: PUCC protein; InterPro: IPR004896 This prote 97.68
KOG1330|consensus493 97.48
TIGR00805633 oat sodium-independent organic anion transporter. 97.45
PF06963 432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.45
KOG3626|consensus 735 97.38
PF03137 539 OATP: Organic Anion Transporter Polypeptide (OATP) 97.36
PF00854 372 PTR2: POT family; InterPro: IPR000109 This entry r 97.32
KOG3098|consensus461 97.19
PF06963432 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 Thi 97.16
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid tra 97.16
KOG3098|consensus 461 97.09
KOG3764|consensus464 97.05
KOG3762|consensus 618 96.94
KOG0637|consensus 498 96.86
KOG3626|consensus 735 96.83
KOG2816|consensus463 96.77
KOG3574|consensus 510 96.71
PF03219 491 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 96.69
KOG1237|consensus 571 96.57
PF13000 544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 96.45
KOG2615|consensus451 96.3
KOG4686|consensus 459 96.06
KOG4332|consensus 454 95.69
PF02487 402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 95.38
PF03137539 OATP: Organic Anion Transporter Polypeptide (OATP) 95.24
PRK03612 521 spermidine synthase; Provisional 94.61
COG3202 509 ATP/ADP translocase [Energy production and convers 94.05
TIGR00806511 rfc RFC reduced folate carrier. Proteins of the RF 91.95
KOG3810|consensus 433 88.39
PF02487402 CLN3: CLN3 protein; InterPro: IPR003492 Batten's d 86.86
KOG2325|consensus488 86.84
TIGR00939 437 2a57 Equilibrative Nucleoside Transporter (ENT). 86.28
PF01770412 Folate_carrier: Reduced folate carrier; InterPro: 85.77
COG5336116 Uncharacterized protein conserved in bacteria [Fun 82.64
PF13000544 Acatn: Acetyl-coenzyme A transporter 1; InterPro: 81.41
TIGR00880141 2_A_01_02 Multidrug resistance protein. 80.34
PF11947153 DUF3464: Protein of unknown function (DUF3464); In 80.09
>KOG0569|consensus Back     alignment and domain information
Probab=99.94  E-value=4.4e-25  Score=172.37  Aligned_cols=196  Identities=32%  Similarity=0.504  Sum_probs=172.1

Q ss_pred             hHHHHHHhhChhHHHHhHHHHHHhhCCCCCh-hHHHHHHHHHHHHHHHHHHHhhhhcCchHHHHHhhHHHHHHHHHHHHh
Q psy5074           2 GLMTFQRFSGVSALIYYTVDIFRNAGTRIAP-STASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAY   80 (204)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~-~~~~~~~~~~~~~~~~~~g~l~d~~grr~~~~~~~~~~~i~~~~~~~~   80 (204)
                      .+.+.+|++|.++..+|...++++.|++.+. .+.+........+.++++.++.||+|||++++.+..++.++.+.+...
T Consensus       276 ~v~~~qq~sGi~ai~~Yst~i~~~aG~~~~~a~~an~~~g~v~~~~t~~~~~lid~~gRRpLll~~~~~~~~~~~~~~~~  355 (485)
T KOG0569|consen  276 VVSFAQQFSGINAIFFYSTSIFKTAGFTPEEAQYANLGIGIVNLLSTLVSPFLIDRLGRRPLLLISLSLMAVALLLMSIA  355 (485)
T ss_pred             HHHHHHHhcCcceeHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHHHHH
Confidence            4678999999999999999999999999876 889999999999999999999999999999999999999998888765


Q ss_pred             heeecCCCCCCCccHHHHHHHHHHHHHHHhcCccchhhhhccccchhhhHhHhHHHHHHHHHHHHHHHHHhHHHHHhhch
Q psy5074          81 FVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTVGS  160 (204)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~R~~~~~~~~~~~~~~~~~~~~~~~~l~~~~g~  160 (204)
                      ....+...  .+..+..+...+.+...++.|.+|++|.+.+|++|++.|+.+.++.....++..++....++.+.+..|.
T Consensus       356 ~~l~~~~~--~~~~y~~i~~~~~~~~~f~~G~gpi~~fi~aELf~~~~R~aa~s~~~~~~w~~~fiv~~~fp~l~~~~g~  433 (485)
T KOG0569|consen  356 LFLSNSFG--SWLSYLCIAAIFLFIISFAIGPGPIPWFIGAELFPQSARSAAQSVATAVNWLSNFIVGFAFPPLQNVIGP  433 (485)
T ss_pred             HHHHHHhh--hHHHHHHHHHHHHHHHhhhcCCCchhHHHHHHhCCccchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            44433110  0122344666777888899999999999999999999999999999999999999999999999999998


Q ss_pred             hHHHHHHHHHHHHHHHHHhhcccCCCCCCHHHHHHHHhcc
Q psy5074         161 AATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMG  200 (204)
Q Consensus       161 ~~~~~~~~~~~~i~~~~~~~~~~e~~~~~~~~~~~~~~~~  200 (204)
                       ..|..+.+.+++..+..++.+||||+|+.+|+.++++++
T Consensus       434 -~~filF~i~~~~~~i~~~~~lPETkgr~~~eI~~~~~~~  472 (485)
T KOG0569|consen  434 -YVFILFVIPLAIFLIYLYRYLPETKGRTPYEIIEELEKR  472 (485)
T ss_pred             -hhhHHHHHHHHHHHHHHHHhCcccCCCCHHHHHHHHHhC
Confidence             788999999999999999999999999999988877655



>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>TIGR01299 synapt_SV2 synaptic vesicle protein SV2 Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK15075 citrate-proton symporter; Provisional Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK15011 sugar efflux transporter B; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>TIGR00897 2A0118 polyol permease family Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>PRK12382 putative transporter; Provisional Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter Back     alignment and domain information
>PRK03545 putative arabinose transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease Back     alignment and domain information
>PRK03699 putative transporter; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>KOG0254|consensus Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>TIGR00883 2A0106 metabolite-proton symporter Back     alignment and domain information
>KOG0569|consensus Back     alignment and domain information
>TIGR00891 2A0112 putative sialic acid transporter Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK10504 putative transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter 1 Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>PRK15034 nitrate/nitrite transport protein NarU; Provisional Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR00902 2A0127 phenyl proprionate permease family protein Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>TIGR00792 gph sugar (Glycoside-Pentoside-Hexuronide) transporter Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN00028 nitrate transmembrane transporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family Back     alignment and domain information
>TIGR00895 2A0115 benzoate transport Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>PF06813 Nodulin-like: Nodulin-like; InterPro: IPR010658 This entry represents a conserved region within plant nodulin-like proteins and a number of uncharacterised proteins Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter Back     alignment and domain information
>PF05977 MFS_3: Transmembrane secretion effector; InterPro: IPR010290 This family consists of the enterobactin exporter EntS proteins and putative permeases all belonging to the major facilitator superfamily Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance transporter, EmrB/QacA subfamily Back     alignment and domain information
>PRK15402 multidrug efflux system translocase MdfA; Provisional Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>PRK14995 methyl viologen resistance protein SmvA; Provisional Back     alignment and domain information
>TIGR00896 CynX cyanate transporter Back     alignment and domain information
>PF00083 Sugar_tr: Sugar (and other) transporter; InterPro: IPR005828 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>KOG0252|consensus Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter Back     alignment and domain information
>PRK11043 putative transporter; Provisional Back     alignment and domain information
>KOG2504|consensus Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK10054 putative transporter; Provisional Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>KOG0255|consensus Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>TIGR00901 2A0125 AmpG-related permease Back     alignment and domain information
>KOG0253|consensus Back     alignment and domain information
>PRK11195 lysophospholipid transporter LplT; Provisional Back     alignment and domain information
>PF05631 DUF791: Protein of unknown function (DUF791); InterPro: IPR008509 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF13347 MFS_2: MFS/sugar transport protein Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>KOG2532|consensus Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF07690 MFS_1: Major Facilitator Superfamily; InterPro: IPR011701 Among the different families of transporter, only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>PF03825 Nuc_H_symport: Nucleoside H+ symporter Back     alignment and domain information
>TIGR00886 2A0108 nitrite extrusion protein (nitrite facilitator) Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2533|consensus Back     alignment and domain information
>TIGR00788 fbt folate/biopterin transporter Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF11700 ATG22: Vacuole effluxer Atg22 like; InterPro: IPR024671 Autophagy is a major survival mechanism in which eukaryotes recycle cellular nutrients during stress conditions Back     alignment and domain information
>TIGR00926 2A1704 Peptide:H+ symporter (also transports b-lactam antibiotics, the antitumor agent, bestatin, and various protease inhibitors) Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>TIGR01301 GPH_sucrose GPH family sucrose/H+ symporter Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PF01306 LacY_symp: LacY proton/sugar symporter; InterPro: IPR022814 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) [] Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>PF12832 MFS_1_like: MFS_1 like family Back     alignment and domain information
>PF06609 TRI12: Fungal trichothecene efflux pump (TRI12); InterPro: IPR010573 This family consists of several fungal specific trichothecene efflux pump proteins Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>TIGR00924 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H+ symporter), bacterial Back     alignment and domain information
>PRK15403 multidrug efflux system protein MdtM; Provisional Back     alignment and domain information
>PF05978 UNC-93: Ion channel regulatory protein UNC-93; InterPro: IPR010291 The proteins in this family are represented by UNC-93 from Caenorhabditis elegans Back     alignment and domain information
>PRK10207 dipeptide/tripeptide permease B; Provisional Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PRK09584 tppB putative tripeptide transporter permease; Reviewed Back     alignment and domain information
>COG0477 ProP Permeases of the major facilitator superfamily [Carbohydrate transport and metabolism / Amino acid transport and metabolism / Inorganic ion transport and metabolism / General function prediction only] Back     alignment and domain information
>KOG2563|consensus Back     alignment and domain information
>PTZ00207 hypothetical protein; Provisional Back     alignment and domain information
>PF03092 BT1: BT1 family; InterPro: IPR004324 Members of this family are transmembrane proteins Back     alignment and domain information
>TIGR00769 AAA ADP/ATP carrier protein family Back     alignment and domain information
>PRK15462 dipeptide/tripeptide permease D; Provisional Back     alignment and domain information
>TIGR01272 gluP glucose/galactose transporter Back     alignment and domain information
>PF06779 DUF1228: Protein of unknown function (DUF1228); InterPro: IPR010645 This entry represents the N terminus of several putative bacterial membrane proteins, which may be sugar transporters Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>PF03209 PUCC: PUCC protein; InterPro: IPR004896 This protein is required for high-level transcription of the PUC operon Back     alignment and domain information
>KOG1330|consensus Back     alignment and domain information
>TIGR00805 oat sodium-independent organic anion transporter Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PF00854 PTR2: POT family; InterPro: IPR000109 This entry represents the POT (proton-dependent oligopeptide transport) family, which all appear to be proton dependent transporters Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>PF06963 FPN1: Ferroportin1 (FPN1); InterPro: IPR009716 This entry represents the solute carrier family 40 member 1 family of proteins, also known as Ferroportin 1 Back     alignment and domain information
>COG3104 PTR2 Dipeptide/tripeptide permease [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3098|consensus Back     alignment and domain information
>KOG3764|consensus Back     alignment and domain information
>KOG3762|consensus Back     alignment and domain information
>KOG0637|consensus Back     alignment and domain information
>KOG3626|consensus Back     alignment and domain information
>KOG2816|consensus Back     alignment and domain information
>KOG3574|consensus Back     alignment and domain information
>PF03219 TLC: TLC ATP/ADP transporter; InterPro: IPR004667 These proteins are members of the ATP:ADP Antiporter (AAA) family, which consists of nucleotide transporters that have 12 GES predicted transmembrane regions Back     alignment and domain information
>KOG1237|consensus Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>KOG2615|consensus Back     alignment and domain information
>KOG4686|consensus Back     alignment and domain information
>KOG4332|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>PF03137 OATP: Organic Anion Transporter Polypeptide (OATP) family; InterPro: IPR004156 This family consists of several eukaryotic Organic-Anion-Transporting Polypeptides (OATPs) Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>COG3202 ATP/ADP translocase [Energy production and conversion] Back     alignment and domain information
>TIGR00806 rfc RFC reduced folate carrier Back     alignment and domain information
>KOG3810|consensus Back     alignment and domain information
>PF02487 CLN3: CLN3 protein; InterPro: IPR003492 Batten's disease, the juvenile variant of neuronal ceroid lipofuscionosis (NCL), is a recessively inherited disorder affecting children of 5-10 years of age Back     alignment and domain information
>KOG2325|consensus Back     alignment and domain information
>TIGR00939 2a57 Equilibrative Nucleoside Transporter (ENT) Back     alignment and domain information
>PF01770 Folate_carrier: Reduced folate carrier; InterPro: IPR002666 The reduced folate carrier (a transmembrane glycoprotein) transports reduced folate into mammalian cells via the carrier mediated mechanism (as opposed to the receptor mediated mechanism) it also transports cytotoxic folate analogues used in chemotherapy [], such as methotrexate (MTX) Back     alignment and domain information
>COG5336 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13000 Acatn: Acetyl-coenzyme A transporter 1; InterPro: IPR024371 Acetyl-coenzyme A transporter 1 (also known as acatn) is a multipass transmembrane protein that appears to promote 9-O-acetylation in gangliosides [, ] Back     alignment and domain information
>TIGR00880 2_A_01_02 Multidrug resistance protein Back     alignment and domain information
>PF11947 DUF3464: Protein of unknown function (DUF3464); InterPro: IPR021855 This family of proteins are functionally uncharacterised Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query204
4gby_A491 The Structure Of The Mfs (Major Facilitator Superfa 2e-13
>pdb|4GBY|A Chain A, The Structure Of The Mfs (Major Facilitator Superfamily) Proton:xylose Symporter Xyle Bound To D-Xylose Length = 491 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 2e-13, Method: Compositional matrix adjust. Identities = 55/201 (27%), Positives = 96/201 (47%), Gaps = 16/201 (7%) Query: 3 LMTFQRFSGVSALIYYTVDIFRNAG--TRIAPSTASIIVGAVQXXXXXXXXXXIDRLGRR 60 L FQ+F G++ ++YY ++F+ G T IA +IIVG + +D+ GR+ Sbjct: 284 LSIFQQFVGINVVLYYAPEVFKTLGASTDIA-LLQTIIVGVINLTFTVLAIMTVDKFGRK 342 Query: 61 FLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMM 120 L + + MA L F + G + + S+ VA F + GP+ W ++ Sbjct: 343 PLQIIGALGMAIGMFSLGTAFYTQAPGI-------VALLSMLFYVAAFAMSWGPVCWVLL 395 Query: 121 AEIIPLEAKLWSSSLLMCYSWSCLFLVSKVF--MD----LIDTVGSAATYGLLGLICTLG 174 +EI P + + ++ + W + VS F MD L+ + +Y + G + L Sbjct: 396 SEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLVAHFHNGFSYWIYGCMGVLA 455 Query: 175 AVFVYTRVPETKNKSFEAIQA 195 A+F++ VPETK K+ E ++A Sbjct: 456 ALFMWKFVPETKGKTLEELEA 476 Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
4gc0_A491 D-xylose-proton symporter; MFS, transport protein; 99.94
1pw4_A 451 Glycerol-3-phosphate transporter; transmembrane, i 99.8
2gfp_A 375 EMRD, multidrug resistance protein D; membrane pro 99.8
3o7q_A 438 L-fucose-proton symporter; transporter, multi-PASS 99.78
4aps_A 491 DI-OR tripeptide H+ symporter; transport protein, 99.75
2xut_A 524 Proton/peptide symporter family protein; transport 99.72
1pw4_A451 Glycerol-3-phosphate transporter; transmembrane, i 99.68
4gc0_A 491 D-xylose-proton symporter; MFS, transport protein; 99.63
2cfq_A417 Lactose permease; transport, transport mechanism, 99.6
3o7q_A438 L-fucose-proton symporter; transporter, multi-PASS 99.57
4aps_A491 DI-OR tripeptide H+ symporter; transport protein, 99.46
2cfq_A 417 Lactose permease; transport, transport mechanism, 99.27
2gfp_A375 EMRD, multidrug resistance protein D; membrane pro 98.98
2xut_A524 Proton/peptide symporter family protein; transport 98.92
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
Probab=99.94  E-value=3.5e-25  Score=175.63  Aligned_cols=193  Identities=25%  Similarity=0.473  Sum_probs=154.6

Q ss_pred             HHHHHHhhChhHHHHhHHHHHHhhCCCCCh-hHHHHHHHHHHHHHHHHHHHhhhhcCchHHHHHhhHHHHHHHHHHHHhh
Q psy5074           3 LMTFQRFSGVSALIYYTVDIFRNAGTRIAP-STASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYF   81 (204)
Q Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~g~~~~~-~~~~~~~~~~~~~~~~~~g~l~d~~grr~~~~~~~~~~~i~~~~~~~~~   81 (204)
                      ...++++.+.+.+..|.|.+.+..+.+... .....+..+...++.++++++.||+|||+.++.+...+.++...+....
T Consensus       284 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~dr~Grr~~~~~~~~~~~~~~~~l~~~~  363 (491)
T 4gc0_A          284 LSIFQQFVGINVVLYYAPEVFKTLGASTDIALLQTIIVGVINLTFTVLAIMTVDKFGRKPLQIIGALGMAIGMFSLGTAF  363 (491)
T ss_dssp             HHHHHHHTCHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCSHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhhhhHHHhcchHHHHhcCCCccchhhHHHHHHHHHHHHHHHHHHHHHhhcCcchhccchHHHHHHHHHHHHHH
Confidence            457788999999999999999988877655 6677778888999999999999999999999998888888777665443


Q ss_pred             eeecCCCCCCCccHHHHHHHHHHHHHHHhcCccchhhhhccccchhhhHhHhHHHHHHHHHHHHHHHHHhHHHHH-----
Q psy5074          82 VFKNQGYDMQDYSWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLID-----  156 (204)
Q Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~R~~~~~~~~~~~~~~~~~~~~~~~~l~~-----  156 (204)
                      ...       ...+..+........+++.+.+++.+.+.+|++|++.|+++.++.+..+++++.+++.+.+.+.+     
T Consensus       364 ~~~-------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~E~fPt~~R~~~~g~~~~~~~~~~~i~~~~~p~l~~~~~~~  436 (491)
T 4gc0_A          364 YTQ-------APGIVALLSMLFYVAAFAMSWGPVCWVLLSEIFPNAIRGKALAIAVAAQWLANYFVSWTFPMMDKNSWLV  436 (491)
T ss_dssp             HTT-------CCHHHHHHHHHHHHHHHHTTTTHHHHHHHHHSSCTTTHHHHHHHHHHHHHHHHHHHHTHHHHHCHHHHHH
T ss_pred             hcc-------cchHHHHHHHHHHHHHHHhHHHHHHHHHHHHhCCHhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            221       23344445555556667777888889999999999999999999999999999999888876643     


Q ss_pred             -hhchhHHHHHHHHHHHHHHHHHhhcccCCCCCCHHHHHHHHhcccC
Q psy5074         157 -TVGSAATYGLLGLICTLGAVFVYTRVPETKNKSFEAIQAELAMGYT  202 (204)
Q Consensus       157 -~~g~~~~~~~~~~~~~i~~~~~~~~~~e~~~~~~~~~~~~~~~~~~  202 (204)
                       ..++...|+++++++++..++.++++||||+|++||+|+.++++.+
T Consensus       437 ~~~~~~~~~~i~~~~~~~~~i~~~~~~PETkg~tLeei~~~f~~~~~  483 (491)
T 4gc0_A          437 AHFHNGFSYWIYGCMGVLAALFMWKFVPETKGKTLEELEALWEPETK  483 (491)
T ss_dssp             HHHTTCHHHHHHHHHHHHHHHHHHHHCCCCTTCCHHHHGGGTC----
T ss_pred             hhhhhhHHHHHHHHHHHHHHHHHHheecCCCCCCHHHHHHHhCCCCc
Confidence             2445567888999999999888888999999999999988876554



>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure
>1pw4_A Glycerol-3-phosphate transporter; transmembrane, inner membrane, major facilitator superfamily, secondary active membrane transporter; 3.30A {Escherichia coli} SCOP: f.38.1.1 Back     alignment and structure
>4gc0_A D-xylose-proton symporter; MFS, transport protein; HET: 6BG BNG; 2.60A {Escherichia coli} PDB: 4gbz_A* 4gby_A* Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>3o7q_A L-fucose-proton symporter; transporter, multi-PASS membrane protei transport protein; HET: BNG; 3.14A {Escherichia coli} PDB: 3o7p_A* Back     alignment and structure
>4aps_A DI-OR tripeptide H+ symporter; transport protein, peptide transport, major facilitator SUPE transporter, MFS; 3.30A {Streptococcus thermophilus} Back     alignment and structure
>2cfq_A Lactose permease; transport, transport mechanism, lactose/H+ symport, sugar transport, transmembrane, formylation; 2.95A {Escherichia coli} SCOP: f.38.1.2 PDB: 1pv7_A* 1pv6_A 2cfp_A 2v8n_A 2y5y_A* Back     alignment and structure
>2gfp_A EMRD, multidrug resistance protein D; membrane protein, multidrug transporter; 3.50A {Escherichia coli} Back     alignment and structure
>2xut_A Proton/peptide symporter family protein; transport protein, membrane protein, major facilitator super transporter; 3.62A {Shewanella oneidensis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query204
d1pw4a_ 447 Glycerol-3-phosphate transporter {Escherichia coli 99.76
d1pw4a_447 Glycerol-3-phosphate transporter {Escherichia coli 99.63
d1pv7a_417 Lactose permease {Escherichia coli [TaxId: 562]} 99.61
d1pv7a_ 417 Lactose permease {Escherichia coli [TaxId: 562]} 99.52
>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: MFS general substrate transporter
superfamily: MFS general substrate transporter
family: Glycerol-3-phosphate transporter
domain: Glycerol-3-phosphate transporter
species: Escherichia coli [TaxId: 562]
Probab=99.76  E-value=2.4e-18  Score=132.41  Aligned_cols=162  Identities=12%  Similarity=-0.053  Sum_probs=123.5

Q ss_pred             HHHhHHHHHHhhCCCCCh-hHHHHHHHHHHHHHHHHHHHhhhhcCchHHHHHhhHHHHHHHHHHHHhheeecCCCCCCCc
Q psy5074          15 LIYYTVDIFRNAGTRIAP-STASIIVGAVQVVVSLLSSLLIDRLGRRFLLLTSEITMAFCQLLLVAYFVFKNQGYDMQDY   93 (204)
Q Consensus        15 ~~~~~~~~~~~~g~~~~~-~~~~~~~~~~~~~~~~~~g~l~d~~grr~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~   93 (204)
                      +....|.+ ++.|++.++ ++..+...++..++++++|+++||+|||+.+.++.++..++.++.+......+       .
T Consensus        44 ~~~~~p~~-~~~g~s~~~~g~~~s~~~~~~~~~~~~~G~l~Dr~g~r~~~~~~~~~~~~~~~~~~~~~~~~~-------~  115 (447)
T d1pw4a_          44 FALAMPYL-VEQGFSRGDLGFALSGISIAYGFSKFIMGSVSDRSNPRVFLPAGLILAAAVMLFMGFVPWATS-------S  115 (447)
T ss_dssp             HHHHHHHT-TSSTTCSSCHHHHHHHHHHHHHHHHHHHHHHHHHSCHHHHHHHHHHHHHHHHHHHHHCHHHHS-------S
T ss_pred             HHHHHHHH-HHhCcCHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchHHHHHHHHHHHHHHhhccccchhhh-------h
Confidence            34445654 568998877 89999999999999999999999999999999999999888887766532211       2


Q ss_pred             cHHHHHHHHHHHHHHHhcCccchhhhhccccchhhhHhHhHHHHHHHHHHHHHHHHHhHHHHHhh-chhHHHHHHHHHHH
Q psy5074          94 SWIPIFSVCTIVAIFRIGIGPIPWFMMAEIIPLEAKLWSSSLLMCYSWSCLFLVSKVFMDLIDTV-GSAATYGLLGLICT  172 (204)
Q Consensus        94 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~p~~~R~~~~~~~~~~~~~~~~~~~~~~~~l~~~~-g~~~~~~~~~~~~~  172 (204)
                      .+..+....+.+.+.+. ..+....++.|.+|+++|+++.++.+....+|..+++.+.+...+.. +|++.+++.+.+..
T Consensus       116 ~~~~~~~~~~~g~~~~~-~~~~~~~~i~~~~~~~~r~~~~~~~~~~~~~g~~i~~~~~~~~~~~~~~w~~~~~~~~~~~~  194 (447)
T d1pw4a_         116 IAVMFVLLFLCGWFQGM-GWPPCGRTMVHWWSQKERGGIVSVWNCAHNVGGGIPPLLFLLGMAWFNDWHAALYMPAFCAI  194 (447)
T ss_dssp             SSHHHHHHHHHHHHHHH-THHHHHHHHHTTCTTTHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHTCCSTTCTHHHHHHHH
T ss_pred             HHHHHHHHHHHHHhhhh-hhhHHHHHHHHHHHhhcccccccccccccchhhhhhhhhhhhHhhhhhcccccchhhhhhHH
Confidence            23334444444444333 34566689999999999999999999999999999998888776654 68888888887777


Q ss_pred             HHHHHHhhcccCC
Q psy5074         173 LGAVFVYTRVPET  185 (204)
Q Consensus       173 i~~~~~~~~~~e~  185 (204)
                      +..+..+++.+|+
T Consensus       195 ~~~~~~~~~~~~~  207 (447)
T d1pw4a_         195 LVALFAFAMMRDT  207 (447)
T ss_dssp             HHHHHHHHHCCCS
T ss_pred             HHHHHHHHhcccc
Confidence            7777666656553



>d1pw4a_ f.38.1.1 (A:) Glycerol-3-phosphate transporter {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pv7a_ f.38.1.2 (A:) Lactose permease {Escherichia coli [TaxId: 562]} Back     information, alignment and structure