Psyllid ID: psy5102


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MYHFLMRSNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNNPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKPEPQRPYHENERNNEAEELYQSEIFRLDFGNPASARFVNNYILSATKSAL
cccHHHHHcHHHHHHHHHHHHHHHHHHHHcccccccEEEccHHHHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccccccccccccccccEEcccccEEEEEcccccEEEEEEEcccccHHHHHHHccHHHHHHHHHccccEEEEEEEEcEEEEcccccHHHHHcccccccccccccccccccccccEEEEEEEEEEEEEEcccHHHHHHHHHHHHccccccEEEccccEEEEEEEcccccEEEEEEEcccccccccccccccHHHHHHHccEEEEEEcccccccHHHHHHHHHcccccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEcHHHHHHHHHHHHHcccHHHHHHHHHHHcHcHHccHHHccccccccHHHHHHHHHHHHHHHHHHHHccccccccccEcccEEEEEEcccccccccccHHHHcccccccEEcccEEEEEEccccccEEEEEEEcccccHHHHHHHccHHHHHHHHHHccccEEEEEcccEEEEccccHHHHHHHccccccccccccccHHHHccccEEEEEEEEEEEEEEcccEEEEEEEEEEEEEcccccEEEccccEEEEEEEccccEEEEEEEEcccccccccccccccccHHHHcccccEEEccccHcHHHHHHHHHHHHHHHcc
MYHFLMRSNLILRRGITQMTLDMERAIRSVMTKnqnvvfapLSIVGALALVLlgsdgqtkdELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKnqnvvfapLSIVGALALVLlgsdgqtkdELTHFMGvatgrslsnnpEAYASFLEKMRNEVYMYFilpknpdlseftkdldydKFSRIIEstnkvdviytipkmkvtssTELRTVLNTMNVtsmfdvsksdlsnmlddrgvavdQVFHKVDIEVTEQGTVAAASTGIIitriskptvkinrpfiffiyhkptdsivfwgsiykpepqrpyhenernneaeELYQSEifrldfgnpasarFVNNYILSATKSAL
MYHFLMRSNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVatgrslsnkltahslrrGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMgvatgrslsnnPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIiestnkvdviytipkmkvtsstelrtVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEvteqgtvaaastgiiitriskptvkiNRPFIFFIYHKPTDSIVFWGSIYKPEPQRPYHENERNNEAEELYQSEIFRLDFGNPASARFVNNYILSATKSAL
MYHFLMRSNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNNPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKPEPQRPYHENERNNEAEELYQSEIFRLDFGNPASARFVNNYILSATKSAL
**HFLMRSNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNNPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYK*******************YQSEIFRLDFGNPASARFVNNYIL*******
**H****SNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNNPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYK*****************ELYQSEIFRLDFGNPASARFVNNYILSATKS**
MYHFLMRSNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNNPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKPEPQRPYHENERNNEAEELYQSEIFRLDFGNPASARFVNNYILSATKSAL
MYHFLMRSNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNNPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKPEPQ*******RNNEAEELYQSEIFRLDFGNPASARFVNNYILSATKS**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYHFLMRSNLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNKLTAHSLRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATGRSLSNNPEAYASFLEKMRNEVYMYFILPKNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKPEPQRPYHENERNNEAEELYQSEIFRLDFGNPASARFVNNYILSATKSAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query357 2.2.26 [Sep-21-2011]
B3RFC3397 Serpin B10 OS=Sorex arane N/A N/A 0.436 0.392 0.373 1e-20
B4USX2397 Serpin B10 OS=Otolemur ga N/A N/A 0.442 0.397 0.341 4e-20
A9RA96397 Serpin B10 OS=Papio anubi N/A N/A 0.442 0.397 0.341 7e-19
A5PJK0397 Serpin B10 OS=Bos taurus yes N/A 0.445 0.400 0.321 1e-18
B1MTC3397 Serpin B10 OS=Callicebus N/A N/A 0.442 0.397 0.329 1e-18
B2KI30397 Serpin B10 OS=Rhinolophus N/A N/A 0.445 0.400 0.333 2e-18
Q8K1K6397 Serpin B10 OS=Mus musculu yes N/A 0.369 0.332 0.364 2e-18
B0CMB0397 Serpin B10 OS=Callithrix no N/A 0.439 0.395 0.321 2e-17
Q5BIR5374 Serpin B8 OS=Bos taurus G no N/A 0.403 0.385 0.348 2e-17
P48595397 Serpin B10 OS=Homo sapien no N/A 0.442 0.397 0.323 6e-17
>sp|B3RFC3|SPB10_SORAR Serpin B10 OS=Sorex araneus GN=SERPINB10 PE=3 SV=1 Back     alignment and function desciption
 Score =  100 bits (249), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 95/166 (57%), Gaps = 10/166 (6%)

Query: 151 PEAYASFLEKMRNEVYMYFILPKN-PDLSEFTKDLDYDKFSRIIESTNKVDVIYTI---- 205
           P+A    L+    ++ +  ILP++   L +  K + YD+ S    ++  +  +YT+    
Sbjct: 234 PQATGLRLDYKNRDLSLLLILPEDVCGLDQLEKAITYDQLSEW--TSEDMMEMYTVELHL 291

Query: 206 PKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVA 265
           PK K+  S +L+T L +M ++  F+ SK+D S M D+R + +  VFHK  +E+ EQGT A
Sbjct: 292 PKFKLEQSYDLKTTLASMGMSDAFNQSKADFSGMSDERNLYLSNVFHKSFVEINEQGTEA 351

Query: 266 AA-STGIIITRISKPTVKIN--RPFIFFIYHKPTDSIVFWGSIYKP 308
           AA S   I  RI  PT++IN   PFIFFI H  T+SI+F+G    P
Sbjct: 352 AAGSASEISVRIKLPTIEINADHPFIFFIRHNKTNSILFYGRFCSP 397




Protease inhibitor that may play a role in the regulation of protease activities during hematopoiesis and apoptosis induced by TNF. May regulate protease activities in the cytoplasm and in the nucleus.
Sorex araneus (taxid: 42254)
>sp|B4USX2|SPB10_OTOGA Serpin B10 OS=Otolemur garnettii GN=SERPINB10 PE=3 SV=1 Back     alignment and function description
>sp|A9RA96|SPB10_PAPAN Serpin B10 OS=Papio anubis GN=SERPINB10 PE=3 SV=1 Back     alignment and function description
>sp|A5PJK0|SPB10_BOVIN Serpin B10 OS=Bos taurus GN=SERPINB10 PE=2 SV=1 Back     alignment and function description
>sp|B1MTC3|SPB10_CALMO Serpin B10 OS=Callicebus moloch GN=SERPINB10 PE=3 SV=1 Back     alignment and function description
>sp|B2KI30|SPB10_RHIFE Serpin B10 OS=Rhinolophus ferrumequinum GN=SERPINB10 PE=3 SV=1 Back     alignment and function description
>sp|Q8K1K6|SPB10_MOUSE Serpin B10 OS=Mus musculus GN=Serpinb10 PE=2 SV=1 Back     alignment and function description
>sp|B0CMB0|SPB10_CALJA Serpin B10 OS=Callithrix jacchus GN=SERPINB10 PE=3 SV=1 Back     alignment and function description
>sp|Q5BIR5|SPB8_BOVIN Serpin B8 OS=Bos taurus GN=SERPINB8 PE=2 SV=1 Back     alignment and function description
>sp|P48595|SPB10_HUMAN Serpin B10 OS=Homo sapiens GN=SERPINB10 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
193688350 532 PREDICTED: plasminogen activator inhibit 0.515 0.345 0.388 1e-27
357615598444 serine protease inhibitor 6 [Danaus plex 0.501 0.403 0.357 5e-20
389608417413 serine protease inhibitor 5 [Papilio xut 0.840 0.726 0.251 7e-19
218551711397 RecName: Full=Serpin B10 gi|190576556|gb 0.436 0.392 0.373 9e-19
218551708397 RecName: Full=Serpin B10 gi|196050404|gb 0.442 0.397 0.341 2e-18
229368692374 serine proteinase inhibitor, clade B, me 0.406 0.387 0.370 3e-18
395830701397 PREDICTED: serpin B10 [Otolemur garnetti 0.442 0.397 0.341 4e-18
344242554302 Serpin B13 [Cricetulus griseus] 0.795 0.940 0.264 5e-18
301613964392 PREDICTED: serpin B4-like [Xenopus (Silu 0.450 0.410 0.374 6e-18
344243138339 Serpin B9 [Cricetulus griseus] 0.725 0.764 0.264 7e-18
>gi|193688350|ref|XP_001946416.1| PREDICTED: plasminogen activator inhibitor 1-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  130 bits (326), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 73/188 (38%), Positives = 104/188 (55%), Gaps = 4/188 (2%)

Query: 127 SDGQTKDELTHFMGVATGRSLSNNPEAY---ASFLEKMRNEVYMYFILPK-NPDLSEFTK 182
           S  Q KD +   M V +   L +  E     A  L    N+   YF+LP  N  LS  T 
Sbjct: 331 SSKQNKDCIYVQMMVGSSEVLFHKNEGLEFKAIGLPYKGNQFITYFVLPDTNISLSSLTA 390

Query: 183 DLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDD 242
            ++      I  +    ++ Y +PKM + S T LR VL  + +  MFD SK+DLSNM  D
Sbjct: 391 KMNGKTIKNITRTAKITELTYFVPKMTLKSLTNLRPVLQNLGINKMFDPSKADLSNMASD 450

Query: 243 RGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFW 302
            G  +  + H+V+I+V E GTVA+A+T + ITR  +    IN+PFIFFI+H  +D++VFW
Sbjct: 451 PGSYISDILHQVEIDVNEIGTVASAATVVTITRGGQTIFNINKPFIFFIHHVESDTVVFW 510

Query: 303 GSIYKPEP 310
            ++YKP P
Sbjct: 511 STVYKPMP 518




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357615598|gb|EHJ69744.1| serine protease inhibitor 6 [Danaus plexippus] Back     alignment and taxonomy information
>gi|389608417|dbj|BAM17818.1| serine protease inhibitor 5 [Papilio xuthus] Back     alignment and taxonomy information
>gi|218551711|sp|B3RFC3.1|SPB10_SORAR RecName: Full=Serpin B10 gi|190576556|gb|ACE79048.1| MGC159890 protein (predicted) [Sorex araneus] Back     alignment and taxonomy information
>gi|218551708|sp|B4USX2.1|SPB10_OTOGA RecName: Full=Serpin B10 gi|196050404|gb|ACG64313.1| serine proteinase inhibitor, clade B, member 10 (predicted) [Otolemur garnettii] Back     alignment and taxonomy information
>gi|229368692|gb|ACQ62978.1| serine proteinase inhibitor, clade B, member 8 isoform a (predicted) [Dasypus novemcinctus] Back     alignment and taxonomy information
>gi|395830701|ref|XP_003788457.1| PREDICTED: serpin B10 [Otolemur garnettii] Back     alignment and taxonomy information
>gi|344242554|gb|EGV98657.1| Serpin B13 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|301613964|ref|XP_002936465.1| PREDICTED: serpin B4-like [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|344243138|gb|EGV99241.1| Serpin B9 [Cricetulus griseus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
MGI|MGI:2138648397 Serpinb10 "serine (or cysteine 0.422 0.380 0.343 5.1e-24
RGD|1309833375 Serpinb8 "serpin peptidase inh 0.403 0.384 0.370 6.1e-23
UNIPROTKB|A5PJK0397 SERPINB10 "Serpin B10" [Bos ta 0.445 0.400 0.321 6.8e-23
UNIPROTKB|F1P1L7401 F1P1L7 "Uncharacterized protei 0.417 0.371 0.320 7.9e-23
UNIPROTKB|F5GY69190 SERPINB11 "Serpin B11" [Homo s 0.369 0.694 0.350 1.8e-22
UNIPROTKB|E1BTF2408 SERPINB12 "Uncharacterized pro 0.296 0.259 0.390 3.3e-22
RGD|1562868387 Serpinb3a "serine (or cysteine 0.403 0.372 0.355 3.9e-22
MGI|MGI:894657374 Serpinb8 "serine (or cysteine) 0.406 0.387 0.350 1.1e-21
UNIPROTKB|F1MG91416 SERPINB2 "Uncharacterized prot 0.406 0.348 0.335 1.2e-21
UNIPROTKB|F1PH86421 SERPINA3 "Uncharacterized prot 0.305 0.258 0.405 1.9e-21
MGI|MGI:2138648 Serpinb10 "serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 10" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 242 (90.2 bits), Expect = 5.1e-24, Sum P(2) = 5.1e-24
 Identities = 54/157 (34%), Positives = 88/157 (56%)

Query:   158 LEKMRNEVYMYFILPKNPD-LSEFTKDLDYDKFSR--IIESTNKVDVIYTIPKMKVTSST 214
             L     ++ +  +LP+  D L +  + + Y+K  +    +  +  +V   +PK K+  S 
Sbjct:   241 LHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESY 300

Query:   215 ELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIIT 274
             +L++ L  M +T +F  SK+D SNM  +R + +  VFHK  +E+ E+GT AAA TG  I+
Sbjct:   301 DLKSALRGMGMTDVFSQSKADFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSEIS 360

Query:   275 -RISKPTVKIN--RPFIFFIYHKPTDSIVFWGSIYKP 308
              RI  P++++N   PF+FFI H  T SI+F G    P
Sbjct:   361 VRIKAPSIELNVDHPFLFFIRHNKTKSILFCGRFCSP 397


GO:0004867 "serine-type endopeptidase inhibitor activity" evidence=IBA
GO:0005575 "cellular_component" evidence=ND
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0010466 "negative regulation of peptidase activity" evidence=IEA
GO:0010951 "negative regulation of endopeptidase activity" evidence=IBA
GO:0030162 "regulation of proteolysis" evidence=IBA
GO:0030414 "peptidase inhibitor activity" evidence=ISO
GO:0045861 "negative regulation of proteolysis" evidence=ISO
RGD|1309833 Serpinb8 "serpin peptidase inhibitor, clade B (ovalbumin), member 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5PJK0 SERPINB10 "Serpin B10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1L7 F1P1L7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F5GY69 SERPINB11 "Serpin B11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BTF2 SERPINB12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1562868 Serpinb3a "serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:894657 Serpinb8 "serine (or cysteine) peptidase inhibitor, clade B, member 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG91 SERPINB2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PH86 SERPINA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
pfam00079369 pfam00079, Serpin, Serpin (serine protease inhibit 2e-40
cd00172364 cd00172, SERPIN, SERine Proteinase INhibitors (ser 3e-38
smart00093359 smart00093, SERPIN, SERine Proteinase INhibitors 5e-38
cd02059389 cd02059, ovalbumin_like, The ovalbumin_like group 7e-27
COG4826410 COG4826, COG4826, Serine protease inhibitor [Postt 3e-25
cd02058380 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 3e-24
cd02044370 cd02044, ov-serpin, ovalbumin family of serpins (o 5e-24
cd02051377 cd02051, PAI-1_nexin-1, Plasminogen activator inhi 7e-23
cd02049364 cd02049, bacterial_SERPIN, SERine Proteinase INhib 1e-22
cd02056361 cd02056, alpha-1-antitrypsin_like, alpha-1-antitry 2e-20
cd02048388 cd02048, neuroserpin, Neuroserpin is a inhibitory 7e-18
cd02057372 cd02057, maspin_like, Maspin (mammary serine prote 5e-17
cd02045381 cd02045, antithrombin-III_like, Antithrombin is a 1e-14
cd02055365 cd02055, PZI, Protein Z-dependent protease inhibit 2e-11
cd02043381 cd02043, plant_SERPIN, SERine Proteinase INhibitor 4e-11
cd02053351 cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) i 6e-10
cd02052374 cd02052, PEDF, Pigment epithelium-derived factor ( 9e-10
PHA02948373 PHA02948, PHA02948, serine protease inhibitor-like 2e-09
cd02047436 cd02047, HCII, Heparin cofactor II (HCII) inhibits 3e-09
cd02054372 cd02054, angiotensinogen, Angiotensinogen is part 3e-09
cd02050352 cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protea 2e-07
cd00172364 cd00172, SERPIN, SERine Proteinase INhibitors (ser 5e-07
pfam00079369 pfam00079, Serpin, Serpin (serine protease inhibit 6e-07
pfam00079369 pfam00079, Serpin, Serpin (serine protease inhibit 2e-06
cd00172364 cd00172, SERPIN, SERine Proteinase INhibitors (ser 3e-06
cd02046366 cd02046, hsp47, Heat shock protein 47 (Hsp47), als 7e-06
smart00093359 smart00093, SERPIN, SERine Proteinase INhibitors 5e-05
smart00093359 smart00093, SERPIN, SERine Proteinase INhibitors 5e-05
cd02048 388 cd02048, neuroserpin, Neuroserpin is a inhibitory 7e-05
cd02058380 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 1e-04
cd02058 380 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 1e-04
cd02048388 cd02048, neuroserpin, Neuroserpin is a inhibitory 1e-04
cd02059389 cd02059, ovalbumin_like, The ovalbumin_like group 4e-04
cd02059 389 cd02059, ovalbumin_like, The ovalbumin_like group 4e-04
cd02043 381 cd02043, plant_SERPIN, SERine Proteinase INhibitor 4e-04
cd02043381 cd02043, plant_SERPIN, SERine Proteinase INhibitor 5e-04
PHA02660364 PHA02660, PHA02660, serpin-like protein; Provision 0.001
>gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) Back     alignment and domain information
 Score =  145 bits (369), Expect = 2e-40
 Identities = 53/153 (34%), Positives = 77/153 (50%), Gaps = 7/153 (4%)

Query: 162 RNEVYMYFILP-KNPDLSEFTKDLDYDKFSRIIES--TNKVDVIYTIPKMKVTSSTELRT 218
           +  + M  ILP +   L E  K L  +     + S    KV     +PK K+ SS +L+ 
Sbjct: 218 KGNLSMLIILPDEGGGLEELEKSLTAELLEEWLSSLKPRKVREELYLPKFKIESSYDLKE 277

Query: 219 VLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISK 278
           VL  + +T  F  SK+D S +     + V +V HK  IEV E+GT AAA+TG++I   + 
Sbjct: 278 VLKKLGITDAFS-SKADFSGISSSEPLYVSKVVHKAFIEVNEEGTEAAAATGVVIVPRAP 336

Query: 279 ---PTVKINRPFIFFIYHKPTDSIVFWGSIYKP 308
              P    +RPF+F I    T SI+F G +  P
Sbjct: 337 PPPPEFVADRPFLFLIRDNSTGSILFMGRVVNP 369


Structure is a multi-domain fold containing a bundle of helices and a beta sandwich. Length = 369

>gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors Back     alignment and domain information
>gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>gnl|CDD|227163 COG4826, COG4826, Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>gnl|CDD|238999 cd02044, ov-serpin, ovalbumin family of serpins (ov-serpins) Back     alignment and domain information
>gnl|CDD|239006 cd02051, PAI-1_nexin-1, Plasminogen activator inhibitor-1_like Back     alignment and domain information
>gnl|CDD|239004 cd02049, bacterial_SERPIN, SERine Proteinase INhibitors (serpins), prokaryotic subgroup Back     alignment and domain information
>gnl|CDD|239011 cd02056, alpha-1-antitrypsin_like, alpha-1-antitrypsin_like Back     alignment and domain information
>gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>gnl|CDD|239012 cd02057, maspin_like, Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages Back     alignment and domain information
>gnl|CDD|239000 cd02045, antithrombin-III_like, Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation Back     alignment and domain information
>gnl|CDD|239010 cd02055, PZI, Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) Back     alignment and domain information
>gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information
>gnl|CDD|239008 cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots Back     alignment and domain information
>gnl|CDD|239007 cd02052, PEDF, Pigment epithelium-derived factor (PEDF)_like Back     alignment and domain information
>gnl|CDD|165258 PHA02948, PHA02948, serine protease inhibitor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|239002 cd02047, HCII, Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade Back     alignment and domain information
>gnl|CDD|239009 cd02054, angiotensinogen, Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis Back     alignment and domain information
>gnl|CDD|239005 cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family Back     alignment and domain information
>gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) Back     alignment and domain information
>gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) Back     alignment and domain information
>gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>gnl|CDD|239001 cd02046, hsp47, Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen Back     alignment and domain information
>gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors Back     alignment and domain information
>gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors Back     alignment and domain information
>gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information
>gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information
>gnl|CDD|165039 PHA02660, PHA02660, serpin-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 357
cd02044370 ov-serpin ovalbumin family of serpins (ov-serpins) 100.0
cd02057372 maspin_like Maspin (mammary serine proteinase inhi 100.0
cd02048388 neuroserpin Neuroserpin is a inhibitory member of 100.0
cd02054372 angiotensinogen Angiotensinogen is part of the ren 100.0
COG4826410 Serine protease inhibitor [Posttranslational modif 100.0
cd02051377 PAI-1_nexin-1 Plasminogen activator inhibitor-1_li 100.0
KOG2392|consensus380 100.0
cd02059389 ovalbumin_like The ovalbumin_like group of serpins 100.0
cd02058380 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2). P 100.0
cd02046366 hsp47 Heat shock protein 47 (Hsp47), also called c 100.0
cd02047436 HCII Heparin cofactor II (HCII) inhibits thrombin, 100.0
cd02045381 antithrombin-III_like Antithrombin is a serine pro 100.0
cd02052374 PEDF Pigment epithelium-derived factor (PEDF)_like 100.0
PHA02948373 serine protease inhibitor-like protein; Provisiona 100.0
cd02056361 alpha-1-antitrypsin_like alpha-1-antitrypsin_like. 100.0
PF00079371 Serpin: Serpin (serine protease inhibitor); InterP 100.0
cd00172364 SERPIN SERine Proteinase INhibitors (serpins) exhi 100.0
smart00093359 SERPIN SERine Proteinase INhibitors. 100.0
cd02049364 bacterial_SERPIN SERine Proteinase INhibitors (ser 100.0
cd02055365 PZI Protein Z-dependent protease inhibitor (ZPI) i 100.0
cd02053351 alpha2AP Alpha2-antiplasmin (alpha2AP) is the prim 100.0
cd02050352 C1_inh C1 inhibitor (C1-Inh) is a protease inhibit 100.0
cd02043381 plant_SERPIN SERine Proteinase INhibitors (serpins 100.0
PHA02660364 serpin-like protein; Provisional 100.0
>cd02044 ov-serpin ovalbumin family of serpins (ov-serpins) Back     alignment and domain information
Probab=100.00  E-value=3.2e-59  Score=457.68  Aligned_cols=294  Identities=24%  Similarity=0.454  Sum_probs=261.1

Q ss_pred             HHhhHHHHHHHHHHHhccCCCCCEEEchhhHHHHHHHHHcCCCchhHHHHHHhhCCCch-------hhHHhhc---c-cc
Q psy5102          14 RGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATG-------RSLSNKL---T-AH   82 (357)
Q Consensus        14 ~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~eL~~~Lg~~~~-------~~ll~~l---~-~~   82 (357)
                      .++++||++||+++... .+++|+|+||+||+.+|+|++.||+|+|++||.++||++..       +++++.+   + +.
T Consensus         3 ~~~~~F~~~l~~~~~~~-~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~el~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (370)
T cd02044           3 LANSAFAVDVFKELSKK-SALQNVFFSPIAIMSSLAMVYLGAKGSTANQIGKVLHFDNVKDVHSSFQTLLSDINKLNSFY   81 (370)
T ss_pred             chhhHHHHHHHHHHhhc-CCCCcEEECHHHHHHHHHHHhhhcCCcHHHHHHHHhCCCCHHHHHHHHHHHHHHHhcCCCCc
Confidence            46789999999999876 67899999999999999999999999999999999999762       3444444   2 44


Q ss_pred             eeeee---eccc---------------------cCCH----HHH---HHHHH---hCCC-cccCCCCCCCccceeEeecc
Q psy5102          83 SLRRG---ITQM---------------------TLDM----ERA---IRSVM---TKNQ-NVVFAPLSIVGALALVLLGS  127 (357)
Q Consensus        83 ~l~~a---f~~~---------------------~~dF----~~a---IN~wv---T~g~-~~~l~~~~l~~~t~lvLvna  127 (357)
                      .++.+   |+++                     .+||    +.+   ||+||   |+|+ ++++++.+++++++++|+||
T Consensus        82 ~l~~a~~~~~~~~~~l~~~f~~~~~~~~~~~~~~vdF~~~~~~a~~~IN~wv~~~T~g~I~~lv~~~~l~~~t~lvlvna  161 (370)
T cd02044          82 SLKLVNRLYGEKRYNFLPEFLSSTKKPYAKELETVDFKDKAEETRGQINSWIKDQTKGKIENLLPENSVDSQTAMVVVNA  161 (370)
T ss_pred             eEeeeeehhhcCCCcccHHHHHHHHHhhccceEeccccCCHHHHHHHHHHHHHHhcCCchhhcCCCCCCCcchhheeeee
Confidence            56655   5554                     5788    233   99999   9999 99999888999999999999


Q ss_pred             -------cCCCCCCCceeeeeeec--------------c-cccccCCCCeEEEe--ecCCeEEEEEEec-CCCChhHHhh
Q psy5102         128 -------DGQTKDELTHFMGVATG--------------R-SLSNNPEAYASFLE--KMRNEVYMYFILP-KNPDLSEFTK  182 (357)
Q Consensus       128 -------~~~F~~~~T~~~~F~~~--------------~-~~~~~~~~~~~vve--y~~~~~sm~iiLP-~~~~L~~l~~  182 (357)
                             ++||++..|..++||..              . +|++.+++++++|+  |++++++|+|||| +..+|.++++
T Consensus       162 i~Fkg~W~~~F~~~~T~~~~F~~~~~~~~~V~mM~~~~~~~~~~~~~~~~~vv~LPy~~~~~sm~iiLP~~~~~l~~l~~  241 (370)
T cd02044         162 AYFKGKWMKKFSEEETKESPFRVNKTETKPVQMMYMEATFNMGNIESLKMKILELPFANKDLSMFILLPDEVTGLEKLES  241 (370)
T ss_pred             eeEcccccCCCChhhCccCcCCcCCCcEEEeeCccccCceeeEEcCCCCeEEEEcccCCCceEEEEEcCCCCCcHHHHHH
Confidence                   89999999999999975              2 56677889999999  9988999999999 8899999999


Q ss_pred             ccChhHHHHHHH--hcCceeEEEEeceeeEeeccchHHHhhhCCccccCCCCCCCCCCCCCCCCceeeeeeEEEEEEEcc
Q psy5102         183 DLDYDKFSRIIE--STNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTE  260 (357)
Q Consensus       183 ~L~~~~l~~~~~--~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGl~~~F~~~~adfs~is~~~~l~vs~v~qk~~iev~E  260 (357)
                      .|+.+.+..|..  +++.+.|+|+||||++++++||+++|++||++.+|++..|||++|+++.+++|++|+|++.|+|||
T Consensus       242 ~l~~~~l~~~~~~~~~~~~~v~l~lPkF~i~~~~~l~~~L~~mGl~~~F~~~~Adfs~ms~~~~l~vs~v~qka~ievdE  321 (370)
T cd02044         242 EINYEKLNKWTSPSTMAEAKVKVYLPRFKMEKMYDLKSVLESLGMKDAFSEGRANFSGMSETKGLALSNVIHKASLEINE  321 (370)
T ss_pred             HhCHHHHHHhhccccceeeEEEEEeeEEEEeeEEccHHHHHHcCchhhCCCCCCChhhcCCCCCeeEeeeeEeeEEEECC
Confidence            999999999974  677889999999999999999999999999999999756999999976689999999999999999


Q ss_pred             Cccccccccceeee-ecCCCEEEEcCceEEEEEECCCCcEEEEEEEcCC
Q psy5102         261 QGTVAAASTGIIIT-RISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKP  308 (357)
Q Consensus       261 ~G~~aaa~t~~~~~-~s~~~~f~~nrPFlf~I~d~~t~~iLF~G~v~~P  308 (357)
                      +|++|+|+|...+. ++.+.+|++||||+|+|+|+.||.|||+|+|.+|
T Consensus       322 ~Gt~aaa~t~~~~~~~~~~~~f~~drPF~f~I~~~~t~~iLF~G~v~~P  370 (370)
T cd02044         322 DGTEAAEVTGAVMLQRSVKEEFNADHPFLFIIRHNKTNCILFFGKFSSP  370 (370)
T ss_pred             CccccccccceeeeccCCCCeEEeeCCEEEEEEECCCCeEEEEEEecCC
Confidence            99999999987555 5556789999999999999999999999999998



Family of closely related proteins, whose members can be secreted (ovalbumin), cytosolic (leukocyte elastase inhibitor, LEI), or targeted to both compartments (plasminogen activator inhibitor 2, PAI-2). This subgroup corresponds to clade B of the serpin superfamily. In general, serpins exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Serpins are of medical interest because mutants can cause blood clotting disorders, emphysema, cirrhosis, and dementia.

>cd02057 maspin_like Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages Back     alignment and domain information
>cd02048 neuroserpin Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) Back     alignment and domain information
>cd02054 angiotensinogen Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis Back     alignment and domain information
>COG4826 Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02051 PAI-1_nexin-1 Plasminogen activator inhibitor-1_like Back     alignment and domain information
>KOG2392|consensus Back     alignment and domain information
>cd02059 ovalbumin_like The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily Back     alignment and domain information
>cd02058 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2) Back     alignment and domain information
>cd02046 hsp47 Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen Back     alignment and domain information
>cd02047 HCII Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade Back     alignment and domain information
>cd02045 antithrombin-III_like Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation Back     alignment and domain information
>cd02052 PEDF Pigment epithelium-derived factor (PEDF)_like Back     alignment and domain information
>PHA02948 serine protease inhibitor-like protein; Provisional Back     alignment and domain information
>cd02056 alpha-1-antitrypsin_like alpha-1-antitrypsin_like Back     alignment and domain information
>PF00079 Serpin: Serpin (serine protease inhibitor); InterPro: IPR023796 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively Back     alignment and domain information
>cd00172 SERPIN SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms Back     alignment and domain information
>smart00093 SERPIN SERine Proteinase INhibitors Back     alignment and domain information
>cd02049 bacterial_SERPIN SERine Proteinase INhibitors (serpins), prokaryotic subgroup Back     alignment and domain information
>cd02055 PZI Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) Back     alignment and domain information
>cd02053 alpha2AP Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots Back     alignment and domain information
>cd02050 C1_inh C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family Back     alignment and domain information
>cd02043 plant_SERPIN SERine Proteinase INhibitors (serpins), plant specific subgroup Back     alignment and domain information
>PHA02660 serpin-like protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
4dy0_A379 Crystal Structure Of Native Protease Nexin-1 With H 2e-16
1c5g_A402 Plasminogen Activator Inhibitor-1 Length = 402 6e-16
4aqh_A383 Plasminogen Activator Inhibitor Type-1 In Complex W 8e-16
3q02_A379 Crystal Structure Of Plasminogen Activator Inhibito 8e-16
3lw2_A379 Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Len 8e-16
1dvn_A379 Latent Form Of Plasminogen Activator Inhibitor-1 (P 9e-16
3nda_A377 Crystal Structure Of Serpin From Tick Ixodes Ricinu 2e-15
1dvm_A379 Active Form Of Human Pai-1 Length = 379 3e-15
3cvm_A392 High Resolution Structure Of A Stable Plasminogen A 3e-15
3eox_A379 High Quality Structure Of Cleaved Pai-1-Stab Length 3e-15
1by7_A382 Human Plasminogen Activator Inhibitor-2. Loop (66-9 3e-15
2arq_A382 Human Plasminogen Activator Inhibitor-2.[loop (66-9 3e-15
3ut3_A375 A Novel Pai-i Inhibitor And Its Structural Mechanis 3e-15
1db2_A377 Crystal Structure Of Native Plasminogen Activator I 3e-15
1b3k_A379 Plasminogen Activator Inhibitor-1 Length = 379 4e-15
1a7c_A379 Human Plasminogen Activator Inhibitor Type-1 In Com 4e-15
3r4l_A379 Human Very Long Half Life Plasminogen Activator Inh 7e-15
4if8_A414 Structure Of Vaspin Length = 414 9e-15
1oo8_A394 Crystal Structure Of A1pi-Pittsburgh In The Native 7e-14
3t1p_A371 Crystal Structure Of An Alpha-1-Antitrypsin Trimer 1e-13
2dut_A423 Crystal Structure Of A M-Loop Deletion Variant Of M 1e-13
2b4x_I427 Crystal Structure Of Antithrombin-Iii Length = 427 2e-13
3kcg_I432 Crystal Structure Of The Antithrombin-Factor Ixa- P 2e-13
2b4x_L427 Crystal Structure Of Antithrombin-Iii Length = 427 2e-13
1ath_A432 The Intact And Cleaved Human Antithrombin Iii Compl 2e-13
2h4r_A415 Crystal Structure Of Wildtype Ment In The Native Co 2e-13
4eb1_I440 Hyperstable In-Frame Insertion Variant Of Antithrom 2e-13
1dzg_I432 N135q-S380c-Antithrombin-Iii Length = 432 2e-13
1atu_A374 Uncleaved Alpha-1-Antitrypsin Length = 374 2e-13
3ne4_A424 1.8 Angstrom Structure Of Intact Native Wild-Type A 3e-13
2hij_I432 Crystal Structure Of P14 Alanine Variant Of Antithr 3e-13
1kct_A394 Alpha1-Antitrypsin Length = 394 3e-13
1psi_A394 Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 3e-13
3drm_A404 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- 3e-13
1qlp_A394 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsi 3e-13
1dzh_I432 P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length 3e-13
3dru_A404 Crystal Structure Of Gly117phe Alpha1-Antitrypsin L 3e-13
2qug_A394 Crystal Structure Of Alpha-1-Antitrypsin, Crystal F 3e-13
1hp7_A394 A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-An 4e-13
2hi9_A363 Crystal Structure Of Human Native Protein C Inhibit 5e-13
2ol2_A395 High Resolution Structure Of Native Pci In Space Gr 7e-13
2gd4_I443 Crystal Structure Of The Antithrombin-S195a Factor 8e-13
1tb6_I432 2.5a Crystal Structure Of The Antithrombin-Thrombin 9e-13
1iz2_A394 Interactions Causing The Kinetic Trap In Serpin Pro 1e-12
1xu8_A380 The 2.8 A Structure Of A Tumour Suppressing Serpin 2e-12
1wz9_A375 The 2.1 A Structure Of A Tumour Suppressing Serpin 3e-12
1xqg_A389 3.10 A Crystal Structure Of Maspin, Space Group P 4 5e-12
3f5n_A407 Structure Of Native Human Neuroserpin Length = 407 6e-12
3fgq_A397 Crystal Structure Of Native Human Neuroserpin Lengt 6e-12
1qmn_A401 Alpha1-Antichymotrypsin Serpin In The Delta Conform 4e-11
2pee_A387 Crystal Structure Of A Thermophilic Serpin, Tengpin 1e-10
2pef_A373 Crystal Structure Of A Thermophilic Serpin, Tengpin 1e-10
2vh4_A381 Structure Of A Loop C-sheet Serpin Polymer Length = 1e-10
1att_A429 Crystal Structure Of Cleaved Bovine Antithrombin Ii 2e-10
3vvj_A392 Structure Of Ovalbumin From Emu (Dromaius Novaeholl 3e-10
3dlw_A411 Antichymotrypsin Length = 411 3e-10
4ajt_A427 The Cystal Structure Of Mouse Protein-Z Dependent P 1e-09
3pzf_A397 1.75a Resolution Structure Of Serpin-2 From Anophel 2e-09
2r9y_A430 Structure Of Antiplasmin Length = 430 5e-09
2vdx_A373 Crystal Structure Of The Reactive Loop Cleaved Cort 5e-09
2h4p_A394 Crystal Structure Of Wildtype Ment In The Cleaved C 1e-08
1jti_A385 Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin 1e-08
1oyh_I432 Crystal Structure Of P13 Alanine Variant Of Antithr 1e-08
1lq8_A346 Crystal Structure Of Cleaved Protein C Inhibitor Le 2e-08
3dy0_A336 Crystal Structure Of Cleaved Pci Bound To Heparin L 2e-08
3f1s_A385 Crystal Structure Of Protein Z Complexed With Prote 3e-08
3h5c_A423 X-Ray Structure Of Protein Z-Protein Z Inhibitor Co 4e-08
1ova_C386 Crystal Structure Of Uncleaved Ovalbumin At 1.95 An 4e-08
2h4q_A382 Crystal Structure Of A M-Loop Deletion Variant Of M 4e-08
2ceo_A379 Thyroxine-Binding Globulin Complex With Thyroxine L 6e-08
1ova_A386 Crystal Structure Of Uncleaved Ovalbumin At 1.95 An 7e-08
1ova_B386 Crystal Structure Of Uncleaved Ovalbumin At 1.95 An 7e-08
1imv_A398 2.85 A Crystal Structure Of Pedf Length = 398 7e-08
1uhg_A385 Crystal Structure Of S-ovalbumin At 1.9 Angstrom Re 9e-08
9pai_A346 Cleaved Substrate Variant Of Plasminogen Activator 2e-07
4ga7_A389 Crystal Structure Of Human Serpinb1 Mutant Length = 4e-07
1d5s_A334 Crystal Structure Of Cleaved Antitrypsin Polymer Le 5e-07
1ezx_A335 Crystal Structure Of A Serpin:protease Complex Leng 5e-07
7api_A347 The S Variant Of Human Alpha1-Antitrypsin, Structur 6e-07
2d26_A358 Active Site Distortion Is Sufficient For Proteinase 6e-07
3ndf_A343 Cleaved Antitrypsin With P8-P6 Asp Length = 343 6e-07
2zv6_A401 Crystal Structure Of Human Squamous Cell Carcinoma 8e-07
1jmo_A480 Crystal Structure Of The Heparin Cofactor Ii-S195a 9e-07
1jmj_A480 Crystal Structure Of Native Heparin Cofactor Ii Len 1e-06
3ndd_A343 Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Len 1e-06
2ach_A360 Crystal Structure Of Cleaved Human Alpha1-antichymo 1e-06
3le2_A393 Structure Of Arabidopsis Atserpin1. Native Stressed 2e-06
1qmb_A326 Cleaved Alpha-1-Antitrypsin Polymer Length = 326 3e-06
1c8o_A300 2.9 A Structure Of Cleaved Viral Serpin Crma Length 6e-06
1m93_B245 1.65 A Structure Of Cleaved Viral Serpin Crma Lengt 6e-06
4caa_A341 Cleaved Antichymotrypsin T345r Length = 341 7e-06
1jjo_C261 Crystal Structure Of Mouse Neuroserpin (Cleaved For 7e-06
3caa_A341 Cleaved Antichymotrypsin A347r Length = 341 8e-06
1as4_A341 Cleaved Antichymotrypsin A349r Length = 341 8e-06
2v95_A371 Struture Of Corticosteroid-Binding Globulin In Comp 2e-05
4bb2_A340 Crystal Structure Of Cleaved Corticosteroid-binding 2e-05
3f02_A359 Cleaved Human Neuroserpin Length = 359 3e-05
1k9o_I378 Crystal Structure Of Michaelis Serpin-Trypsin Compl 3e-05
1sek_A378 The Structure Of Active Serpin K From Manduca Sexta 3e-05
1f0c_A305 Structure Of The Viral Serpin Crma Length = 305 1e-04
2oay_A390 Crystal Structure Of Latent Human C1-Inhibitor Leng 2e-04
>pdb|4DY0|A Chain A, Crystal Structure Of Native Protease Nexin-1 With Heparin Length = 379 Back     alignment and structure

Iteration: 1

Score = 83.6 bits (205), Expect = 2e-16, Method: Compositional matrix adjust. Identities = 45/113 (39%), Positives = 67/113 (59%), Gaps = 4/113 (3%) Query: 198 KVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNML-DDRGVAVDQVFHKVDI 256 +V VI +PK + T+L+ L + +T MFD SK++ + + + V + K I Sbjct: 269 RVQVI--LPKFTAVAQTDLKEPLKVLGITDMFDSSKANFAKITTGSENLHVSHILQKAKI 326 Query: 257 EVTEQGTVA-AASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKP 308 EV+E GT A AA+T I+I R S P ++RPF+FFI H PT +++F G I KP Sbjct: 327 EVSEDGTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLFMGQINKP 379
>pdb|1C5G|A Chain A, Plasminogen Activator Inhibitor-1 Length = 402 Back     alignment and structure
>pdb|4AQH|A Chain A, Plasminogen Activator Inhibitor Type-1 In Complex With The Inhibitor Az3976 Length = 383 Back     alignment and structure
>pdb|3Q02|A Chain A, Crystal Structure Of Plasminogen Activator Inhibitor-1 In A Metastable Active Conformation. Length = 379 Back     alignment and structure
>pdb|3LW2|A Chain A, Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 Back     alignment and structure
>pdb|1DVN|A Chain A, Latent Form Of Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 Back     alignment and structure
>pdb|3NDA|A Chain A, Crystal Structure Of Serpin From Tick Ixodes Ricinus Length = 377 Back     alignment and structure
>pdb|1DVM|A Chain A, Active Form Of Human Pai-1 Length = 379 Back     alignment and structure
>pdb|3CVM|A Chain A, High Resolution Structure Of A Stable Plasminogen Activator Inhibitor Type-1 In Its Protease Cleaved Form Length = 392 Back     alignment and structure
>pdb|3EOX|A Chain A, High Quality Structure Of Cleaved Pai-1-Stab Length = 379 Back     alignment and structure
>pdb|1BY7|A Chain A, Human Plasminogen Activator Inhibitor-2. Loop (66-98) Deletion Mutant Length = 382 Back     alignment and structure
>pdb|2ARQ|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98) Deletion Mutant] Complexed With Peptide N-Acetyl-Teaaagdggvmtgr-Oh Length = 382 Back     alignment and structure
>pdb|3UT3|A Chain A, A Novel Pai-i Inhibitor And Its Structural Mechanism Length = 375 Back     alignment and structure
>pdb|1DB2|A Chain A, Crystal Structure Of Native Plasminogen Activator Inhibitor- 1 Length = 377 Back     alignment and structure
>pdb|1B3K|A Chain A, Plasminogen Activator Inhibitor-1 Length = 379 Back     alignment and structure
>pdb|1A7C|A Chain A, Human Plasminogen Activator Inhibitor Type-1 In Complex With A Pentapeptide Length = 379 Back     alignment and structure
>pdb|3R4L|A Chain A, Human Very Long Half Life Plasminogen Activator Inhibitor Type-1 Length = 379 Back     alignment and structure
>pdb|4IF8|A Chain A, Structure Of Vaspin Length = 414 Back     alignment and structure
>pdb|1OO8|A Chain A, Crystal Structure Of A1pi-Pittsburgh In The Native Conformation Length = 394 Back     alignment and structure
>pdb|3T1P|A Chain A, Crystal Structure Of An Alpha-1-Antitrypsin Trimer Length = 371 Back     alignment and structure
>pdb|2DUT|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Native Conformation Length = 423 Back     alignment and structure
>pdb|2B4X|I Chain I, Crystal Structure Of Antithrombin-Iii Length = 427 Back     alignment and structure
>pdb|3KCG|I Chain I, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 432 Back     alignment and structure
>pdb|2B4X|L Chain L, Crystal Structure Of Antithrombin-Iii Length = 427 Back     alignment and structure
>pdb|1ATH|A Chain A, The Intact And Cleaved Human Antithrombin Iii Complex As A Model For Serpin-Proteinase Interactions Length = 432 Back     alignment and structure
>pdb|2H4R|A Chain A, Crystal Structure Of Wildtype Ment In The Native Conformation Length = 415 Back     alignment and structure
>pdb|4EB1|I Chain I, Hyperstable In-Frame Insertion Variant Of Antithrombin Length = 440 Back     alignment and structure
>pdb|1DZG|I Chain I, N135q-S380c-Antithrombin-Iii Length = 432 Back     alignment and structure
>pdb|1ATU|A Chain A, Uncleaved Alpha-1-Antitrypsin Length = 374 Back     alignment and structure
>pdb|3NE4|A Chain A, 1.8 Angstrom Structure Of Intact Native Wild-Type Alpha-1-Antitrypsin Length = 424 Back     alignment and structure
>pdb|2HIJ|I Chain I, Crystal Structure Of P14 Alanine Variant Of Antithrombin Length = 432 Back     alignment and structure
>pdb|1KCT|A Chain A, Alpha1-Antitrypsin Length = 394 Back     alignment and structure
>pdb|1PSI|A Chain A, Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 To Leu Length = 394 Back     alignment and structure
>pdb|3DRM|A Chain A, 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- Antitrypsin Length = 404 Back     alignment and structure
>pdb|1QLP|A Chain A, 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsin: A Canonical Template For Active Serpins Length = 394 Back     alignment and structure
>pdb|1DZH|I Chain I, P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length = 432 Back     alignment and structure
>pdb|3DRU|A Chain A, Crystal Structure Of Gly117phe Alpha1-Antitrypsin Length = 404 Back     alignment and structure
>pdb|2QUG|A Chain A, Crystal Structure Of Alpha-1-Antitrypsin, Crystal Form A Length = 394 Back     alignment and structure
>pdb|1HP7|A Chain A, A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-Antitrypsin Shows Variability Of The Reactive Center And Other Loops Length = 394 Back     alignment and structure
>pdb|2HI9|A Chain A, Crystal Structure Of Human Native Protein C Inhibitor Length = 363 Back     alignment and structure
>pdb|2OL2|A Chain A, High Resolution Structure Of Native Pci In Space Group P21 Length = 395 Back     alignment and structure
>pdb|2GD4|I Chain I, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 443 Back     alignment and structure
>pdb|1TB6|I Chain I, 2.5a Crystal Structure Of The Antithrombin-Thrombin-Heparin Ternary Complex Length = 432 Back     alignment and structure
>pdb|1IZ2|A Chain A, Interactions Causing The Kinetic Trap In Serpin Protein Folding Length = 394 Back     alignment and structure
>pdb|1XU8|A Chain A, The 2.8 A Structure Of A Tumour Suppressing Serpin Length = 380 Back     alignment and structure
>pdb|1WZ9|A Chain A, The 2.1 A Structure Of A Tumour Suppressing Serpin Length = 375 Back     alignment and structure
>pdb|1XQG|A Chain A, 3.10 A Crystal Structure Of Maspin, Space Group P 4 21 2 Length = 389 Back     alignment and structure
>pdb|3F5N|A Chain A, Structure Of Native Human Neuroserpin Length = 407 Back     alignment and structure
>pdb|3FGQ|A Chain A, Crystal Structure Of Native Human Neuroserpin Length = 397 Back     alignment and structure
>pdb|1QMN|A Chain A, Alpha1-Antichymotrypsin Serpin In The Delta Conformation (Partial Loop Insertion) Length = 401 Back     alignment and structure
>pdb|2PEE|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Native State Length = 387 Back     alignment and structure
>pdb|2PEF|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Latent State Length = 373 Back     alignment and structure
>pdb|2VH4|A Chain A, Structure Of A Loop C-sheet Serpin Polymer Length = 381 Back     alignment and structure
>pdb|1ATT|A Chain A, Crystal Structure Of Cleaved Bovine Antithrombin Iii At 3.2 Angstroms Resolution Length = 429 Back     alignment and structure
>pdb|3VVJ|A Chain A, Structure Of Ovalbumin From Emu (Dromaius Novaehollandiae) Length = 392 Back     alignment and structure
>pdb|3DLW|A Chain A, Antichymotrypsin Length = 411 Back     alignment and structure
>pdb|4AJT|A Chain A, The Cystal Structure Of Mouse Protein-Z Dependent Protease Inhibitor(Mzpi) Length = 427 Back     alignment and structure
>pdb|3PZF|A Chain A, 1.75a Resolution Structure Of Serpin-2 From Anopheles Gambiae Length = 397 Back     alignment and structure
>pdb|2R9Y|A Chain A, Structure Of Antiplasmin Length = 430 Back     alignment and structure
>pdb|2VDX|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Corticosteroid Binding Globulin Length = 373 Back     alignment and structure
>pdb|2H4P|A Chain A, Crystal Structure Of Wildtype Ment In The Cleaved Conformation Length = 394 Back     alignment and structure
>pdb|1JTI|A Chain A, Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin Mutant R339t Length = 385 Back     alignment and structure
>pdb|1OYH|I Chain I, Crystal Structure Of P13 Alanine Variant Of Antithrombin Length = 432 Back     alignment and structure
>pdb|1LQ8|A Chain A, Crystal Structure Of Cleaved Protein C Inhibitor Length = 346 Back     alignment and structure
>pdb|3DY0|A Chain A, Crystal Structure Of Cleaved Pci Bound To Heparin Length = 336 Back     alignment and structure
>pdb|3F1S|A Chain A, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 385 Back     alignment and structure
>pdb|3H5C|A Chain A, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 423 Back     alignment and structure
>pdb|1OVA|C Chain C, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 Back     alignment and structure
>pdb|2H4Q|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Cleaved Conformation Length = 382 Back     alignment and structure
>pdb|2CEO|A Chain A, Thyroxine-Binding Globulin Complex With Thyroxine Length = 379 Back     alignment and structure
>pdb|1OVA|A Chain A, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 Back     alignment and structure
>pdb|1OVA|B Chain B, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 Back     alignment and structure
>pdb|1IMV|A Chain A, 2.85 A Crystal Structure Of Pedf Length = 398 Back     alignment and structure
>pdb|1UHG|A Chain A, Crystal Structure Of S-ovalbumin At 1.9 Angstrom Resolution Length = 385 Back     alignment and structure
>pdb|9PAI|A Chain A, Cleaved Substrate Variant Of Plasminogen Activator Inhibitor-1 Length = 346 Back     alignment and structure
>pdb|4GA7|A Chain A, Crystal Structure Of Human Serpinb1 Mutant Length = 389 Back     alignment and structure
>pdb|1D5S|A Chain A, Crystal Structure Of Cleaved Antitrypsin Polymer Length = 334 Back     alignment and structure
>pdb|1EZX|A Chain A, Crystal Structure Of A Serpin:protease Complex Length = 335 Back     alignment and structure
>pdb|7API|A Chain A, The S Variant Of Human Alpha1-Antitrypsin, Structure And Implications For Function And Metabolism Length = 347 Back     alignment and structure
>pdb|2D26|A Chain A, Active Site Distortion Is Sufficient For Proteinase Inhibit Second Crystal Structure Of Covalent Serpin-Proteinase Complex Length = 358 Back     alignment and structure
>pdb|3NDF|A Chain A, Cleaved Antitrypsin With P8-P6 Asp Length = 343 Back     alignment and structure
>pdb|2ZV6|A Chain A, Crystal Structure Of Human Squamous Cell Carcinoma Antigen 1 Length = 401 Back     alignment and structure
>pdb|1JMO|A Chain A, Crystal Structure Of The Heparin Cofactor Ii-S195a Thrombin Complex Length = 480 Back     alignment and structure
>pdb|1JMJ|A Chain A, Crystal Structure Of Native Heparin Cofactor Ii Length = 480 Back     alignment and structure
>pdb|3NDD|A Chain A, Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Length = 343 Back     alignment and structure
>pdb|2ACH|A Chain A, Crystal Structure Of Cleaved Human Alpha1-antichymotrypsin At 2.7 Angstroms Resolution And Its Comparison With Other Serpins Length = 360 Back     alignment and structure
>pdb|3LE2|A Chain A, Structure Of Arabidopsis Atserpin1. Native Stressed Conforma Length = 393 Back     alignment and structure
>pdb|1QMB|A Chain A, Cleaved Alpha-1-Antitrypsin Polymer Length = 326 Back     alignment and structure
>pdb|1C8O|A Chain A, 2.9 A Structure Of Cleaved Viral Serpin Crma Length = 300 Back     alignment and structure
>pdb|1M93|B Chain B, 1.65 A Structure Of Cleaved Viral Serpin Crma Length = 245 Back     alignment and structure
>pdb|4CAA|A Chain A, Cleaved Antichymotrypsin T345r Length = 341 Back     alignment and structure
>pdb|1JJO|C Chain C, Crystal Structure Of Mouse Neuroserpin (Cleaved Form) Length = 261 Back     alignment and structure
>pdb|3CAA|A Chain A, Cleaved Antichymotrypsin A347r Length = 341 Back     alignment and structure
>pdb|1AS4|A Chain A, Cleaved Antichymotrypsin A349r Length = 341 Back     alignment and structure
>pdb|2V95|A Chain A, Struture Of Corticosteroid-Binding Globulin In Complex With Cortisol Length = 371 Back     alignment and structure
>pdb|4BB2|A Chain A, Crystal Structure Of Cleaved Corticosteroid-binding Globulin In Complex With Progesterone Length = 340 Back     alignment and structure
>pdb|3F02|A Chain A, Cleaved Human Neuroserpin Length = 359 Back     alignment and structure
>pdb|1K9O|I Chain I, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 378 Back     alignment and structure
>pdb|1SEK|A Chain A, The Structure Of Active Serpin K From Manduca Sexta And A Model For Serpin-Protease Complex Formation Length = 378 Back     alignment and structure
>pdb|1F0C|A Chain A, Structure Of The Viral Serpin Crma Length = 305 Back     alignment and structure
>pdb|2OAY|A Chain A, Crystal Structure Of Latent Human C1-Inhibitor Length = 390 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
4au2_A392 HSP47, serpin peptidase inhibitor, clade H (heat s 9e-46
4au2_A 392 HSP47, serpin peptidase inhibitor, clade H (heat s 8e-07
4au2_A392 HSP47, serpin peptidase inhibitor, clade H (heat s 3e-05
1lj5_A379 Plasminogen activator inhibitor-1; beta-barrell, b 3e-44
1lj5_A379 Plasminogen activator inhibitor-1; beta-barrell, b 1e-06
1lj5_A379 Plasminogen activator inhibitor-1; beta-barrell, b 2e-05
2vdx_A373 Corticosteroid-binding globulin; transport protein 5e-44
2vdx_A373 Corticosteroid-binding globulin; transport protein 4e-07
2vdx_A373 Corticosteroid-binding globulin; transport protein 7e-06
3ne4_A424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 5e-44
3ne4_A424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 1e-06
3ne4_A424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 2e-05
4dy0_A379 GLIA-derived nexin; serpin, protease inhibitor, th 3e-43
4dy0_A 379 GLIA-derived nexin; serpin, protease inhibitor, th 4e-07
4dy0_A379 GLIA-derived nexin; serpin, protease inhibitor, th 3e-06
3f5n_A407 Neuroserpin; cleaved form, fenib, human, tissue PL 9e-43
3f5n_A 407 Neuroserpin; cleaved form, fenib, human, tissue PL 3e-07
3f5n_A407 Neuroserpin; cleaved form, fenib, human, tissue PL 3e-06
1yxa_A398 Serine (OR cysteine) proteinase inhibitor, clade 3 9e-43
1yxa_A398 Serine (OR cysteine) proteinase inhibitor, clade 3 1e-06
1yxa_A398 Serine (OR cysteine) proteinase inhibitor, clade 3 2e-05
2ceo_A379 Thyroxine-binding globulin; transport, serpin, hor 1e-42
2ceo_A379 Thyroxine-binding globulin; transport, serpin, hor 4e-07
2ceo_A379 Thyroxine-binding globulin; transport, serpin, hor 7e-06
2pef_A373 Serine protease inhibitor; serpin; 1.60A {Thermoan 1e-42
2pef_A373 Serine protease inhibitor; serpin; 1.60A {Thermoan 1e-06
2pef_A373 Serine protease inhibitor; serpin; 1.60A {Thermoan 3e-06
3kcg_I432 Antithrombin-III, ATIII; michaelis complex, blood 2e-42
3kcg_I 432 Antithrombin-III, ATIII; michaelis complex, blood 8e-09
3kcg_I432 Antithrombin-III, ATIII; michaelis complex, blood 1e-07
2r9y_A430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 2e-42
2r9y_A 430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 3e-06
2r9y_A430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 4e-06
1uhg_A385 Ovalbumin, S-ovalbumin; allergen, egg white protei 3e-42
1uhg_A 385 Ovalbumin, S-ovalbumin; allergen, egg white protei 7e-07
1uhg_A385 Ovalbumin, S-ovalbumin; allergen, egg white protei 3e-06
1wz9_A375 Maspin precursor; serpin, tumor suppressor, serpin 4e-42
1wz9_A 375 Maspin precursor; serpin, tumor suppressor, serpin 7e-07
1wz9_A375 Maspin precursor; serpin, tumor suppressor, serpin 3e-06
1qmn_A401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 4e-42
1qmn_A 401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 7e-06
1qmn_A401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 1e-04
3sto_A406 Serine protease inhibitor; serpin fold, hydrolase 5e-42
3sto_A 406 Serine protease inhibitor; serpin fold, hydrolase 4e-06
3sto_A406 Serine protease inhibitor; serpin fold, hydrolase 1e-04
2arr_A382 Plasminogen activator inhibitor-2; serpin, peptide 6e-42
2arr_A 382 Plasminogen activator inhibitor-2; serpin, peptide 2e-06
2arr_A382 Plasminogen activator inhibitor-2; serpin, peptide 2e-05
2v95_A371 Corticosteroid-binding globulin; transport protein 2e-41
2v95_A371 Corticosteroid-binding globulin; transport protein 4e-06
2v95_A371 Corticosteroid-binding globulin; transport protein 5e-05
2oay_A390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 3e-41
2oay_A390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 3e-08
2oay_A390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 3e-07
3f1s_A385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 3e-41
3f1s_A385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 4e-06
3f1s_A385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 1e-05
2zv6_A401 Serpin B3; serine proteinase inhibitor, reactive s 7e-41
2zv6_A 401 Serpin B3; serine proteinase inhibitor, reactive s 3e-07
2zv6_A401 Serpin B3; serine proteinase inhibitor, reactive s 3e-06
1imv_A398 PEDF, pigment epithelium-derived factor; serpin, a 7e-41
1imv_A398 PEDF, pigment epithelium-derived factor; serpin, a 3e-07
1imv_A398 PEDF, pigment epithelium-derived factor; serpin, a 5e-06
1jmo_A480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 9e-40
1jmo_A480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 2e-08
1jmo_A480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 4e-07
3b9f_I395 Protein C inhibitor; michaelis complex, acute phas 1e-39
3b9f_I395 Protein C inhibitor; michaelis complex, acute phas 8e-07
3b9f_I395 Protein C inhibitor; michaelis complex, acute phas 3e-06
3nda_A377 Serpin-2; vaccination target, TICK, hydrolase inhi 2e-39
3nda_A377 Serpin-2; vaccination target, TICK, hydrolase inhi 3e-07
3nda_A377 Serpin-2; vaccination target, TICK, hydrolase inhi 2e-06
3pzf_A397 Serpin 2; protease inhibitor, melanization, hydrol 3e-39
3pzf_A 397 Serpin 2; protease inhibitor, melanization, hydrol 5e-05
3pzf_A397 Serpin 2; protease inhibitor, melanization, hydrol 4e-04
2h4r_A415 MENT, heterochromatin-associated protein MENT; ser 3e-39
2h4r_A 415 MENT, heterochromatin-associated protein MENT; ser 1e-07
2h4r_A415 MENT, heterochromatin-associated protein MENT; ser 1e-06
2wxw_A453 Angiotensinogen, serpin A8; glycoprotein, hyperten 4e-39
2wxw_A 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 6e-08
2wxw_A453 Angiotensinogen, serpin A8; glycoprotein, hyperten 1e-06
2wxy_C453 Angiotensinogen, serpin A8; glycoprotein, hyperten 2e-38
2wxy_C 453 Angiotensinogen, serpin A8; glycoprotein, hyperten 3e-08
2wxy_C453 Angiotensinogen, serpin A8; glycoprotein, hyperten 3e-07
1sek_A378 Serpin K; serine protease inhibitor, protease; 2.1 5e-38
1sek_A378 Serpin K; serine protease inhibitor, protease; 2.1 7e-07
1sek_A378 Serpin K; serine protease inhibitor, protease; 2.1 2e-06
3ozq_A376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 1e-35
3ozq_A376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 3e-08
3ozq_A376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 1e-06
1sng_A370 COG4826: serine protease inhibitor; serine proteas 5e-35
1sng_A370 COG4826: serine protease inhibitor; serine proteas 2e-07
1sng_A370 COG4826: serine protease inhibitor; serine proteas 3e-06
3le2_A393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 1e-34
3le2_A393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 1e-06
3le2_A 393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 1e-06
3dy0_A336 N-terminus plasma serine protease inhibitor; serpi 9e-29
3dy0_A336 N-terminus plasma serine protease inhibitor; serpi 2e-06
3dy0_A336 N-terminus plasma serine protease inhibitor; serpi 6e-06
2xn6_A350 Thyroxine-binding globulin; transport, cleaved pro 1e-28
2xn6_A350 Thyroxine-binding globulin; transport, cleaved pro 3e-07
2xn6_A350 Thyroxine-binding globulin; transport, cleaved pro 6e-06
3ndd_A343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 3e-28
3ndd_A343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 3e-06
3ndd_A343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 2e-05
1f0c_A305 ICE inhibitor; apoptosis, caspase inhibitor, prote 1e-27
1f0c_A305 ICE inhibitor; apoptosis, caspase inhibitor, prote 6e-05
1f0c_A305 ICE inhibitor; apoptosis, caspase inhibitor, prote 6e-05
1m93_B245 Serine proteinase inhibitor 2; serpin, CRMA, apopt 1e-27
1as4_A341 Antichymotrypsin, ACT; serpin, serine protease inh 2e-27
1as4_A341 Antichymotrypsin, ACT; serpin, serine protease inh 2e-06
1as4_A341 Antichymotrypsin, ACT; serpin, serine protease inh 6e-06
3f02_A359 Neuroserpin; cleaved form, fenib, human, disease M 2e-27
3f02_A359 Neuroserpin; cleaved form, fenib, human, disease M 3e-07
3f02_A359 Neuroserpin; cleaved form, fenib, human, disease M 2e-06
1hle_A345 Horse leukocyte elastase inhibitor; hydrolase inhi 4e-27
1hle_A345 Horse leukocyte elastase inhibitor; hydrolase inhi 1e-06
1hle_A345 Horse leukocyte elastase inhibitor; hydrolase inhi 7e-06
2h4p_A394 MENT, heterochromatin-associated protein MENT; ser 5e-26
2h4p_A394 MENT, heterochromatin-associated protein MENT; ser 3e-08
2h4p_A394 MENT, heterochromatin-associated protein MENT; ser 2e-06
1mtp_A323 Serine proteinase inhibitor (serpin), chain A; str 2e-24
1mtp_A323 Serine proteinase inhibitor (serpin), chain A; str 3e-07
1mtp_A323 Serine proteinase inhibitor (serpin), chain A; str 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-09
3f02_C48 Neuroserpin; cleaved form, fenib, human, disease M 1e-07
1hle_B31 Horse leukocyte elastase inhibitor; hydrolase inhi 1e-07
2h4p_B34 MENT, heterochromatin-associated protein MENT; ser 2e-07
3ndd_B36 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 3e-06
1m93_A55 Serine proteinase inhibitor 2; serpin, CRMA, apopt 4e-06
1m93_A55 Serine proteinase inhibitor 2; serpin, CRMA, apopt 4e-06
2xn6_B35 Thyroxine-binding globulin; transport, cleaved pro 5e-05
2riv_B40 Thyroxine-binding globulin; TBG, serpin, cleaved, 9e-05
1as4_B37 Antichymotrypsin, ACT; serpin, serine protease inh 3e-04
>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 Back     alignment and structure
 Score =  160 bits (406), Expect = 9e-46
 Identities = 33/155 (21%), Positives = 63/155 (40%), Gaps = 1/155 (0%)

Query: 163 NEVYMYFILPKNPD-LSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLN 221
               +  ++P + + L    K L  ++    +    K  V  ++PK  V  + +L+  L 
Sbjct: 229 KLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQKHLA 288

Query: 222 TMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTV 281
            + +T   D +K+DLS M   + + +  VFH    E   +G              S    
Sbjct: 289 GLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDTEGNPFDQDIYGREELRSPKLF 348

Query: 282 KINRPFIFFIYHKPTDSIVFWGSIYKPEPQRPYHE 316
             + PFIF +    + S++F G + +P+  +   E
Sbjct: 349 YADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDE 383


>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 Back     alignment and structure
>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 Back     alignment and structure
>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 Back     alignment and structure
>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 Back     alignment and structure
>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 Back     alignment and structure
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 Back     alignment and structure
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 Back     alignment and structure
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 Back     alignment and structure
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 Back     alignment and structure
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 Back     alignment and structure
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 Back     alignment and structure
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 Back     alignment and structure
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 Back     alignment and structure
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 Back     alignment and structure
>1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 245 Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 Back     alignment and structure
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 Back     alignment and structure
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 Back     alignment and structure
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 Back     alignment and structure
>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 Back     alignment and structure
>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 Back     alignment and structure
>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3f02_C Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 1jjo_E Length = 48 Back     alignment and structure
>1hle_B Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 31 Back     alignment and structure
>2h4p_B MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_B Length = 34 Back     alignment and structure
>3ndd_B Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 1ezx_B 3ndf_B 7api_B* 8api_B* 9api_B* 2d26_B Length = 36 Back     alignment and structure
>1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 55 Back     alignment and structure
>1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 55 Back     alignment and structure
>2xn6_B Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn5_B* 2xn7_B* Length = 35 Back     alignment and structure
>2riv_B Thyroxine-binding globulin; TBG, serpin, cleaved, mutation, glycoprotein, secreted, signaling protein; 1.50A {Homo sapiens} PDB: 2riw_B* 2xn3_B* Length = 40 Back     alignment and structure
>1as4_B Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_B* 3caa_B 4caa_B Length = 37 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
4ga7_A389 Leukocyte elastase inhibitor; serpin, conformation 100.0
4au2_A392 HSP47, serpin peptidase inhibitor, clade H (heat s 100.0
3f5n_A407 Neuroserpin; cleaved form, fenib, human, tissue PL 100.0
3ne4_A424 Alpha-1-antitrypsin; serpin, LUNG disease, liver d 100.0
4dy0_A379 GLIA-derived nexin; serpin, protease inhibitor, th 100.0
1uhg_A385 Ovalbumin, S-ovalbumin; allergen, egg white protei 100.0
1lj5_A379 Plasminogen activator inhibitor-1; beta-barrell, b 100.0
3nda_A377 Serpin-2; vaccination target, TICK, hydrolase inhi 100.0
3f1s_A385 Protein Z-dependent protease inhibitor; PZ, ZPI, c 100.0
2arr_A382 Plasminogen activator inhibitor-2; serpin, peptide 100.0
2vdx_A373 Corticosteroid-binding globulin; transport protein 100.0
2h4r_A415 MENT, heterochromatin-associated protein MENT; ser 100.0
4ajt_A427 Protein Z-dependent protease inhibitor; blood clot 100.0
3sto_A406 Serine protease inhibitor; serpin fold, hydrolase 100.0
2ceo_A379 Thyroxine-binding globulin; transport, serpin, hor 100.0
1wz9_A375 Maspin precursor; serpin, tumor suppressor, serpin 100.0
3kcg_I432 Antithrombin-III, ATIII; michaelis complex, blood 100.0
2zv6_A401 Serpin B3; serine proteinase inhibitor, reactive s 100.0
1sek_A378 Serpin K; serine protease inhibitor, protease; 2.1 100.0
1yxa_A398 Serine (OR cysteine) proteinase inhibitor, clade 3 100.0
1jmo_A480 HC-II, heparin cofactor II, HLS2, serin; serpin, t 100.0
1qmn_A401 AACT, alpha-1-antichymotrypsin; serpin, serine pro 100.0
3pzf_A397 Serpin 2; protease inhibitor, melanization, hydrol 100.0
2v95_A371 Corticosteroid-binding globulin; transport protein 100.0
2pef_A373 Serine protease inhibitor; serpin; 1.60A {Thermoan 100.0
3b9f_I395 Protein C inhibitor; michaelis complex, acute phas 100.0
3ozq_A376 Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito 100.0
3le2_A393 Serpin-ZX; apoplast, glycoprotein, protease inhibi 100.0
1imv_A398 PEDF, pigment epithelium-derived factor; serpin, a 100.0
1sng_A370 COG4826: serine protease inhibitor; serine proteas 100.0
2r9y_A430 Alpha-2-antiplasmin; inhibitory serpin, plasmin in 100.0
2wxy_C453 Angiotensinogen, serpin A8; glycoprotein, hyperten 100.0
2oay_A390 C1-inhibitor, plasma protease C1 inhibitor, C1 INH 100.0
2wxw_A453 Angiotensinogen, serpin A8; glycoprotein, hyperten 100.0
3f02_A359 Neuroserpin; cleaved form, fenib, human, disease M 100.0
1hle_A345 Horse leukocyte elastase inhibitor; hydrolase inhi 100.0
3ndd_A343 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 100.0
2h4p_A394 MENT, heterochromatin-associated protein MENT; ser 100.0
2xn6_A350 Thyroxine-binding globulin; transport, cleaved pro 100.0
3dy0_A336 N-terminus plasma serine protease inhibitor; serpi 100.0
4afx_A387 Protein Z dependent protease inhibitor; hydrolase 100.0
1as4_A341 Antichymotrypsin, ACT; serpin, serine protease inh 100.0
1mtp_A323 Serine proteinase inhibitor (serpin), chain A; str 100.0
1f0c_A305 ICE inhibitor; apoptosis, caspase inhibitor, prote 100.0
1m93_B245 Serine proteinase inhibitor 2; serpin, CRMA, apopt 100.0
1m93_A55 Serine proteinase inhibitor 2; serpin, CRMA, apopt 99.35
3ndd_B36 Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 99.26
1hle_B31 Horse leukocyte elastase inhibitor; hydrolase inhi 99.24
4afx_B36 Protein Z dependent protease inhibitor; hydrolase 99.23
2xn6_B35 Thyroxine-binding globulin; transport, cleaved pro 99.23
2h4p_B34 MENT, heterochromatin-associated protein MENT; ser 99.21
2riv_B40 Thyroxine-binding globulin; TBG, serpin, cleaved, 99.2
1as4_B37 Antichymotrypsin, ACT; serpin, serine protease inh 99.19
3f02_C48 Neuroserpin; cleaved form, fenib, human, disease M 99.14
1m93_C41 Serine proteinase inhibitor 2; serpin, CRMA, apopt 99.07
1mtp_B43 Serine proteinase inhibitor (serpin), chain B; str 99.02
3dy0_B29 C-terminus plasma serine protease inhibitor; serpi 98.94
>4ga7_A Leukocyte elastase inhibitor; serpin, conformational change, serine protease inhibitor, Ca inhibitor, chymase inhibitor, chymotrypsin inhibitor; 2.90A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.3e-64  Score=497.00  Aligned_cols=299  Identities=27%  Similarity=0.397  Sum_probs=262.1

Q ss_pred             chhHHHHhhHHHHHHHHHHHhccCCCCCEEEchhhHHHHHHHHHcCCCchhHHHHHHhhCCCch-------hhHHhhc--
Q psy5102           9 NLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATG-------RSLSNKL--   79 (357)
Q Consensus         9 ~~~~~~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~eL~~~Lg~~~~-------~~ll~~l--   79 (357)
                      +..+..++++||++||+++.+. .+++|+||||+||+.+|+|+++||+|+|++||.++||++..       +.|+..+  
T Consensus        11 ~~~l~~~~~~Fa~~L~~~l~~~-~~~~Ni~~SP~Si~~aLaml~~GA~g~T~~el~~~L~~~~~~~~~~~~~~l~~~l~~   89 (389)
T 4ga7_A           11 MEQLSSANTRFALDLFLALSEN-NPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRFQSLNADINK   89 (389)
T ss_dssp             CCHHHHHHHHHHHHHHHHHHHH-CSSSCEEECHHHHHHHHHHHHTTCCHHHHHHHHHHTTGGGCTTHHHHHHHHHHHHTC
T ss_pred             HHHHHHHHhHHHHHHHHHHhhc-CCCCCEEEchHHHHHHHHHHHhhccCcHHHHHHHHhCCCCHHHHHHHHHHHHHHHhC
Confidence            5678999999999999999877 67899999999999999999999999999999999999761       5566666  


Q ss_pred             -c-cceeeee---eccc---------------------cCCH-H---HH---HHHHH---hCCC-cccCCCCCCCcccee
Q psy5102          80 -T-AHSLRRG---ITQM---------------------TLDM-E---RA---IRSVM---TKNQ-NVVFAPLSIVGALAL  122 (357)
Q Consensus        80 -~-~~~l~~a---f~~~---------------------~~dF-~---~a---IN~wv---T~g~-~~~l~~~~l~~~t~l  122 (357)
                       + ++.++++   |+++                     .+|| +   .|   ||+||   |+|+ ++++++++++++|++
T Consensus        90 ~~~~~~l~~an~l~~~~~~~l~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~IN~WV~~~T~g~I~~ll~~~~l~~~t~l  169 (389)
T 4ga7_A           90 RGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKL  169 (389)
T ss_dssp             TTCSSEEEEEEEEEEETTSCBCHHHHHHHHHHTSCCEEEECHHHHHHHHHHHHHHHHHHHTTTSSTTSSCTTSSCTTCCE
T ss_pred             CCCCcEEEEeeeeeecCCCccCHHHHHHHHHHhCCeeEecccccCHHHHHHHHHHHHHHhhCCchhhccCCCCCCCCceE
Confidence             2 5677776   7665                     6789 2   33   99999   9999 999999899999999


Q ss_pred             Eeecc-------cCCCCCCCceeeeeeec--------------c-cccccCCCCeEEEe--ecCCeEEEEEEec-CC---
Q psy5102         123 VLLGS-------DGQTKDELTHFMGVATG--------------R-SLSNNPEAYASFLE--KMRNEVYMYFILP-KN---  174 (357)
Q Consensus       123 vLvna-------~~~F~~~~T~~~~F~~~--------------~-~~~~~~~~~~~vve--y~~~~~sm~iiLP-~~---  174 (357)
                      +|+||       +.||++..|.+++||..              . +|+++++++|+||+  |.+++++|+|||| +.   
T Consensus       170 vLvNaiyFkg~W~~~F~~~~T~~~~F~~~~~~~~~V~mM~~~~~~~~~~~~~~~~~vleLPy~~~~~sm~iiLP~~~~~~  249 (389)
T 4ga7_A          170 VLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDE  249 (389)
T ss_dssp             EEEEEEEEECCBSSCCCTTTCEEEEEEEETTEEEEEEEEEEEEEEEEEEETTTTEEEEEEEBTTSSEEEEEEEESSCCSS
T ss_pred             EEEEEEEEEeeecCCCCccCccccceEeCCCcEEEEEEEEEeeeEEEEEECCCCEEEEEEECCCCCEEEEEEecCCCccc
Confidence            99999       89999999999999976              2 57788999999999  9998999999999 76   


Q ss_pred             -CChhHHhhccChhHHHHHH--HhcCceeEEEEeceeeEeeccchHHHhhhCCccccCCCCCCCCCCCCCCCCceeeeee
Q psy5102         175 -PDLSEFTKDLDYDKFSRII--ESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVF  251 (357)
Q Consensus       175 -~~L~~l~~~L~~~~l~~~~--~~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGl~~~F~~~~adfs~is~~~~l~vs~v~  251 (357)
                       .+|.+++++|+.+.+..|.  ..++.+.|+|.||||++++++||+++|++||++++|+++.||||+|+++.+++|++|+
T Consensus       250 ~~~L~~le~~L~~~~l~~~~~~~~~~~~~v~v~lPKFki~~~~dL~~~L~~lGi~~~F~~~~Adfsgis~~~~l~vs~v~  329 (389)
T 4ga7_A          250 STGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIV  329 (389)
T ss_dssp             SSSCHHHHHHCCHHHHHHHHSGGGCEEEEEEEEEECEEEEEEEECHHHHHHTTCCGGGCTTTCCCTTTBCCSSCCEEEEE
T ss_pred             cccHHHHHHHhCHHHHHHHhhhhcCcceEEEEEeccEEEEEeechHHHHHHcCcHhhcCCCcCCcccccCCCCcceeeEE
Confidence             8999999999999999998  5788999999999999999999999999999999999657999999987789999999


Q ss_pred             EEEEEEEccCccccccccceeee-ec--CCCEEEEcCceEEEEEECCCCcEEEEEEEcCC
Q psy5102         252 HKVDIEVTEQGTVAAASTGIIIT-RI--SKPTVKINRPFIFFIYHKPTDSIVFWGSIYKP  308 (357)
Q Consensus       252 qk~~iev~E~G~~aaa~t~~~~~-~s--~~~~f~~nrPFlf~I~d~~t~~iLF~G~v~~P  308 (357)
                      ||+.|+|||+|++|+|+|++.+. ++  .+.+|++||||+|+|+|+.|+.|||+|+|.+|
T Consensus       330 hka~ieVnE~GteAaAaT~~~~~~~s~~~~~~f~~drPFlf~I~~~~t~~iLF~G~v~~P  389 (389)
T 4ga7_A          330 HKSFVEVNEEGTEAAAATAGIATFCMDDPEENFTADHPFLFFIRHNSSGSILFLGRFSSP  389 (389)
T ss_dssp             EEEEEEECSCBC----------CCCSSSCEEEEECCSCEEEEEEETTTTEEEEEEEECCC
T ss_pred             EEEEEEecCCCcccccccccccccccCCCCCcEEccCCEEEEEEECCCCcEEEEEEecCC
Confidence            99999999999999999987765 44  34689999999999999999999999999998



>4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Back     alignment and structure
>3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Back     alignment and structure
>3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Back     alignment and structure
>4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Back     alignment and structure
>1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Back     alignment and structure
>1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Back     alignment and structure
>3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Back     alignment and structure
>3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Back     alignment and structure
>2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Back     alignment and structure
>2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Back     alignment and structure
>2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Back     alignment and structure
>4ajt_A Protein Z-dependent protease inhibitor; blood clotting, ZPI; 2.50A {Mus musculus} Back     alignment and structure
>3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Back     alignment and structure
>2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Back     alignment and structure
>1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Back     alignment and structure
>3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} SCOP: e.1.1.1 PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Back     alignment and structure
>2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Back     alignment and structure
>1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Back     alignment and structure
>1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Back     alignment and structure
>1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Back     alignment and structure
>1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Back     alignment and structure
>3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Back     alignment and structure
>2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Back     alignment and structure
>2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Back     alignment and structure
>3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Back     alignment and structure
>3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Back     alignment and structure
>3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} SCOP: e.1.1.0 Back     alignment and structure
>1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Back     alignment and structure
>1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Back     alignment and structure
>2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Back     alignment and structure
>2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Back     alignment and structure
>2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Back     alignment and structure
>2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Back     alignment and structure
>3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Back     alignment and structure
>1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Back     alignment and structure
>3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Back     alignment and structure
>2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Back     alignment and structure
>2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Back     alignment and structure
>3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Back     alignment and structure
>4afx_A Protein Z dependent protease inhibitor; hydrolase inhibitor, serpin, protein Z dependent inhibitor, coagulation; 2.09A {Homo sapiens} PDB: 4aju_A 3h5c_A* 3f1s_A* Back     alignment and structure
>1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Back     alignment and structure
>1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Back     alignment and structure
>1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Back     alignment and structure
>1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Back     alignment and structure
>1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Back     alignment and structure
>3ndd_B Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 1ezx_B 3ndf_B 7api_B* 8api_B* 9api_B* 2d26_B Back     alignment and structure
>1hle_B Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Back     alignment and structure
>4afx_B Protein Z dependent protease inhibitor; hydrolase inhibitor, serpin, protein Z dependent inhibitor, coagulation; 2.09A {Homo sapiens} PDB: 4aju_B Back     alignment and structure
>2xn6_B Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn5_B* 2xn7_B* Back     alignment and structure
>2h4p_B MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_B Back     alignment and structure
>2riv_B Thyroxine-binding globulin; TBG, serpin, cleaved, mutation, glycoprotein, secreted, signaling protein; 1.50A {Homo sapiens} PDB: 2riw_B* 2xn3_B* Back     alignment and structure
>1as4_B Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_B* 3caa_B 4caa_B Back     alignment and structure
>3f02_C Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 1jjo_E Back     alignment and structure
>1m93_C Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_B 1f0c_B Back     alignment and structure
>1mtp_B Serine proteinase inhibitor (serpin), chain B; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Back     alignment and structure
>3dy0_B C-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_B* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 357
g1jjo.1334 e.1.1.1 (A:,C:,E:) Neuroserpin {Mouse (Mus musculu 3e-38
d2b5ti1426 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien 7e-34
d2b5ti1 426 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien 5e-09
d2b5ti1426 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien 9e-09
d1qlpa_372 e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap 3e-33
d1qlpa_372 e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap 9e-09
d1qlpa_372 e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap 5e-08
g1lq8.1358 e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s 6e-33
g1lq8.1358 e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s 2e-07
g1lq8.1358 e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s 2e-07
d1xqga_378 e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 1e-32
d1xqga_378 e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 3e-08
d1xqga_378 e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 2e-07
g1as4.1369 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( 3e-32
g1as4.1369 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( 3e-07
g1as4.1369 e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( 6e-07
g1hle.1375 e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c 9e-32
g1hle.1375 e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c 4e-08
g1hle.1375 e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c 4e-08
d1lj5a_379 e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu 1e-31
d1lj5a_ 379 e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu 1e-07
d1lj5a_379 e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu 2e-07
d1jmja_420 e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 1e-31
d1jmja_420 e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2e-08
d1jmja_420 e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 3e-07
d1uhga_385 e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId 6e-31
d1uhga_ 385 e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId 9e-09
d1uhga_385 e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId 7e-08
d1by7a_381 e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu 3e-30
d1by7a_ 381 e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu 7e-08
d1by7a_381 e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu 9e-08
d1imva_383 e.1.1.1 (A:) Pigment epithelium-derived factor, PE 3e-29
d1imva_383 e.1.1.1 (A:) Pigment epithelium-derived factor, PE 4e-09
d1imva_383 e.1.1.1 (A:) Pigment epithelium-derived factor, PE 6e-08
d1k9oi_376 e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor 3e-27
d1k9oi_376 e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor 5e-08
d1k9oi_376 e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor 1e-07
g1m93.1322 e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine res 4e-26
g1m93.1322 e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine res 7e-08
g1mtp.1355 e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax 2e-23
g1mtp.1355 e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax 3e-09
g1mtp.1355 e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax 3e-08
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 Back     information, alignment and structure
>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 Back     information, alignment and structure
>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 Back     information, alignment and structure
>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
d2b5ti1426 Antithrombin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1jmja_420 Heparin cofactor II (Hc-II, leuserpin 2) {Human (H 100.0
d1uhga_385 Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} 100.0
d1lj5a_379 Plasminogen activator inhibitor-1 {Human (Homo sap 100.0
g1hle.1375 Elastase inhibitor {Horse (Equus caballus) [TaxId: 100.0
d1xqga_378 Maspin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1by7a_381 Plasminogen activator inhibitor-2 {Human (Homo sap 100.0
d1imva_383 Pigment epithelium-derived factor, PEDF {Human (Ho 100.0
d1k9oi_376 Alaserpin (serpin 1) {Tobacco hornworm (Manduca se 100.0
d1qlpa_372 Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 100.0
g1as4.1369 Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T 100.0
g1lq8.1358 Protein C inhibitor {Human (Homo sapiens) [TaxId: 100.0
g1mtp.1355 Thermopin {Thermobifida fusca [TaxId: 2021]} 100.0
g1jjo.1334 Neuroserpin {Mouse (Mus musculus) [TaxId: 10090]} 100.0
g1m93.1322 Viral serpin crmA (cytokine response modifier prot 100.0
>d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Serpins
superfamily: Serpins
family: Serpins
domain: Antithrombin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.6e-60  Score=469.58  Aligned_cols=300  Identities=25%  Similarity=0.385  Sum_probs=263.6

Q ss_pred             hhHHHHhhHHHHHHHHHHHhccCCCCCEEEchhhHHHHHHHHHcCCCchhHHHHHHhhCCCch------------hhHHh
Q psy5102          10 LILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATG------------RSLSN   77 (357)
Q Consensus        10 ~~~~~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~eL~~~Lg~~~~------------~~ll~   77 (357)
                      ..+..++++||++||+++....++++|+||||+||+.+|+|+++||+|+|++||.++||++..            +.|..
T Consensus        44 ~~l~~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aLa~l~~GA~g~T~~el~~~L~~~~~~~~~~~~~~~~~~~l~~  123 (426)
T d2b5ti1          44 WELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNC  123 (426)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHTSCTTSCEEECHHHHHHHHHHHHTTCCHHHHHHHHHHTTGGGSCHHHHHTHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHhcCCCCCEEEECHHHHHHHHHHHHHhCchHHHHHHHHhcCCCCCCcchHHHHHHHHHHHHH
Confidence            358999999999999999743257899999999999999999999999999999999999751            23333


Q ss_pred             hc----c-cceeeee---eccc---------------------cCCH----HHH---HHHHH---hCCC-cccCCCCCCC
Q psy5102          78 KL----T-AHSLRRG---ITQM---------------------TLDM----ERA---IRSVM---TKNQ-NVVFAPLSIV  117 (357)
Q Consensus        78 ~l----~-~~~l~~a---f~~~---------------------~~dF----~~a---IN~wv---T~g~-~~~l~~~~l~  117 (357)
                      .+    + +..++++   |+++                     .+||    +.+   ||+||   |+|+ ++++++++++
T Consensus       124 ~l~~~~~~~~~l~~an~l~v~~~~~~~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~IN~wv~~~T~g~I~~~~~~~~l~  203 (426)
T d2b5ti1         124 RLYRKANKASKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAIN  203 (426)
T ss_dssp             HHTSCCCSSEEEEEEEEEEEETTSCCCHHHHHHHHHHHSSCCEEECTTTCHHHHHHHHHHHHHHHTTTSCSCSSCTTCSC
T ss_pred             HHhccCCCCcEEeeeehhhhcccccchHHHHHHHHHhcCCeEEEecccccHHHHHHHHHHHHHHhcCCCccCCCCccCCC
Confidence            33    2 4556555   6654                     6788    233   99999   9999 9999988999


Q ss_pred             ccceeEeecc-------cCCCCCCCceeeeeeec------------c---cccccCCCCeEEEe--ecCCeEEEEEEec-
Q psy5102         118 GALALVLLGS-------DGQTKDELTHFMGVATG------------R---SLSNNPEAYASFLE--KMRNEVYMYFILP-  172 (357)
Q Consensus       118 ~~t~lvLvna-------~~~F~~~~T~~~~F~~~------------~---~~~~~~~~~~~vve--y~~~~~sm~iiLP-  172 (357)
                      ++|.++|+||       +.||++..|..++||..            .   .|++. +.++++|+  |++++++|+|||| 
T Consensus       204 ~~t~l~Lvna~yFkg~W~~~F~~~~T~~~~F~~~~~~~v~v~mM~~~~~~~~~~~-~~~~~vveLPy~~~~~sm~iiLP~  282 (426)
T d2b5ti1         204 ELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRV-AEGTQVLELPFKGDDITMVLILPK  282 (426)
T ss_dssp             TTCCEEEEEEEEEEEEBSSCCCGGGCEEEEECCSSSCCEEEEEEEEEEEEEEEEC-GGGCEEEEEEBTTSSEEEEEEECC
T ss_pred             chhHHHHHhhhhhccccccCccccccccceeecCCCeEEEeecceeecceeeEEc-cCCeEEEEeecCCCceEEEEEecC
Confidence            9999999999       89999999999999976            1   33333 34899999  9999999999999 


Q ss_pred             CCCChhHHhhccChhHHHHHHHhcCceeEEEEeceeeEeeccchHHHhhhCCccccCCCCCCCCCCCCCC--CCceeeee
Q psy5102         173 KNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDD--RGVAVDQV  250 (357)
Q Consensus       173 ~~~~L~~l~~~L~~~~l~~~~~~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGl~~~F~~~~adfs~is~~--~~l~vs~v  250 (357)
                      +..++..+++.|+.+.+..|.++++.+.|+|.||||++++++||+++|++||++++|++..|||++|+.+  ++++|++|
T Consensus       283 ~~~~l~~le~~L~~~~l~~~~~~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGi~~~F~~~~Adfs~i~~~~~~~l~vs~v  362 (426)
T d2b5ti1         283 PEKSLAKVEKELTPEVLQEWLDELEEMMLCVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDA  362 (426)
T ss_dssp             SSSCHHHHHHHCCHHHHHHHHHHCEEEEEEEEEECEEEECCSCHHHHHHTTTCCGGGCTTTCCCTTTSCSSSSCCCCCEE
T ss_pred             CCCCHHHHHHhhhHHHHHHHHHhhhhccceEeeeeEEEEEeecHHHHHHHcCChhhcCCccccCccccccCCCCcEEEeE
Confidence            8999999999999999999999999999999999999999999999999999999998757999999753  48999999


Q ss_pred             eEEEEEEEccCccccccccceeee-ec---CCCEEEEcCceEEEEEECCCCcEEEEEEEcCCCC
Q psy5102         251 FHKVDIEVTEQGTVAAASTGIIIT-RI---SKPTVKINRPFIFFIYHKPTDSIVFWGSIYKPEP  310 (357)
Q Consensus       251 ~qk~~iev~E~G~~aaa~t~~~~~-~s---~~~~f~~nrPFlf~I~d~~t~~iLF~G~v~~P~~  310 (357)
                      +|++.|+|||+|++|+|+|.+.+. ++   .+.+|++||||+|+|+|+.||.|||+|+|.+|+.
T Consensus       363 ~hka~ieVdE~GteAaa~T~~~~~~~s~~~~~~~f~~drPFlF~I~d~~t~~iLF~G~v~~Pt~  426 (426)
T d2b5ti1         363 FHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVCFKANRPFLVFIREVPLNTIIFMGRVANPCV  426 (426)
T ss_dssp             EEEEEEEECSSEESCCCCCCCCCSCCCCCTTCCCEECCSCEEEEEEETTTCCEEEEEEESCCCC
T ss_pred             EEEEEEEECCCceeccccceeeeccccCCCCCcEEEecCCEEEEEEECCCCCEEEEEEecCCCC
Confidence            999999999999999999987665 43   3568999999999999999999999999999973



>d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Back     information, alignment and structure
>d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure