Psyllid ID: psy5102
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 357 | ||||||
| 193688350 | 532 | PREDICTED: plasminogen activator inhibit | 0.515 | 0.345 | 0.388 | 1e-27 | |
| 357615598 | 444 | serine protease inhibitor 6 [Danaus plex | 0.501 | 0.403 | 0.357 | 5e-20 | |
| 389608417 | 413 | serine protease inhibitor 5 [Papilio xut | 0.840 | 0.726 | 0.251 | 7e-19 | |
| 218551711 | 397 | RecName: Full=Serpin B10 gi|190576556|gb | 0.436 | 0.392 | 0.373 | 9e-19 | |
| 218551708 | 397 | RecName: Full=Serpin B10 gi|196050404|gb | 0.442 | 0.397 | 0.341 | 2e-18 | |
| 229368692 | 374 | serine proteinase inhibitor, clade B, me | 0.406 | 0.387 | 0.370 | 3e-18 | |
| 395830701 | 397 | PREDICTED: serpin B10 [Otolemur garnetti | 0.442 | 0.397 | 0.341 | 4e-18 | |
| 344242554 | 302 | Serpin B13 [Cricetulus griseus] | 0.795 | 0.940 | 0.264 | 5e-18 | |
| 301613964 | 392 | PREDICTED: serpin B4-like [Xenopus (Silu | 0.450 | 0.410 | 0.374 | 6e-18 | |
| 344243138 | 339 | Serpin B9 [Cricetulus griseus] | 0.725 | 0.764 | 0.264 | 7e-18 |
| >gi|193688350|ref|XP_001946416.1| PREDICTED: plasminogen activator inhibitor 1-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 130 bits (326), Expect = 1e-27, Method: Compositional matrix adjust.
Identities = 73/188 (38%), Positives = 104/188 (55%), Gaps = 4/188 (2%)
Query: 127 SDGQTKDELTHFMGVATGRSLSNNPEAY---ASFLEKMRNEVYMYFILPK-NPDLSEFTK 182
S Q KD + M V + L + E A L N+ YF+LP N LS T
Sbjct: 331 SSKQNKDCIYVQMMVGSSEVLFHKNEGLEFKAIGLPYKGNQFITYFVLPDTNISLSSLTA 390
Query: 183 DLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDD 242
++ I + ++ Y +PKM + S T LR VL + + MFD SK+DLSNM D
Sbjct: 391 KMNGKTIKNITRTAKITELTYFVPKMTLKSLTNLRPVLQNLGINKMFDPSKADLSNMASD 450
Query: 243 RGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTVKINRPFIFFIYHKPTDSIVFW 302
G + + H+V+I+V E GTVA+A+T + ITR + IN+PFIFFI+H +D++VFW
Sbjct: 451 PGSYISDILHQVEIDVNEIGTVASAATVVTITRGGQTIFNINKPFIFFIHHVESDTVVFW 510
Query: 303 GSIYKPEP 310
++YKP P
Sbjct: 511 STVYKPMP 518
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357615598|gb|EHJ69744.1| serine protease inhibitor 6 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|389608417|dbj|BAM17818.1| serine protease inhibitor 5 [Papilio xuthus] | Back alignment and taxonomy information |
|---|
| >gi|218551711|sp|B3RFC3.1|SPB10_SORAR RecName: Full=Serpin B10 gi|190576556|gb|ACE79048.1| MGC159890 protein (predicted) [Sorex araneus] | Back alignment and taxonomy information |
|---|
| >gi|218551708|sp|B4USX2.1|SPB10_OTOGA RecName: Full=Serpin B10 gi|196050404|gb|ACG64313.1| serine proteinase inhibitor, clade B, member 10 (predicted) [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
| >gi|229368692|gb|ACQ62978.1| serine proteinase inhibitor, clade B, member 8 isoform a (predicted) [Dasypus novemcinctus] | Back alignment and taxonomy information |
|---|
| >gi|395830701|ref|XP_003788457.1| PREDICTED: serpin B10 [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
| >gi|344242554|gb|EGV98657.1| Serpin B13 [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
| >gi|301613964|ref|XP_002936465.1| PREDICTED: serpin B4-like [Xenopus (Silurana) tropicalis] | Back alignment and taxonomy information |
|---|
| >gi|344243138|gb|EGV99241.1| Serpin B9 [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 357 | ||||||
| MGI|MGI:2138648 | 397 | Serpinb10 "serine (or cysteine | 0.422 | 0.380 | 0.343 | 5.1e-24 | |
| RGD|1309833 | 375 | Serpinb8 "serpin peptidase inh | 0.403 | 0.384 | 0.370 | 6.1e-23 | |
| UNIPROTKB|A5PJK0 | 397 | SERPINB10 "Serpin B10" [Bos ta | 0.445 | 0.400 | 0.321 | 6.8e-23 | |
| UNIPROTKB|F1P1L7 | 401 | F1P1L7 "Uncharacterized protei | 0.417 | 0.371 | 0.320 | 7.9e-23 | |
| UNIPROTKB|F5GY69 | 190 | SERPINB11 "Serpin B11" [Homo s | 0.369 | 0.694 | 0.350 | 1.8e-22 | |
| UNIPROTKB|E1BTF2 | 408 | SERPINB12 "Uncharacterized pro | 0.296 | 0.259 | 0.390 | 3.3e-22 | |
| RGD|1562868 | 387 | Serpinb3a "serine (or cysteine | 0.403 | 0.372 | 0.355 | 3.9e-22 | |
| MGI|MGI:894657 | 374 | Serpinb8 "serine (or cysteine) | 0.406 | 0.387 | 0.350 | 1.1e-21 | |
| UNIPROTKB|F1MG91 | 416 | SERPINB2 "Uncharacterized prot | 0.406 | 0.348 | 0.335 | 1.2e-21 | |
| UNIPROTKB|F1PH86 | 421 | SERPINA3 "Uncharacterized prot | 0.305 | 0.258 | 0.405 | 1.9e-21 |
| MGI|MGI:2138648 Serpinb10 "serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 10" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 242 (90.2 bits), Expect = 5.1e-24, Sum P(2) = 5.1e-24
Identities = 54/157 (34%), Positives = 88/157 (56%)
Query: 158 LEKMRNEVYMYFILPKNPD-LSEFTKDLDYDKFSR--IIESTNKVDVIYTIPKMKVTSST 214
L ++ + +LP+ D L + + + Y+K + + + +V +PK K+ S
Sbjct: 241 LHYQNRDLSLLLLLPEAIDGLEQLERAITYEKLDKWTSADMMDTYEVQLYLPKFKMEESY 300
Query: 215 ELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIIT 274
+L++ L M +T +F SK+D SNM +R + + VFHK +E+ E+GT AAA TG I+
Sbjct: 301 DLKSALRGMGMTDVFSQSKADFSNMTSERNLFLSNVFHKTFLEINEEGTEAAAGTGSEIS 360
Query: 275 -RISKPTVKIN--RPFIFFIYHKPTDSIVFWGSIYKP 308
RI P++++N PF+FFI H T SI+F G P
Sbjct: 361 VRIKAPSIELNVDHPFLFFIRHNKTKSILFCGRFCSP 397
|
|
| RGD|1309833 Serpinb8 "serpin peptidase inhibitor, clade B (ovalbumin), member 8" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5PJK0 SERPINB10 "Serpin B10" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P1L7 F1P1L7 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F5GY69 SERPINB11 "Serpin B11" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BTF2 SERPINB12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1562868 Serpinb3a "serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:894657 Serpinb8 "serine (or cysteine) peptidase inhibitor, clade B, member 8" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MG91 SERPINB2 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PH86 SERPINA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 357 | |||
| pfam00079 | 369 | pfam00079, Serpin, Serpin (serine protease inhibit | 2e-40 | |
| cd00172 | 364 | cd00172, SERPIN, SERine Proteinase INhibitors (ser | 3e-38 | |
| smart00093 | 359 | smart00093, SERPIN, SERine Proteinase INhibitors | 5e-38 | |
| cd02059 | 389 | cd02059, ovalbumin_like, The ovalbumin_like group | 7e-27 | |
| COG4826 | 410 | COG4826, COG4826, Serine protease inhibitor [Postt | 3e-25 | |
| cd02058 | 380 | cd02058, PAI-2, Plasminogen Activator Inhibitor-2 | 3e-24 | |
| cd02044 | 370 | cd02044, ov-serpin, ovalbumin family of serpins (o | 5e-24 | |
| cd02051 | 377 | cd02051, PAI-1_nexin-1, Plasminogen activator inhi | 7e-23 | |
| cd02049 | 364 | cd02049, bacterial_SERPIN, SERine Proteinase INhib | 1e-22 | |
| cd02056 | 361 | cd02056, alpha-1-antitrypsin_like, alpha-1-antitry | 2e-20 | |
| cd02048 | 388 | cd02048, neuroserpin, Neuroserpin is a inhibitory | 7e-18 | |
| cd02057 | 372 | cd02057, maspin_like, Maspin (mammary serine prote | 5e-17 | |
| cd02045 | 381 | cd02045, antithrombin-III_like, Antithrombin is a | 1e-14 | |
| cd02055 | 365 | cd02055, PZI, Protein Z-dependent protease inhibit | 2e-11 | |
| cd02043 | 381 | cd02043, plant_SERPIN, SERine Proteinase INhibitor | 4e-11 | |
| cd02053 | 351 | cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) i | 6e-10 | |
| cd02052 | 374 | cd02052, PEDF, Pigment epithelium-derived factor ( | 9e-10 | |
| PHA02948 | 373 | PHA02948, PHA02948, serine protease inhibitor-like | 2e-09 | |
| cd02047 | 436 | cd02047, HCII, Heparin cofactor II (HCII) inhibits | 3e-09 | |
| cd02054 | 372 | cd02054, angiotensinogen, Angiotensinogen is part | 3e-09 | |
| cd02050 | 352 | cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protea | 2e-07 | |
| cd00172 | 364 | cd00172, SERPIN, SERine Proteinase INhibitors (ser | 5e-07 | |
| pfam00079 | 369 | pfam00079, Serpin, Serpin (serine protease inhibit | 6e-07 | |
| pfam00079 | 369 | pfam00079, Serpin, Serpin (serine protease inhibit | 2e-06 | |
| cd00172 | 364 | cd00172, SERPIN, SERine Proteinase INhibitors (ser | 3e-06 | |
| cd02046 | 366 | cd02046, hsp47, Heat shock protein 47 (Hsp47), als | 7e-06 | |
| smart00093 | 359 | smart00093, SERPIN, SERine Proteinase INhibitors | 5e-05 | |
| smart00093 | 359 | smart00093, SERPIN, SERine Proteinase INhibitors | 5e-05 | |
| cd02048 | 388 | cd02048, neuroserpin, Neuroserpin is a inhibitory | 7e-05 | |
| cd02058 | 380 | cd02058, PAI-2, Plasminogen Activator Inhibitor-2 | 1e-04 | |
| cd02058 | 380 | cd02058, PAI-2, Plasminogen Activator Inhibitor-2 | 1e-04 | |
| cd02048 | 388 | cd02048, neuroserpin, Neuroserpin is a inhibitory | 1e-04 | |
| cd02059 | 389 | cd02059, ovalbumin_like, The ovalbumin_like group | 4e-04 | |
| cd02059 | 389 | cd02059, ovalbumin_like, The ovalbumin_like group | 4e-04 | |
| cd02043 | 381 | cd02043, plant_SERPIN, SERine Proteinase INhibitor | 4e-04 | |
| cd02043 | 381 | cd02043, plant_SERPIN, SERine Proteinase INhibitor | 5e-04 | |
| PHA02660 | 364 | PHA02660, PHA02660, serpin-like protein; Provision | 0.001 |
| >gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) | Back alignment and domain information |
|---|
Score = 145 bits (369), Expect = 2e-40
Identities = 53/153 (34%), Positives = 77/153 (50%), Gaps = 7/153 (4%)
Query: 162 RNEVYMYFILP-KNPDLSEFTKDLDYDKFSRIIES--TNKVDVIYTIPKMKVTSSTELRT 218
+ + M ILP + L E K L + + S KV +PK K+ SS +L+
Sbjct: 218 KGNLSMLIILPDEGGGLEELEKSLTAELLEEWLSSLKPRKVREELYLPKFKIESSYDLKE 277
Query: 219 VLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISK 278
VL + +T F SK+D S + + V +V HK IEV E+GT AAA+TG++I +
Sbjct: 278 VLKKLGITDAFS-SKADFSGISSSEPLYVSKVVHKAFIEVNEEGTEAAAATGVVIVPRAP 336
Query: 279 ---PTVKINRPFIFFIYHKPTDSIVFWGSIYKP 308
P +RPF+F I T SI+F G + P
Sbjct: 337 PPPPEFVADRPFLFLIRDNSTGSILFMGRVVNP 369
|
Structure is a multi-domain fold containing a bundle of helices and a beta sandwich. Length = 369 |
| >gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms | Back alignment and domain information |
|---|
| >gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|227163 COG4826, COG4826, Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) | Back alignment and domain information |
|---|
| >gnl|CDD|238999 cd02044, ov-serpin, ovalbumin family of serpins (ov-serpins) | Back alignment and domain information |
|---|
| >gnl|CDD|239006 cd02051, PAI-1_nexin-1, Plasminogen activator inhibitor-1_like | Back alignment and domain information |
|---|
| >gnl|CDD|239004 cd02049, bacterial_SERPIN, SERine Proteinase INhibitors (serpins), prokaryotic subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|239011 cd02056, alpha-1-antitrypsin_like, alpha-1-antitrypsin_like | Back alignment and domain information |
|---|
| >gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) | Back alignment and domain information |
|---|
| >gnl|CDD|239012 cd02057, maspin_like, Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages | Back alignment and domain information |
|---|
| >gnl|CDD|239000 cd02045, antithrombin-III_like, Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation | Back alignment and domain information |
|---|
| >gnl|CDD|239010 cd02055, PZI, Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) | Back alignment and domain information |
|---|
| >gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|239008 cd02053, alpha2AP, Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots | Back alignment and domain information |
|---|
| >gnl|CDD|239007 cd02052, PEDF, Pigment epithelium-derived factor (PEDF)_like | Back alignment and domain information |
|---|
| >gnl|CDD|165258 PHA02948, PHA02948, serine protease inhibitor-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|239002 cd02047, HCII, Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade | Back alignment and domain information |
|---|
| >gnl|CDD|239009 cd02054, angiotensinogen, Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis | Back alignment and domain information |
|---|
| >gnl|CDD|239005 cd02050, C1_inh, C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family | Back alignment and domain information |
|---|
| >gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms | Back alignment and domain information |
|---|
| >gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) | Back alignment and domain information |
|---|
| >gnl|CDD|215699 pfam00079, Serpin, Serpin (serine protease inhibitor) | Back alignment and domain information |
|---|
| >gnl|CDD|238101 cd00172, SERPIN, SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms | Back alignment and domain information |
|---|
| >gnl|CDD|239001 cd02046, hsp47, Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen | Back alignment and domain information |
|---|
| >gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|214513 smart00093, SERPIN, SERine Proteinase INhibitors | Back alignment and domain information |
|---|
| >gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) | Back alignment and domain information |
|---|
| >gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) | Back alignment and domain information |
|---|
| >gnl|CDD|239013 cd02058, PAI-2, Plasminogen Activator Inhibitor-2 (PAI-2) | Back alignment and domain information |
|---|
| >gnl|CDD|239003 cd02048, neuroserpin, Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) | Back alignment and domain information |
|---|
| >gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|239014 cd02059, ovalbumin_like, The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|238998 cd02043, plant_SERPIN, SERine Proteinase INhibitors (serpins), plant specific subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|165039 PHA02660, PHA02660, serpin-like protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 357 | |||
| cd02044 | 370 | ov-serpin ovalbumin family of serpins (ov-serpins) | 100.0 | |
| cd02057 | 372 | maspin_like Maspin (mammary serine proteinase inhi | 100.0 | |
| cd02048 | 388 | neuroserpin Neuroserpin is a inhibitory member of | 100.0 | |
| cd02054 | 372 | angiotensinogen Angiotensinogen is part of the ren | 100.0 | |
| COG4826 | 410 | Serine protease inhibitor [Posttranslational modif | 100.0 | |
| cd02051 | 377 | PAI-1_nexin-1 Plasminogen activator inhibitor-1_li | 100.0 | |
| KOG2392|consensus | 380 | 100.0 | ||
| cd02059 | 389 | ovalbumin_like The ovalbumin_like group of serpins | 100.0 | |
| cd02058 | 380 | PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2). P | 100.0 | |
| cd02046 | 366 | hsp47 Heat shock protein 47 (Hsp47), also called c | 100.0 | |
| cd02047 | 436 | HCII Heparin cofactor II (HCII) inhibits thrombin, | 100.0 | |
| cd02045 | 381 | antithrombin-III_like Antithrombin is a serine pro | 100.0 | |
| cd02052 | 374 | PEDF Pigment epithelium-derived factor (PEDF)_like | 100.0 | |
| PHA02948 | 373 | serine protease inhibitor-like protein; Provisiona | 100.0 | |
| cd02056 | 361 | alpha-1-antitrypsin_like alpha-1-antitrypsin_like. | 100.0 | |
| PF00079 | 371 | Serpin: Serpin (serine protease inhibitor); InterP | 100.0 | |
| cd00172 | 364 | SERPIN SERine Proteinase INhibitors (serpins) exhi | 100.0 | |
| smart00093 | 359 | SERPIN SERine Proteinase INhibitors. | 100.0 | |
| cd02049 | 364 | bacterial_SERPIN SERine Proteinase INhibitors (ser | 100.0 | |
| cd02055 | 365 | PZI Protein Z-dependent protease inhibitor (ZPI) i | 100.0 | |
| cd02053 | 351 | alpha2AP Alpha2-antiplasmin (alpha2AP) is the prim | 100.0 | |
| cd02050 | 352 | C1_inh C1 inhibitor (C1-Inh) is a protease inhibit | 100.0 | |
| cd02043 | 381 | plant_SERPIN SERine Proteinase INhibitors (serpins | 100.0 | |
| PHA02660 | 364 | serpin-like protein; Provisional | 100.0 |
| >cd02044 ov-serpin ovalbumin family of serpins (ov-serpins) | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.2e-59 Score=457.68 Aligned_cols=294 Identities=24% Similarity=0.454 Sum_probs=261.1
Q ss_pred HHhhHHHHHHHHHHHhccCCCCCEEEchhhHHHHHHHHHcCCCchhHHHHHHhhCCCch-------hhHHhhc---c-cc
Q psy5102 14 RGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATG-------RSLSNKL---T-AH 82 (357)
Q Consensus 14 ~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~eL~~~Lg~~~~-------~~ll~~l---~-~~ 82 (357)
.++++||++||+++... .+++|+|+||+||+.+|+|++.||+|+|++||.++||++.. +++++.+ + +.
T Consensus 3 ~~~~~F~~~l~~~~~~~-~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~el~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~ 81 (370)
T cd02044 3 LANSAFAVDVFKELSKK-SALQNVFFSPIAIMSSLAMVYLGAKGSTANQIGKVLHFDNVKDVHSSFQTLLSDINKLNSFY 81 (370)
T ss_pred chhhHHHHHHHHHHhhc-CCCCcEEECHHHHHHHHHHHhhhcCCcHHHHHHHHhCCCCHHHHHHHHHHHHHHHhcCCCCc
Confidence 46789999999999876 67899999999999999999999999999999999999762 3444444 2 44
Q ss_pred eeeee---eccc---------------------cCCH----HHH---HHHHH---hCCC-cccCCCCCCCccceeEeecc
Q psy5102 83 SLRRG---ITQM---------------------TLDM----ERA---IRSVM---TKNQ-NVVFAPLSIVGALALVLLGS 127 (357)
Q Consensus 83 ~l~~a---f~~~---------------------~~dF----~~a---IN~wv---T~g~-~~~l~~~~l~~~t~lvLvna 127 (357)
.++.+ |+++ .+|| +.+ ||+|| |+|+ ++++++.+++++++++|+||
T Consensus 82 ~l~~a~~~~~~~~~~l~~~f~~~~~~~~~~~~~~vdF~~~~~~a~~~IN~wv~~~T~g~I~~lv~~~~l~~~t~lvlvna 161 (370)
T cd02044 82 SLKLVNRLYGEKRYNFLPEFLSSTKKPYAKELETVDFKDKAEETRGQINSWIKDQTKGKIENLLPENSVDSQTAMVVVNA 161 (370)
T ss_pred eEeeeeehhhcCCCcccHHHHHHHHHhhccceEeccccCCHHHHHHHHHHHHHHhcCCchhhcCCCCCCCcchhheeeee
Confidence 56655 5554 5788 233 99999 9999 99999888999999999999
Q ss_pred -------cCCCCCCCceeeeeeec--------------c-cccccCCCCeEEEe--ecCCeEEEEEEec-CCCChhHHhh
Q psy5102 128 -------DGQTKDELTHFMGVATG--------------R-SLSNNPEAYASFLE--KMRNEVYMYFILP-KNPDLSEFTK 182 (357)
Q Consensus 128 -------~~~F~~~~T~~~~F~~~--------------~-~~~~~~~~~~~vve--y~~~~~sm~iiLP-~~~~L~~l~~ 182 (357)
++||++..|..++||.. . +|++.+++++++|+ |++++++|+|||| +..+|.++++
T Consensus 162 i~Fkg~W~~~F~~~~T~~~~F~~~~~~~~~V~mM~~~~~~~~~~~~~~~~~vv~LPy~~~~~sm~iiLP~~~~~l~~l~~ 241 (370)
T cd02044 162 AYFKGKWMKKFSEEETKESPFRVNKTETKPVQMMYMEATFNMGNIESLKMKILELPFANKDLSMFILLPDEVTGLEKLES 241 (370)
T ss_pred eeEcccccCCCChhhCccCcCCcCCCcEEEeeCccccCceeeEEcCCCCeEEEEcccCCCceEEEEEcCCCCCcHHHHHH
Confidence 89999999999999975 2 56677889999999 9988999999999 8899999999
Q ss_pred ccChhHHHHHHH--hcCceeEEEEeceeeEeeccchHHHhhhCCccccCCCCCCCCCCCCCCCCceeeeeeEEEEEEEcc
Q psy5102 183 DLDYDKFSRIIE--STNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTE 260 (357)
Q Consensus 183 ~L~~~~l~~~~~--~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGl~~~F~~~~adfs~is~~~~l~vs~v~qk~~iev~E 260 (357)
.|+.+.+..|.. +++.+.|+|+||||++++++||+++|++||++.+|++..|||++|+++.+++|++|+|++.|+|||
T Consensus 242 ~l~~~~l~~~~~~~~~~~~~v~l~lPkF~i~~~~~l~~~L~~mGl~~~F~~~~Adfs~ms~~~~l~vs~v~qka~ievdE 321 (370)
T cd02044 242 EINYEKLNKWTSPSTMAEAKVKVYLPRFKMEKMYDLKSVLESLGMKDAFSEGRANFSGMSETKGLALSNVIHKASLEINE 321 (370)
T ss_pred HhCHHHHHHhhccccceeeEEEEEeeEEEEeeEEccHHHHHHcCchhhCCCCCCChhhcCCCCCeeEeeeeEeeEEEECC
Confidence 999999999974 677889999999999999999999999999999999756999999976689999999999999999
Q ss_pred Cccccccccceeee-ecCCCEEEEcCceEEEEEECCCCcEEEEEEEcCC
Q psy5102 261 QGTVAAASTGIIIT-RISKPTVKINRPFIFFIYHKPTDSIVFWGSIYKP 308 (357)
Q Consensus 261 ~G~~aaa~t~~~~~-~s~~~~f~~nrPFlf~I~d~~t~~iLF~G~v~~P 308 (357)
+|++|+|+|...+. ++.+.+|++||||+|+|+|+.||.|||+|+|.+|
T Consensus 322 ~Gt~aaa~t~~~~~~~~~~~~f~~drPF~f~I~~~~t~~iLF~G~v~~P 370 (370)
T cd02044 322 DGTEAAEVTGAVMLQRSVKEEFNADHPFLFIIRHNKTNCILFFGKFSSP 370 (370)
T ss_pred CccccccccceeeeccCCCCeEEeeCCEEEEEEECCCCeEEEEEEecCC
Confidence 99999999987555 5556789999999999999999999999999998
|
Family of closely related proteins, whose members can be secreted (ovalbumin), cytosolic (leukocyte elastase inhibitor, LEI), or targeted to both compartments (plasminogen activator inhibitor 2, PAI-2). This subgroup corresponds to clade B of the serpin superfamily. In general, serpins exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms. Many serpins, such as antitrypsin and antichymotrypsin, function as serine protease inhibitors which regulate blood coagulation cascades. Non-inhibitory serpins perform many diverse functions such as chaperoning proteins or transporting hormones. Serpins are of medical interest because mutants can cause blood clotting disorders, emphysema, cirrhosis, and dementia. |
| >cd02057 maspin_like Maspin (mammary serine proteinase inhibitor), a member of the serpin superfamily, with a multitude of effects on cells and tissues at an assortment of developmental stages | Back alignment and domain information |
|---|
| >cd02048 neuroserpin Neuroserpin is a inhibitory member of the SERine Proteinase INhibitor (serpin) family that reacts preferentially with tissue-type plasminogen activator (tPA) | Back alignment and domain information |
|---|
| >cd02054 angiotensinogen Angiotensinogen is part of the renin-angiotensin system (RAS), which plays an important role in blood pressure regulation, renal haemodynamics, fluid and electrolyte homeostasis | Back alignment and domain information |
|---|
| >COG4826 Serine protease inhibitor [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02051 PAI-1_nexin-1 Plasminogen activator inhibitor-1_like | Back alignment and domain information |
|---|
| >KOG2392|consensus | Back alignment and domain information |
|---|
| >cd02059 ovalbumin_like The ovalbumin_like group of serpins contains ovalbumin, the squamous cell carcinoma antigen 1 (SCCA1) and other closely related serpins of clade B of the serpin superfamily | Back alignment and domain information |
|---|
| >cd02058 PAI-2 Plasminogen Activator Inhibitor-2 (PAI-2) | Back alignment and domain information |
|---|
| >cd02046 hsp47 Heat shock protein 47 (Hsp47), also called colligin, because of its collagen binding ability, is a chaperone specific for procollagen | Back alignment and domain information |
|---|
| >cd02047 HCII Heparin cofactor II (HCII) inhibits thrombin, the final protease of the coagulation cascade | Back alignment and domain information |
|---|
| >cd02045 antithrombin-III_like Antithrombin is a serine proteinase inhibitor (serpin) which controls the process of coagulation | Back alignment and domain information |
|---|
| >cd02052 PEDF Pigment epithelium-derived factor (PEDF)_like | Back alignment and domain information |
|---|
| >PHA02948 serine protease inhibitor-like protein; Provisional | Back alignment and domain information |
|---|
| >cd02056 alpha-1-antitrypsin_like alpha-1-antitrypsin_like | Back alignment and domain information |
|---|
| >PF00079 Serpin: Serpin (serine protease inhibitor); InterPro: IPR023796 Peptide proteinase inhibitors can be found as single domain proteins or as single or multiple domains within proteins; these are referred to as either simple or compound inhibitors, respectively | Back alignment and domain information |
|---|
| >cd00172 SERPIN SERine Proteinase INhibitors (serpins) exhibit conformational polymorphism shifting from native to cleaved, latent, delta, or polymorphic forms | Back alignment and domain information |
|---|
| >smart00093 SERPIN SERine Proteinase INhibitors | Back alignment and domain information |
|---|
| >cd02049 bacterial_SERPIN SERine Proteinase INhibitors (serpins), prokaryotic subgroup | Back alignment and domain information |
|---|
| >cd02055 PZI Protein Z-dependent protease inhibitor (ZPI) is a member of the serpin superfamily of proteinase inhibitors (clade A10) | Back alignment and domain information |
|---|
| >cd02053 alpha2AP Alpha2-antiplasmin (alpha2AP) is the primary inhibitor of plasmin, a proteinase that digests fibrin, the main component of blood clots | Back alignment and domain information |
|---|
| >cd02050 C1_inh C1 inhibitor (C1-Inh) is a protease inhibitor of the serpin family | Back alignment and domain information |
|---|
| >cd02043 plant_SERPIN SERine Proteinase INhibitors (serpins), plant specific subgroup | Back alignment and domain information |
|---|
| >PHA02660 serpin-like protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 357 | ||||
| 4dy0_A | 379 | Crystal Structure Of Native Protease Nexin-1 With H | 2e-16 | ||
| 1c5g_A | 402 | Plasminogen Activator Inhibitor-1 Length = 402 | 6e-16 | ||
| 4aqh_A | 383 | Plasminogen Activator Inhibitor Type-1 In Complex W | 8e-16 | ||
| 3q02_A | 379 | Crystal Structure Of Plasminogen Activator Inhibito | 8e-16 | ||
| 3lw2_A | 379 | Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Len | 8e-16 | ||
| 1dvn_A | 379 | Latent Form Of Plasminogen Activator Inhibitor-1 (P | 9e-16 | ||
| 3nda_A | 377 | Crystal Structure Of Serpin From Tick Ixodes Ricinu | 2e-15 | ||
| 1dvm_A | 379 | Active Form Of Human Pai-1 Length = 379 | 3e-15 | ||
| 3cvm_A | 392 | High Resolution Structure Of A Stable Plasminogen A | 3e-15 | ||
| 3eox_A | 379 | High Quality Structure Of Cleaved Pai-1-Stab Length | 3e-15 | ||
| 1by7_A | 382 | Human Plasminogen Activator Inhibitor-2. Loop (66-9 | 3e-15 | ||
| 2arq_A | 382 | Human Plasminogen Activator Inhibitor-2.[loop (66-9 | 3e-15 | ||
| 3ut3_A | 375 | A Novel Pai-i Inhibitor And Its Structural Mechanis | 3e-15 | ||
| 1db2_A | 377 | Crystal Structure Of Native Plasminogen Activator I | 3e-15 | ||
| 1b3k_A | 379 | Plasminogen Activator Inhibitor-1 Length = 379 | 4e-15 | ||
| 1a7c_A | 379 | Human Plasminogen Activator Inhibitor Type-1 In Com | 4e-15 | ||
| 3r4l_A | 379 | Human Very Long Half Life Plasminogen Activator Inh | 7e-15 | ||
| 4if8_A | 414 | Structure Of Vaspin Length = 414 | 9e-15 | ||
| 1oo8_A | 394 | Crystal Structure Of A1pi-Pittsburgh In The Native | 7e-14 | ||
| 3t1p_A | 371 | Crystal Structure Of An Alpha-1-Antitrypsin Trimer | 1e-13 | ||
| 2dut_A | 423 | Crystal Structure Of A M-Loop Deletion Variant Of M | 1e-13 | ||
| 2b4x_I | 427 | Crystal Structure Of Antithrombin-Iii Length = 427 | 2e-13 | ||
| 3kcg_I | 432 | Crystal Structure Of The Antithrombin-Factor Ixa- P | 2e-13 | ||
| 2b4x_L | 427 | Crystal Structure Of Antithrombin-Iii Length = 427 | 2e-13 | ||
| 1ath_A | 432 | The Intact And Cleaved Human Antithrombin Iii Compl | 2e-13 | ||
| 2h4r_A | 415 | Crystal Structure Of Wildtype Ment In The Native Co | 2e-13 | ||
| 4eb1_I | 440 | Hyperstable In-Frame Insertion Variant Of Antithrom | 2e-13 | ||
| 1dzg_I | 432 | N135q-S380c-Antithrombin-Iii Length = 432 | 2e-13 | ||
| 1atu_A | 374 | Uncleaved Alpha-1-Antitrypsin Length = 374 | 2e-13 | ||
| 3ne4_A | 424 | 1.8 Angstrom Structure Of Intact Native Wild-Type A | 3e-13 | ||
| 2hij_I | 432 | Crystal Structure Of P14 Alanine Variant Of Antithr | 3e-13 | ||
| 1kct_A | 394 | Alpha1-Antitrypsin Length = 394 | 3e-13 | ||
| 1psi_A | 394 | Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 | 3e-13 | ||
| 3drm_A | 404 | 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- | 3e-13 | ||
| 1qlp_A | 394 | 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsi | 3e-13 | ||
| 1dzh_I | 432 | P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length | 3e-13 | ||
| 3dru_A | 404 | Crystal Structure Of Gly117phe Alpha1-Antitrypsin L | 3e-13 | ||
| 2qug_A | 394 | Crystal Structure Of Alpha-1-Antitrypsin, Crystal F | 3e-13 | ||
| 1hp7_A | 394 | A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-An | 4e-13 | ||
| 2hi9_A | 363 | Crystal Structure Of Human Native Protein C Inhibit | 5e-13 | ||
| 2ol2_A | 395 | High Resolution Structure Of Native Pci In Space Gr | 7e-13 | ||
| 2gd4_I | 443 | Crystal Structure Of The Antithrombin-S195a Factor | 8e-13 | ||
| 1tb6_I | 432 | 2.5a Crystal Structure Of The Antithrombin-Thrombin | 9e-13 | ||
| 1iz2_A | 394 | Interactions Causing The Kinetic Trap In Serpin Pro | 1e-12 | ||
| 1xu8_A | 380 | The 2.8 A Structure Of A Tumour Suppressing Serpin | 2e-12 | ||
| 1wz9_A | 375 | The 2.1 A Structure Of A Tumour Suppressing Serpin | 3e-12 | ||
| 1xqg_A | 389 | 3.10 A Crystal Structure Of Maspin, Space Group P 4 | 5e-12 | ||
| 3f5n_A | 407 | Structure Of Native Human Neuroserpin Length = 407 | 6e-12 | ||
| 3fgq_A | 397 | Crystal Structure Of Native Human Neuroserpin Lengt | 6e-12 | ||
| 1qmn_A | 401 | Alpha1-Antichymotrypsin Serpin In The Delta Conform | 4e-11 | ||
| 2pee_A | 387 | Crystal Structure Of A Thermophilic Serpin, Tengpin | 1e-10 | ||
| 2pef_A | 373 | Crystal Structure Of A Thermophilic Serpin, Tengpin | 1e-10 | ||
| 2vh4_A | 381 | Structure Of A Loop C-sheet Serpin Polymer Length = | 1e-10 | ||
| 1att_A | 429 | Crystal Structure Of Cleaved Bovine Antithrombin Ii | 2e-10 | ||
| 3vvj_A | 392 | Structure Of Ovalbumin From Emu (Dromaius Novaeholl | 3e-10 | ||
| 3dlw_A | 411 | Antichymotrypsin Length = 411 | 3e-10 | ||
| 4ajt_A | 427 | The Cystal Structure Of Mouse Protein-Z Dependent P | 1e-09 | ||
| 3pzf_A | 397 | 1.75a Resolution Structure Of Serpin-2 From Anophel | 2e-09 | ||
| 2r9y_A | 430 | Structure Of Antiplasmin Length = 430 | 5e-09 | ||
| 2vdx_A | 373 | Crystal Structure Of The Reactive Loop Cleaved Cort | 5e-09 | ||
| 2h4p_A | 394 | Crystal Structure Of Wildtype Ment In The Cleaved C | 1e-08 | ||
| 1jti_A | 385 | Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin | 1e-08 | ||
| 1oyh_I | 432 | Crystal Structure Of P13 Alanine Variant Of Antithr | 1e-08 | ||
| 1lq8_A | 346 | Crystal Structure Of Cleaved Protein C Inhibitor Le | 2e-08 | ||
| 3dy0_A | 336 | Crystal Structure Of Cleaved Pci Bound To Heparin L | 2e-08 | ||
| 3f1s_A | 385 | Crystal Structure Of Protein Z Complexed With Prote | 3e-08 | ||
| 3h5c_A | 423 | X-Ray Structure Of Protein Z-Protein Z Inhibitor Co | 4e-08 | ||
| 1ova_C | 386 | Crystal Structure Of Uncleaved Ovalbumin At 1.95 An | 4e-08 | ||
| 2h4q_A | 382 | Crystal Structure Of A M-Loop Deletion Variant Of M | 4e-08 | ||
| 2ceo_A | 379 | Thyroxine-Binding Globulin Complex With Thyroxine L | 6e-08 | ||
| 1ova_A | 386 | Crystal Structure Of Uncleaved Ovalbumin At 1.95 An | 7e-08 | ||
| 1ova_B | 386 | Crystal Structure Of Uncleaved Ovalbumin At 1.95 An | 7e-08 | ||
| 1imv_A | 398 | 2.85 A Crystal Structure Of Pedf Length = 398 | 7e-08 | ||
| 1uhg_A | 385 | Crystal Structure Of S-ovalbumin At 1.9 Angstrom Re | 9e-08 | ||
| 9pai_A | 346 | Cleaved Substrate Variant Of Plasminogen Activator | 2e-07 | ||
| 4ga7_A | 389 | Crystal Structure Of Human Serpinb1 Mutant Length = | 4e-07 | ||
| 1d5s_A | 334 | Crystal Structure Of Cleaved Antitrypsin Polymer Le | 5e-07 | ||
| 1ezx_A | 335 | Crystal Structure Of A Serpin:protease Complex Leng | 5e-07 | ||
| 7api_A | 347 | The S Variant Of Human Alpha1-Antitrypsin, Structur | 6e-07 | ||
| 2d26_A | 358 | Active Site Distortion Is Sufficient For Proteinase | 6e-07 | ||
| 3ndf_A | 343 | Cleaved Antitrypsin With P8-P6 Asp Length = 343 | 6e-07 | ||
| 2zv6_A | 401 | Crystal Structure Of Human Squamous Cell Carcinoma | 8e-07 | ||
| 1jmo_A | 480 | Crystal Structure Of The Heparin Cofactor Ii-S195a | 9e-07 | ||
| 1jmj_A | 480 | Crystal Structure Of Native Heparin Cofactor Ii Len | 1e-06 | ||
| 3ndd_A | 343 | Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Len | 1e-06 | ||
| 2ach_A | 360 | Crystal Structure Of Cleaved Human Alpha1-antichymo | 1e-06 | ||
| 3le2_A | 393 | Structure Of Arabidopsis Atserpin1. Native Stressed | 2e-06 | ||
| 1qmb_A | 326 | Cleaved Alpha-1-Antitrypsin Polymer Length = 326 | 3e-06 | ||
| 1c8o_A | 300 | 2.9 A Structure Of Cleaved Viral Serpin Crma Length | 6e-06 | ||
| 1m93_B | 245 | 1.65 A Structure Of Cleaved Viral Serpin Crma Lengt | 6e-06 | ||
| 4caa_A | 341 | Cleaved Antichymotrypsin T345r Length = 341 | 7e-06 | ||
| 1jjo_C | 261 | Crystal Structure Of Mouse Neuroserpin (Cleaved For | 7e-06 | ||
| 3caa_A | 341 | Cleaved Antichymotrypsin A347r Length = 341 | 8e-06 | ||
| 1as4_A | 341 | Cleaved Antichymotrypsin A349r Length = 341 | 8e-06 | ||
| 2v95_A | 371 | Struture Of Corticosteroid-Binding Globulin In Comp | 2e-05 | ||
| 4bb2_A | 340 | Crystal Structure Of Cleaved Corticosteroid-binding | 2e-05 | ||
| 3f02_A | 359 | Cleaved Human Neuroserpin Length = 359 | 3e-05 | ||
| 1k9o_I | 378 | Crystal Structure Of Michaelis Serpin-Trypsin Compl | 3e-05 | ||
| 1sek_A | 378 | The Structure Of Active Serpin K From Manduca Sexta | 3e-05 | ||
| 1f0c_A | 305 | Structure Of The Viral Serpin Crma Length = 305 | 1e-04 | ||
| 2oay_A | 390 | Crystal Structure Of Latent Human C1-Inhibitor Leng | 2e-04 |
| >pdb|4DY0|A Chain A, Crystal Structure Of Native Protease Nexin-1 With Heparin Length = 379 | Back alignment and structure |
|
| >pdb|1C5G|A Chain A, Plasminogen Activator Inhibitor-1 Length = 402 | Back alignment and structure |
| >pdb|4AQH|A Chain A, Plasminogen Activator Inhibitor Type-1 In Complex With The Inhibitor Az3976 Length = 383 | Back alignment and structure |
| >pdb|3Q02|A Chain A, Crystal Structure Of Plasminogen Activator Inhibitor-1 In A Metastable Active Conformation. Length = 379 | Back alignment and structure |
| >pdb|3LW2|A Chain A, Mouse Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 | Back alignment and structure |
| >pdb|1DVN|A Chain A, Latent Form Of Plasminogen Activator Inhibitor-1 (Pai-1) Length = 379 | Back alignment and structure |
| >pdb|3NDA|A Chain A, Crystal Structure Of Serpin From Tick Ixodes Ricinus Length = 377 | Back alignment and structure |
| >pdb|1DVM|A Chain A, Active Form Of Human Pai-1 Length = 379 | Back alignment and structure |
| >pdb|3CVM|A Chain A, High Resolution Structure Of A Stable Plasminogen Activator Inhibitor Type-1 In Its Protease Cleaved Form Length = 392 | Back alignment and structure |
| >pdb|3EOX|A Chain A, High Quality Structure Of Cleaved Pai-1-Stab Length = 379 | Back alignment and structure |
| >pdb|1BY7|A Chain A, Human Plasminogen Activator Inhibitor-2. Loop (66-98) Deletion Mutant Length = 382 | Back alignment and structure |
| >pdb|2ARQ|A Chain A, Human Plasminogen Activator Inhibitor-2.[loop (66-98) Deletion Mutant] Complexed With Peptide N-Acetyl-Teaaagdggvmtgr-Oh Length = 382 | Back alignment and structure |
| >pdb|3UT3|A Chain A, A Novel Pai-i Inhibitor And Its Structural Mechanism Length = 375 | Back alignment and structure |
| >pdb|1DB2|A Chain A, Crystal Structure Of Native Plasminogen Activator Inhibitor- 1 Length = 377 | Back alignment and structure |
| >pdb|1B3K|A Chain A, Plasminogen Activator Inhibitor-1 Length = 379 | Back alignment and structure |
| >pdb|1A7C|A Chain A, Human Plasminogen Activator Inhibitor Type-1 In Complex With A Pentapeptide Length = 379 | Back alignment and structure |
| >pdb|3R4L|A Chain A, Human Very Long Half Life Plasminogen Activator Inhibitor Type-1 Length = 379 | Back alignment and structure |
| >pdb|4IF8|A Chain A, Structure Of Vaspin Length = 414 | Back alignment and structure |
| >pdb|1OO8|A Chain A, Crystal Structure Of A1pi-Pittsburgh In The Native Conformation Length = 394 | Back alignment and structure |
| >pdb|3T1P|A Chain A, Crystal Structure Of An Alpha-1-Antitrypsin Trimer Length = 371 | Back alignment and structure |
| >pdb|2DUT|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Native Conformation Length = 423 | Back alignment and structure |
| >pdb|2B4X|I Chain I, Crystal Structure Of Antithrombin-Iii Length = 427 | Back alignment and structure |
| >pdb|3KCG|I Chain I, Crystal Structure Of The Antithrombin-Factor Ixa- Pentasaccharide Complex Length = 432 | Back alignment and structure |
| >pdb|2B4X|L Chain L, Crystal Structure Of Antithrombin-Iii Length = 427 | Back alignment and structure |
| >pdb|1ATH|A Chain A, The Intact And Cleaved Human Antithrombin Iii Complex As A Model For Serpin-Proteinase Interactions Length = 432 | Back alignment and structure |
| >pdb|2H4R|A Chain A, Crystal Structure Of Wildtype Ment In The Native Conformation Length = 415 | Back alignment and structure |
| >pdb|4EB1|I Chain I, Hyperstable In-Frame Insertion Variant Of Antithrombin Length = 440 | Back alignment and structure |
| >pdb|1DZG|I Chain I, N135q-S380c-Antithrombin-Iii Length = 432 | Back alignment and structure |
| >pdb|1ATU|A Chain A, Uncleaved Alpha-1-Antitrypsin Length = 374 | Back alignment and structure |
| >pdb|3NE4|A Chain A, 1.8 Angstrom Structure Of Intact Native Wild-Type Alpha-1-Antitrypsin Length = 424 | Back alignment and structure |
| >pdb|2HIJ|I Chain I, Crystal Structure Of P14 Alanine Variant Of Antithrombin Length = 432 | Back alignment and structure |
| >pdb|1KCT|A Chain A, Alpha1-Antitrypsin Length = 394 | Back alignment and structure |
| >pdb|1PSI|A Chain A, Intact Recombined Alpha1-Antitrypsin Mutant Phe 51 To Leu Length = 394 | Back alignment and structure |
| >pdb|3DRM|A Chain A, 2.2 Angstrom Crystal Structure Of Thr114phe Alpha1- Antitrypsin Length = 404 | Back alignment and structure |
| >pdb|1QLP|A Chain A, 2.0 Angstrom Structure Of Intact Alpha-1-Antitrypsin: A Canonical Template For Active Serpins Length = 394 | Back alignment and structure |
| >pdb|1DZH|I Chain I, P14-Fluorescein-N135q-S380c-Antithrombin-Iii Length = 432 | Back alignment and structure |
| >pdb|3DRU|A Chain A, Crystal Structure Of Gly117phe Alpha1-Antitrypsin Length = 404 | Back alignment and structure |
| >pdb|2QUG|A Chain A, Crystal Structure Of Alpha-1-Antitrypsin, Crystal Form A Length = 394 | Back alignment and structure |
| >pdb|1HP7|A Chain A, A 2.1 Angstrom Structure Of An Uncleaved Alpha-1-Antitrypsin Shows Variability Of The Reactive Center And Other Loops Length = 394 | Back alignment and structure |
| >pdb|2HI9|A Chain A, Crystal Structure Of Human Native Protein C Inhibitor Length = 363 | Back alignment and structure |
| >pdb|2OL2|A Chain A, High Resolution Structure Of Native Pci In Space Group P21 Length = 395 | Back alignment and structure |
| >pdb|2GD4|I Chain I, Crystal Structure Of The Antithrombin-S195a Factor Xa-Pentasaccharide Complex Length = 443 | Back alignment and structure |
| >pdb|1TB6|I Chain I, 2.5a Crystal Structure Of The Antithrombin-Thrombin-Heparin Ternary Complex Length = 432 | Back alignment and structure |
| >pdb|1IZ2|A Chain A, Interactions Causing The Kinetic Trap In Serpin Protein Folding Length = 394 | Back alignment and structure |
| >pdb|1XU8|A Chain A, The 2.8 A Structure Of A Tumour Suppressing Serpin Length = 380 | Back alignment and structure |
| >pdb|1WZ9|A Chain A, The 2.1 A Structure Of A Tumour Suppressing Serpin Length = 375 | Back alignment and structure |
| >pdb|1XQG|A Chain A, 3.10 A Crystal Structure Of Maspin, Space Group P 4 21 2 Length = 389 | Back alignment and structure |
| >pdb|3F5N|A Chain A, Structure Of Native Human Neuroserpin Length = 407 | Back alignment and structure |
| >pdb|3FGQ|A Chain A, Crystal Structure Of Native Human Neuroserpin Length = 397 | Back alignment and structure |
| >pdb|1QMN|A Chain A, Alpha1-Antichymotrypsin Serpin In The Delta Conformation (Partial Loop Insertion) Length = 401 | Back alignment and structure |
| >pdb|2PEE|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Native State Length = 387 | Back alignment and structure |
| >pdb|2PEF|A Chain A, Crystal Structure Of A Thermophilic Serpin, Tengpin, In The Latent State Length = 373 | Back alignment and structure |
| >pdb|2VH4|A Chain A, Structure Of A Loop C-sheet Serpin Polymer Length = 381 | Back alignment and structure |
| >pdb|1ATT|A Chain A, Crystal Structure Of Cleaved Bovine Antithrombin Iii At 3.2 Angstroms Resolution Length = 429 | Back alignment and structure |
| >pdb|3VVJ|A Chain A, Structure Of Ovalbumin From Emu (Dromaius Novaehollandiae) Length = 392 | Back alignment and structure |
| >pdb|3DLW|A Chain A, Antichymotrypsin Length = 411 | Back alignment and structure |
| >pdb|4AJT|A Chain A, The Cystal Structure Of Mouse Protein-Z Dependent Protease Inhibitor(Mzpi) Length = 427 | Back alignment and structure |
| >pdb|3PZF|A Chain A, 1.75a Resolution Structure Of Serpin-2 From Anopheles Gambiae Length = 397 | Back alignment and structure |
| >pdb|2R9Y|A Chain A, Structure Of Antiplasmin Length = 430 | Back alignment and structure |
| >pdb|2VDX|A Chain A, Crystal Structure Of The Reactive Loop Cleaved Corticosteroid Binding Globulin Length = 373 | Back alignment and structure |
| >pdb|2H4P|A Chain A, Crystal Structure Of Wildtype Ment In The Cleaved Conformation Length = 394 | Back alignment and structure |
| >pdb|1JTI|A Chain A, Loop-Inserted Structure Of P1-P1' Cleaved Ovalbumin Mutant R339t Length = 385 | Back alignment and structure |
| >pdb|1OYH|I Chain I, Crystal Structure Of P13 Alanine Variant Of Antithrombin Length = 432 | Back alignment and structure |
| >pdb|1LQ8|A Chain A, Crystal Structure Of Cleaved Protein C Inhibitor Length = 346 | Back alignment and structure |
| >pdb|3DY0|A Chain A, Crystal Structure Of Cleaved Pci Bound To Heparin Length = 336 | Back alignment and structure |
| >pdb|3F1S|A Chain A, Crystal Structure Of Protein Z Complexed With Protein Z-Dependent Inhibitor Length = 385 | Back alignment and structure |
| >pdb|3H5C|A Chain A, X-Ray Structure Of Protein Z-Protein Z Inhibitor Complex Length = 423 | Back alignment and structure |
| >pdb|1OVA|C Chain C, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 | Back alignment and structure |
| >pdb|2H4Q|A Chain A, Crystal Structure Of A M-Loop Deletion Variant Of Ment In The Cleaved Conformation Length = 382 | Back alignment and structure |
| >pdb|2CEO|A Chain A, Thyroxine-Binding Globulin Complex With Thyroxine Length = 379 | Back alignment and structure |
| >pdb|1OVA|A Chain A, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 | Back alignment and structure |
| >pdb|1OVA|B Chain B, Crystal Structure Of Uncleaved Ovalbumin At 1.95 Angstroms Resolution Length = 386 | Back alignment and structure |
| >pdb|1IMV|A Chain A, 2.85 A Crystal Structure Of Pedf Length = 398 | Back alignment and structure |
| >pdb|1UHG|A Chain A, Crystal Structure Of S-ovalbumin At 1.9 Angstrom Resolution Length = 385 | Back alignment and structure |
| >pdb|9PAI|A Chain A, Cleaved Substrate Variant Of Plasminogen Activator Inhibitor-1 Length = 346 | Back alignment and structure |
| >pdb|4GA7|A Chain A, Crystal Structure Of Human Serpinb1 Mutant Length = 389 | Back alignment and structure |
| >pdb|1D5S|A Chain A, Crystal Structure Of Cleaved Antitrypsin Polymer Length = 334 | Back alignment and structure |
| >pdb|1EZX|A Chain A, Crystal Structure Of A Serpin:protease Complex Length = 335 | Back alignment and structure |
| >pdb|7API|A Chain A, The S Variant Of Human Alpha1-Antitrypsin, Structure And Implications For Function And Metabolism Length = 347 | Back alignment and structure |
| >pdb|2D26|A Chain A, Active Site Distortion Is Sufficient For Proteinase Inhibit Second Crystal Structure Of Covalent Serpin-Proteinase Complex Length = 358 | Back alignment and structure |
| >pdb|3NDF|A Chain A, Cleaved Antitrypsin With P8-P6 Asp Length = 343 | Back alignment and structure |
| >pdb|2ZV6|A Chain A, Crystal Structure Of Human Squamous Cell Carcinoma Antigen 1 Length = 401 | Back alignment and structure |
| >pdb|1JMO|A Chain A, Crystal Structure Of The Heparin Cofactor Ii-S195a Thrombin Complex Length = 480 | Back alignment and structure |
| >pdb|1JMJ|A Chain A, Crystal Structure Of Native Heparin Cofactor Ii Length = 480 | Back alignment and structure |
| >pdb|3NDD|A Chain A, Cleaved Antitrypsin With P10 Pro, And P9-P6 Asp Length = 343 | Back alignment and structure |
| >pdb|2ACH|A Chain A, Crystal Structure Of Cleaved Human Alpha1-antichymotrypsin At 2.7 Angstroms Resolution And Its Comparison With Other Serpins Length = 360 | Back alignment and structure |
| >pdb|3LE2|A Chain A, Structure Of Arabidopsis Atserpin1. Native Stressed Conforma Length = 393 | Back alignment and structure |
| >pdb|1QMB|A Chain A, Cleaved Alpha-1-Antitrypsin Polymer Length = 326 | Back alignment and structure |
| >pdb|1C8O|A Chain A, 2.9 A Structure Of Cleaved Viral Serpin Crma Length = 300 | Back alignment and structure |
| >pdb|1M93|B Chain B, 1.65 A Structure Of Cleaved Viral Serpin Crma Length = 245 | Back alignment and structure |
| >pdb|4CAA|A Chain A, Cleaved Antichymotrypsin T345r Length = 341 | Back alignment and structure |
| >pdb|1JJO|C Chain C, Crystal Structure Of Mouse Neuroserpin (Cleaved Form) Length = 261 | Back alignment and structure |
| >pdb|3CAA|A Chain A, Cleaved Antichymotrypsin A347r Length = 341 | Back alignment and structure |
| >pdb|1AS4|A Chain A, Cleaved Antichymotrypsin A349r Length = 341 | Back alignment and structure |
| >pdb|2V95|A Chain A, Struture Of Corticosteroid-Binding Globulin In Complex With Cortisol Length = 371 | Back alignment and structure |
| >pdb|4BB2|A Chain A, Crystal Structure Of Cleaved Corticosteroid-binding Globulin In Complex With Progesterone Length = 340 | Back alignment and structure |
| >pdb|3F02|A Chain A, Cleaved Human Neuroserpin Length = 359 | Back alignment and structure |
| >pdb|1K9O|I Chain I, Crystal Structure Of Michaelis Serpin-Trypsin Complex Length = 378 | Back alignment and structure |
| >pdb|1SEK|A Chain A, The Structure Of Active Serpin K From Manduca Sexta And A Model For Serpin-Protease Complex Formation Length = 378 | Back alignment and structure |
| >pdb|1F0C|A Chain A, Structure Of The Viral Serpin Crma Length = 305 | Back alignment and structure |
| >pdb|2OAY|A Chain A, Crystal Structure Of Latent Human C1-Inhibitor Length = 390 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 357 | |||
| 4au2_A | 392 | HSP47, serpin peptidase inhibitor, clade H (heat s | 9e-46 | |
| 4au2_A | 392 | HSP47, serpin peptidase inhibitor, clade H (heat s | 8e-07 | |
| 4au2_A | 392 | HSP47, serpin peptidase inhibitor, clade H (heat s | 3e-05 | |
| 1lj5_A | 379 | Plasminogen activator inhibitor-1; beta-barrell, b | 3e-44 | |
| 1lj5_A | 379 | Plasminogen activator inhibitor-1; beta-barrell, b | 1e-06 | |
| 1lj5_A | 379 | Plasminogen activator inhibitor-1; beta-barrell, b | 2e-05 | |
| 2vdx_A | 373 | Corticosteroid-binding globulin; transport protein | 5e-44 | |
| 2vdx_A | 373 | Corticosteroid-binding globulin; transport protein | 4e-07 | |
| 2vdx_A | 373 | Corticosteroid-binding globulin; transport protein | 7e-06 | |
| 3ne4_A | 424 | Alpha-1-antitrypsin; serpin, LUNG disease, liver d | 5e-44 | |
| 3ne4_A | 424 | Alpha-1-antitrypsin; serpin, LUNG disease, liver d | 1e-06 | |
| 3ne4_A | 424 | Alpha-1-antitrypsin; serpin, LUNG disease, liver d | 2e-05 | |
| 4dy0_A | 379 | GLIA-derived nexin; serpin, protease inhibitor, th | 3e-43 | |
| 4dy0_A | 379 | GLIA-derived nexin; serpin, protease inhibitor, th | 4e-07 | |
| 4dy0_A | 379 | GLIA-derived nexin; serpin, protease inhibitor, th | 3e-06 | |
| 3f5n_A | 407 | Neuroserpin; cleaved form, fenib, human, tissue PL | 9e-43 | |
| 3f5n_A | 407 | Neuroserpin; cleaved form, fenib, human, tissue PL | 3e-07 | |
| 3f5n_A | 407 | Neuroserpin; cleaved form, fenib, human, tissue PL | 3e-06 | |
| 1yxa_A | 398 | Serine (OR cysteine) proteinase inhibitor, clade 3 | 9e-43 | |
| 1yxa_A | 398 | Serine (OR cysteine) proteinase inhibitor, clade 3 | 1e-06 | |
| 1yxa_A | 398 | Serine (OR cysteine) proteinase inhibitor, clade 3 | 2e-05 | |
| 2ceo_A | 379 | Thyroxine-binding globulin; transport, serpin, hor | 1e-42 | |
| 2ceo_A | 379 | Thyroxine-binding globulin; transport, serpin, hor | 4e-07 | |
| 2ceo_A | 379 | Thyroxine-binding globulin; transport, serpin, hor | 7e-06 | |
| 2pef_A | 373 | Serine protease inhibitor; serpin; 1.60A {Thermoan | 1e-42 | |
| 2pef_A | 373 | Serine protease inhibitor; serpin; 1.60A {Thermoan | 1e-06 | |
| 2pef_A | 373 | Serine protease inhibitor; serpin; 1.60A {Thermoan | 3e-06 | |
| 3kcg_I | 432 | Antithrombin-III, ATIII; michaelis complex, blood | 2e-42 | |
| 3kcg_I | 432 | Antithrombin-III, ATIII; michaelis complex, blood | 8e-09 | |
| 3kcg_I | 432 | Antithrombin-III, ATIII; michaelis complex, blood | 1e-07 | |
| 2r9y_A | 430 | Alpha-2-antiplasmin; inhibitory serpin, plasmin in | 2e-42 | |
| 2r9y_A | 430 | Alpha-2-antiplasmin; inhibitory serpin, plasmin in | 3e-06 | |
| 2r9y_A | 430 | Alpha-2-antiplasmin; inhibitory serpin, plasmin in | 4e-06 | |
| 1uhg_A | 385 | Ovalbumin, S-ovalbumin; allergen, egg white protei | 3e-42 | |
| 1uhg_A | 385 | Ovalbumin, S-ovalbumin; allergen, egg white protei | 7e-07 | |
| 1uhg_A | 385 | Ovalbumin, S-ovalbumin; allergen, egg white protei | 3e-06 | |
| 1wz9_A | 375 | Maspin precursor; serpin, tumor suppressor, serpin | 4e-42 | |
| 1wz9_A | 375 | Maspin precursor; serpin, tumor suppressor, serpin | 7e-07 | |
| 1wz9_A | 375 | Maspin precursor; serpin, tumor suppressor, serpin | 3e-06 | |
| 1qmn_A | 401 | AACT, alpha-1-antichymotrypsin; serpin, serine pro | 4e-42 | |
| 1qmn_A | 401 | AACT, alpha-1-antichymotrypsin; serpin, serine pro | 7e-06 | |
| 1qmn_A | 401 | AACT, alpha-1-antichymotrypsin; serpin, serine pro | 1e-04 | |
| 3sto_A | 406 | Serine protease inhibitor; serpin fold, hydrolase | 5e-42 | |
| 3sto_A | 406 | Serine protease inhibitor; serpin fold, hydrolase | 4e-06 | |
| 3sto_A | 406 | Serine protease inhibitor; serpin fold, hydrolase | 1e-04 | |
| 2arr_A | 382 | Plasminogen activator inhibitor-2; serpin, peptide | 6e-42 | |
| 2arr_A | 382 | Plasminogen activator inhibitor-2; serpin, peptide | 2e-06 | |
| 2arr_A | 382 | Plasminogen activator inhibitor-2; serpin, peptide | 2e-05 | |
| 2v95_A | 371 | Corticosteroid-binding globulin; transport protein | 2e-41 | |
| 2v95_A | 371 | Corticosteroid-binding globulin; transport protein | 4e-06 | |
| 2v95_A | 371 | Corticosteroid-binding globulin; transport protein | 5e-05 | |
| 2oay_A | 390 | C1-inhibitor, plasma protease C1 inhibitor, C1 INH | 3e-41 | |
| 2oay_A | 390 | C1-inhibitor, plasma protease C1 inhibitor, C1 INH | 3e-08 | |
| 2oay_A | 390 | C1-inhibitor, plasma protease C1 inhibitor, C1 INH | 3e-07 | |
| 3f1s_A | 385 | Protein Z-dependent protease inhibitor; PZ, ZPI, c | 3e-41 | |
| 3f1s_A | 385 | Protein Z-dependent protease inhibitor; PZ, ZPI, c | 4e-06 | |
| 3f1s_A | 385 | Protein Z-dependent protease inhibitor; PZ, ZPI, c | 1e-05 | |
| 2zv6_A | 401 | Serpin B3; serine proteinase inhibitor, reactive s | 7e-41 | |
| 2zv6_A | 401 | Serpin B3; serine proteinase inhibitor, reactive s | 3e-07 | |
| 2zv6_A | 401 | Serpin B3; serine proteinase inhibitor, reactive s | 3e-06 | |
| 1imv_A | 398 | PEDF, pigment epithelium-derived factor; serpin, a | 7e-41 | |
| 1imv_A | 398 | PEDF, pigment epithelium-derived factor; serpin, a | 3e-07 | |
| 1imv_A | 398 | PEDF, pigment epithelium-derived factor; serpin, a | 5e-06 | |
| 1jmo_A | 480 | HC-II, heparin cofactor II, HLS2, serin; serpin, t | 9e-40 | |
| 1jmo_A | 480 | HC-II, heparin cofactor II, HLS2, serin; serpin, t | 2e-08 | |
| 1jmo_A | 480 | HC-II, heparin cofactor II, HLS2, serin; serpin, t | 4e-07 | |
| 3b9f_I | 395 | Protein C inhibitor; michaelis complex, acute phas | 1e-39 | |
| 3b9f_I | 395 | Protein C inhibitor; michaelis complex, acute phas | 8e-07 | |
| 3b9f_I | 395 | Protein C inhibitor; michaelis complex, acute phas | 3e-06 | |
| 3nda_A | 377 | Serpin-2; vaccination target, TICK, hydrolase inhi | 2e-39 | |
| 3nda_A | 377 | Serpin-2; vaccination target, TICK, hydrolase inhi | 3e-07 | |
| 3nda_A | 377 | Serpin-2; vaccination target, TICK, hydrolase inhi | 2e-06 | |
| 3pzf_A | 397 | Serpin 2; protease inhibitor, melanization, hydrol | 3e-39 | |
| 3pzf_A | 397 | Serpin 2; protease inhibitor, melanization, hydrol | 5e-05 | |
| 3pzf_A | 397 | Serpin 2; protease inhibitor, melanization, hydrol | 4e-04 | |
| 2h4r_A | 415 | MENT, heterochromatin-associated protein MENT; ser | 3e-39 | |
| 2h4r_A | 415 | MENT, heterochromatin-associated protein MENT; ser | 1e-07 | |
| 2h4r_A | 415 | MENT, heterochromatin-associated protein MENT; ser | 1e-06 | |
| 2wxw_A | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 4e-39 | |
| 2wxw_A | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 6e-08 | |
| 2wxw_A | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 1e-06 | |
| 2wxy_C | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 2e-38 | |
| 2wxy_C | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 3e-08 | |
| 2wxy_C | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 3e-07 | |
| 1sek_A | 378 | Serpin K; serine protease inhibitor, protease; 2.1 | 5e-38 | |
| 1sek_A | 378 | Serpin K; serine protease inhibitor, protease; 2.1 | 7e-07 | |
| 1sek_A | 378 | Serpin K; serine protease inhibitor, protease; 2.1 | 2e-06 | |
| 3ozq_A | 376 | Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito | 1e-35 | |
| 3ozq_A | 376 | Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito | 3e-08 | |
| 3ozq_A | 376 | Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito | 1e-06 | |
| 1sng_A | 370 | COG4826: serine protease inhibitor; serine proteas | 5e-35 | |
| 1sng_A | 370 | COG4826: serine protease inhibitor; serine proteas | 2e-07 | |
| 1sng_A | 370 | COG4826: serine protease inhibitor; serine proteas | 3e-06 | |
| 3le2_A | 393 | Serpin-ZX; apoplast, glycoprotein, protease inhibi | 1e-34 | |
| 3le2_A | 393 | Serpin-ZX; apoplast, glycoprotein, protease inhibi | 1e-06 | |
| 3le2_A | 393 | Serpin-ZX; apoplast, glycoprotein, protease inhibi | 1e-06 | |
| 3dy0_A | 336 | N-terminus plasma serine protease inhibitor; serpi | 9e-29 | |
| 3dy0_A | 336 | N-terminus plasma serine protease inhibitor; serpi | 2e-06 | |
| 3dy0_A | 336 | N-terminus plasma serine protease inhibitor; serpi | 6e-06 | |
| 2xn6_A | 350 | Thyroxine-binding globulin; transport, cleaved pro | 1e-28 | |
| 2xn6_A | 350 | Thyroxine-binding globulin; transport, cleaved pro | 3e-07 | |
| 2xn6_A | 350 | Thyroxine-binding globulin; transport, cleaved pro | 6e-06 | |
| 3ndd_A | 343 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 3e-28 | |
| 3ndd_A | 343 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 3e-06 | |
| 3ndd_A | 343 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 2e-05 | |
| 1f0c_A | 305 | ICE inhibitor; apoptosis, caspase inhibitor, prote | 1e-27 | |
| 1f0c_A | 305 | ICE inhibitor; apoptosis, caspase inhibitor, prote | 6e-05 | |
| 1f0c_A | 305 | ICE inhibitor; apoptosis, caspase inhibitor, prote | 6e-05 | |
| 1m93_B | 245 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 1e-27 | |
| 1as4_A | 341 | Antichymotrypsin, ACT; serpin, serine protease inh | 2e-27 | |
| 1as4_A | 341 | Antichymotrypsin, ACT; serpin, serine protease inh | 2e-06 | |
| 1as4_A | 341 | Antichymotrypsin, ACT; serpin, serine protease inh | 6e-06 | |
| 3f02_A | 359 | Neuroserpin; cleaved form, fenib, human, disease M | 2e-27 | |
| 3f02_A | 359 | Neuroserpin; cleaved form, fenib, human, disease M | 3e-07 | |
| 3f02_A | 359 | Neuroserpin; cleaved form, fenib, human, disease M | 2e-06 | |
| 1hle_A | 345 | Horse leukocyte elastase inhibitor; hydrolase inhi | 4e-27 | |
| 1hle_A | 345 | Horse leukocyte elastase inhibitor; hydrolase inhi | 1e-06 | |
| 1hle_A | 345 | Horse leukocyte elastase inhibitor; hydrolase inhi | 7e-06 | |
| 2h4p_A | 394 | MENT, heterochromatin-associated protein MENT; ser | 5e-26 | |
| 2h4p_A | 394 | MENT, heterochromatin-associated protein MENT; ser | 3e-08 | |
| 2h4p_A | 394 | MENT, heterochromatin-associated protein MENT; ser | 2e-06 | |
| 1mtp_A | 323 | Serine proteinase inhibitor (serpin), chain A; str | 2e-24 | |
| 1mtp_A | 323 | Serine proteinase inhibitor (serpin), chain A; str | 3e-07 | |
| 1mtp_A | 323 | Serine proteinase inhibitor (serpin), chain A; str | 5e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 3f02_C | 48 | Neuroserpin; cleaved form, fenib, human, disease M | 1e-07 | |
| 1hle_B | 31 | Horse leukocyte elastase inhibitor; hydrolase inhi | 1e-07 | |
| 2h4p_B | 34 | MENT, heterochromatin-associated protein MENT; ser | 2e-07 | |
| 3ndd_B | 36 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 3e-06 | |
| 1m93_A | 55 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 4e-06 | |
| 1m93_A | 55 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 4e-06 | |
| 2xn6_B | 35 | Thyroxine-binding globulin; transport, cleaved pro | 5e-05 | |
| 2riv_B | 40 | Thyroxine-binding globulin; TBG, serpin, cleaved, | 9e-05 | |
| 1as4_B | 37 | Antichymotrypsin, ACT; serpin, serine protease inh | 3e-04 |
| >4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 | Back alignment and structure |
|---|
Score = 160 bits (406), Expect = 9e-46
Identities = 33/155 (21%), Positives = 63/155 (40%), Gaps = 1/155 (0%)
Query: 163 NEVYMYFILPKNPD-LSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLN 221
+ ++P + + L K L ++ + K V ++PK V + +L+ L
Sbjct: 229 KLSSLIILMPHHVEPLERLEKLLTKEQLKIWMGKMQKKAVAISLPKGVVEVTHDLQKHLA 288
Query: 222 TMNVTSMFDVSKSDLSNMLDDRGVAVDQVFHKVDIEVTEQGTVAAASTGIIITRISKPTV 281
+ +T D +K+DLS M + + + VFH E +G S
Sbjct: 289 GLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFEWDTEGNPFDQDIYGREELRSPKLF 348
Query: 282 KINRPFIFFIYHKPTDSIVFWGSIYKPEPQRPYHE 316
+ PFIF + + S++F G + +P+ + E
Sbjct: 349 YADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDE 383
|
| >4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 | Back alignment and structure |
|---|
| >4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B Length = 392 | Back alignment and structure |
|---|
| >1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 | Back alignment and structure |
|---|
| >1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 | Back alignment and structure |
|---|
| >1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B Length = 379 | Back alignment and structure |
|---|
| >2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 | Back alignment and structure |
|---|
| >2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 | Back alignment and structure |
|---|
| >2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* Length = 373 | Back alignment and structure |
|---|
| >3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 | Back alignment and structure |
|---|
| >3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 | Back alignment and structure |
|---|
| >3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B Length = 424 | Back alignment and structure |
|---|
| >4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 | Back alignment and structure |
|---|
| >4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 | Back alignment and structure |
|---|
| >4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C Length = 379 | Back alignment and structure |
|---|
| >3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 | Back alignment and structure |
|---|
| >3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 | Back alignment and structure |
|---|
| >3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} Length = 407 | Back alignment and structure |
|---|
| >1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 | Back alignment and structure |
|---|
| >1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 | Back alignment and structure |
|---|
| >1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} Length = 398 | Back alignment and structure |
|---|
| >2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 | Back alignment and structure |
|---|
| >2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 | Back alignment and structure |
|---|
| >2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} Length = 379 | Back alignment and structure |
|---|
| >2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 | Back alignment and structure |
|---|
| >2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 | Back alignment and structure |
|---|
| >2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A Length = 373 | Back alignment and structure |
|---|
| >3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 | Back alignment and structure |
|---|
| >3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 | Back alignment and structure |
|---|
| >3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... Length = 432 | Back alignment and structure |
|---|
| >2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 | Back alignment and structure |
|---|
| >2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 | Back alignment and structure |
|---|
| >2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} Length = 430 | Back alignment and structure |
|---|
| >1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 | Back alignment and structure |
|---|
| >1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 | Back alignment and structure |
|---|
| >1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A Length = 385 | Back alignment and structure |
|---|
| >1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 | Back alignment and structure |
|---|
| >1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 | Back alignment and structure |
|---|
| >1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A Length = 375 | Back alignment and structure |
|---|
| >1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 | Back alignment and structure |
|---|
| >1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 | Back alignment and structure |
|---|
| >1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A Length = 401 | Back alignment and structure |
|---|
| >3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 | Back alignment and structure |
|---|
| >3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 | Back alignment and structure |
|---|
| >3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} Length = 406 | Back alignment and structure |
|---|
| >2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 | Back alignment and structure |
|---|
| >2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 | Back alignment and structure |
|---|
| >2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A Length = 382 | Back alignment and structure |
|---|
| >2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 | Back alignment and structure |
|---|
| >2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 | Back alignment and structure |
|---|
| >2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} Length = 371 | Back alignment and structure |
|---|
| >2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} Length = 390 | Back alignment and structure |
|---|
| >3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 | Back alignment and structure |
|---|
| >3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 | Back alignment and structure |
|---|
| >3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* Length = 385 | Back alignment and structure |
|---|
| >2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 | Back alignment and structure |
|---|
| >2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 | Back alignment and structure |
|---|
| >2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} Length = 401 | Back alignment and structure |
|---|
| >1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 | Back alignment and structure |
|---|
| >1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 | Back alignment and structure |
|---|
| >1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 Length = 398 | Back alignment and structure |
|---|
| >1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 | Back alignment and structure |
|---|
| >1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 | Back alignment and structure |
|---|
| >1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* Length = 480 | Back alignment and structure |
|---|
| >3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 | Back alignment and structure |
|---|
| >3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 | Back alignment and structure |
|---|
| >3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* Length = 395 | Back alignment and structure |
|---|
| >3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 | Back alignment and structure |
|---|
| >3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 | Back alignment and structure |
|---|
| >3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} Length = 377 | Back alignment and structure |
|---|
| >3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 | Back alignment and structure |
|---|
| >3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 | Back alignment and structure |
|---|
| >3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} Length = 397 | Back alignment and structure |
|---|
| >2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 | Back alignment and structure |
|---|
| >2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 | Back alignment and structure |
|---|
| >2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A Length = 415 | Back alignment and structure |
|---|
| >2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 | Back alignment and structure |
|---|
| >2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 | Back alignment and structure |
|---|
| >2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B Length = 453 | Back alignment and structure |
|---|
| >2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 | Back alignment and structure |
|---|
| >2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 | Back alignment and structure |
|---|
| >2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A Length = 453 | Back alignment and structure |
|---|
| >1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 | Back alignment and structure |
|---|
| >1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 | Back alignment and structure |
|---|
| >1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I Length = 378 | Back alignment and structure |
|---|
| >3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 | Back alignment and structure |
|---|
| >3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 | Back alignment and structure |
|---|
| >3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} Length = 376 | Back alignment and structure |
|---|
| >1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 | Back alignment and structure |
|---|
| >1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 | Back alignment and structure |
|---|
| >1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 Length = 370 | Back alignment and structure |
|---|
| >3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 | Back alignment and structure |
|---|
| >3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 | Back alignment and structure |
|---|
| >3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} Length = 393 | Back alignment and structure |
|---|
| >3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 | Back alignment and structure |
|---|
| >3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 | Back alignment and structure |
|---|
| >3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* Length = 336 | Back alignment and structure |
|---|
| >2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 | Back alignment and structure |
|---|
| >2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 | Back alignment and structure |
|---|
| >2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* Length = 350 | Back alignment and structure |
|---|
| >3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 | Back alignment and structure |
|---|
| >3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 | Back alignment and structure |
|---|
| >3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A Length = 343 | Back alignment and structure |
|---|
| >1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 | Back alignment and structure |
|---|
| >1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 | Back alignment and structure |
|---|
| >1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A Length = 305 | Back alignment and structure |
|---|
| >1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 245 | Back alignment and structure |
|---|
| >1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 | Back alignment and structure |
|---|
| >1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 | Back alignment and structure |
|---|
| >1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A Length = 341 | Back alignment and structure |
|---|
| >3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 | Back alignment and structure |
|---|
| >3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 | Back alignment and structure |
|---|
| >3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A Length = 359 | Back alignment and structure |
|---|
| >1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 | Back alignment and structure |
|---|
| >1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 | Back alignment and structure |
|---|
| >1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 345 | Back alignment and structure |
|---|
| >2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 | Back alignment and structure |
|---|
| >2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 | Back alignment and structure |
|---|
| >2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A Length = 394 | Back alignment and structure |
|---|
| >1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 | Back alignment and structure |
|---|
| >1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 | Back alignment and structure |
|---|
| >1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 Length = 323 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3f02_C Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 1jjo_E Length = 48 | Back alignment and structure |
|---|
| >1hle_B Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 Length = 31 | Back alignment and structure |
|---|
| >2h4p_B MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_B Length = 34 | Back alignment and structure |
|---|
| >3ndd_B Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 1ezx_B 3ndf_B 7api_B* 8api_B* 9api_B* 2d26_B Length = 36 | Back alignment and structure |
|---|
| >1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 55 | Back alignment and structure |
|---|
| >1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 Length = 55 | Back alignment and structure |
|---|
| >2xn6_B Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn5_B* 2xn7_B* Length = 35 | Back alignment and structure |
|---|
| >2riv_B Thyroxine-binding globulin; TBG, serpin, cleaved, mutation, glycoprotein, secreted, signaling protein; 1.50A {Homo sapiens} PDB: 2riw_B* 2xn3_B* Length = 40 | Back alignment and structure |
|---|
| >1as4_B Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_B* 3caa_B 4caa_B Length = 37 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 357 | |||
| 4ga7_A | 389 | Leukocyte elastase inhibitor; serpin, conformation | 100.0 | |
| 4au2_A | 392 | HSP47, serpin peptidase inhibitor, clade H (heat s | 100.0 | |
| 3f5n_A | 407 | Neuroserpin; cleaved form, fenib, human, tissue PL | 100.0 | |
| 3ne4_A | 424 | Alpha-1-antitrypsin; serpin, LUNG disease, liver d | 100.0 | |
| 4dy0_A | 379 | GLIA-derived nexin; serpin, protease inhibitor, th | 100.0 | |
| 1uhg_A | 385 | Ovalbumin, S-ovalbumin; allergen, egg white protei | 100.0 | |
| 1lj5_A | 379 | Plasminogen activator inhibitor-1; beta-barrell, b | 100.0 | |
| 3nda_A | 377 | Serpin-2; vaccination target, TICK, hydrolase inhi | 100.0 | |
| 3f1s_A | 385 | Protein Z-dependent protease inhibitor; PZ, ZPI, c | 100.0 | |
| 2arr_A | 382 | Plasminogen activator inhibitor-2; serpin, peptide | 100.0 | |
| 2vdx_A | 373 | Corticosteroid-binding globulin; transport protein | 100.0 | |
| 2h4r_A | 415 | MENT, heterochromatin-associated protein MENT; ser | 100.0 | |
| 4ajt_A | 427 | Protein Z-dependent protease inhibitor; blood clot | 100.0 | |
| 3sto_A | 406 | Serine protease inhibitor; serpin fold, hydrolase | 100.0 | |
| 2ceo_A | 379 | Thyroxine-binding globulin; transport, serpin, hor | 100.0 | |
| 1wz9_A | 375 | Maspin precursor; serpin, tumor suppressor, serpin | 100.0 | |
| 3kcg_I | 432 | Antithrombin-III, ATIII; michaelis complex, blood | 100.0 | |
| 2zv6_A | 401 | Serpin B3; serine proteinase inhibitor, reactive s | 100.0 | |
| 1sek_A | 378 | Serpin K; serine protease inhibitor, protease; 2.1 | 100.0 | |
| 1yxa_A | 398 | Serine (OR cysteine) proteinase inhibitor, clade 3 | 100.0 | |
| 1jmo_A | 480 | HC-II, heparin cofactor II, HLS2, serin; serpin, t | 100.0 | |
| 1qmn_A | 401 | AACT, alpha-1-antichymotrypsin; serpin, serine pro | 100.0 | |
| 3pzf_A | 397 | Serpin 2; protease inhibitor, melanization, hydrol | 100.0 | |
| 2v95_A | 371 | Corticosteroid-binding globulin; transport protein | 100.0 | |
| 2pef_A | 373 | Serine protease inhibitor; serpin; 1.60A {Thermoan | 100.0 | |
| 3b9f_I | 395 | Protein C inhibitor; michaelis complex, acute phas | 100.0 | |
| 3ozq_A | 376 | Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molito | 100.0 | |
| 3le2_A | 393 | Serpin-ZX; apoplast, glycoprotein, protease inhibi | 100.0 | |
| 1imv_A | 398 | PEDF, pigment epithelium-derived factor; serpin, a | 100.0 | |
| 1sng_A | 370 | COG4826: serine protease inhibitor; serine proteas | 100.0 | |
| 2r9y_A | 430 | Alpha-2-antiplasmin; inhibitory serpin, plasmin in | 100.0 | |
| 2wxy_C | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 100.0 | |
| 2oay_A | 390 | C1-inhibitor, plasma protease C1 inhibitor, C1 INH | 100.0 | |
| 2wxw_A | 453 | Angiotensinogen, serpin A8; glycoprotein, hyperten | 100.0 | |
| 3f02_A | 359 | Neuroserpin; cleaved form, fenib, human, disease M | 100.0 | |
| 1hle_A | 345 | Horse leukocyte elastase inhibitor; hydrolase inhi | 100.0 | |
| 3ndd_A | 343 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 100.0 | |
| 2h4p_A | 394 | MENT, heterochromatin-associated protein MENT; ser | 100.0 | |
| 2xn6_A | 350 | Thyroxine-binding globulin; transport, cleaved pro | 100.0 | |
| 3dy0_A | 336 | N-terminus plasma serine protease inhibitor; serpi | 100.0 | |
| 4afx_A | 387 | Protein Z dependent protease inhibitor; hydrolase | 100.0 | |
| 1as4_A | 341 | Antichymotrypsin, ACT; serpin, serine protease inh | 100.0 | |
| 1mtp_A | 323 | Serine proteinase inhibitor (serpin), chain A; str | 100.0 | |
| 1f0c_A | 305 | ICE inhibitor; apoptosis, caspase inhibitor, prote | 100.0 | |
| 1m93_B | 245 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 100.0 | |
| 1m93_A | 55 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 99.35 | |
| 3ndd_B | 36 | Alpha-1-antitrypsin; serpin, hydrolase inhibitor; | 99.26 | |
| 1hle_B | 31 | Horse leukocyte elastase inhibitor; hydrolase inhi | 99.24 | |
| 4afx_B | 36 | Protein Z dependent protease inhibitor; hydrolase | 99.23 | |
| 2xn6_B | 35 | Thyroxine-binding globulin; transport, cleaved pro | 99.23 | |
| 2h4p_B | 34 | MENT, heterochromatin-associated protein MENT; ser | 99.21 | |
| 2riv_B | 40 | Thyroxine-binding globulin; TBG, serpin, cleaved, | 99.2 | |
| 1as4_B | 37 | Antichymotrypsin, ACT; serpin, serine protease inh | 99.19 | |
| 3f02_C | 48 | Neuroserpin; cleaved form, fenib, human, disease M | 99.14 | |
| 1m93_C | 41 | Serine proteinase inhibitor 2; serpin, CRMA, apopt | 99.07 | |
| 1mtp_B | 43 | Serine proteinase inhibitor (serpin), chain B; str | 99.02 | |
| 3dy0_B | 29 | C-terminus plasma serine protease inhibitor; serpi | 98.94 |
| >4ga7_A Leukocyte elastase inhibitor; serpin, conformational change, serine protease inhibitor, Ca inhibitor, chymase inhibitor, chymotrypsin inhibitor; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.3e-64 Score=497.00 Aligned_cols=299 Identities=27% Similarity=0.397 Sum_probs=262.1
Q ss_pred chhHHHHhhHHHHHHHHHHHhccCCCCCEEEchhhHHHHHHHHHcCCCchhHHHHHHhhCCCch-------hhHHhhc--
Q psy5102 9 NLILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATG-------RSLSNKL-- 79 (357)
Q Consensus 9 ~~~~~~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~eL~~~Lg~~~~-------~~ll~~l-- 79 (357)
+..+..++++||++||+++.+. .+++|+||||+||+.+|+|+++||+|+|++||.++||++.. +.|+..+
T Consensus 11 ~~~l~~~~~~Fa~~L~~~l~~~-~~~~Ni~~SP~Si~~aLaml~~GA~g~T~~el~~~L~~~~~~~~~~~~~~l~~~l~~ 89 (389)
T 4ga7_A 11 MEQLSSANTRFALDLFLALSEN-NPAGNIFISPFSISSAMAMVFLGTRGNTAAQLSKTFHFNTVEEVHSRFQSLNADINK 89 (389)
T ss_dssp CCHHHHHHHHHHHHHHHHHHHH-CSSSCEEECHHHHHHHHHHHHTTCCHHHHHHHHHHTTGGGCTTHHHHHHHHHHHHTC
T ss_pred HHHHHHHHhHHHHHHHHHHhhc-CCCCCEEEchHHHHHHHHHHHhhccCcHHHHHHHHhCCCCHHHHHHHHHHHHHHHhC
Confidence 5678999999999999999877 67899999999999999999999999999999999999761 5566666
Q ss_pred -c-cceeeee---eccc---------------------cCCH-H---HH---HHHHH---hCCC-cccCCCCCCCcccee
Q psy5102 80 -T-AHSLRRG---ITQM---------------------TLDM-E---RA---IRSVM---TKNQ-NVVFAPLSIVGALAL 122 (357)
Q Consensus 80 -~-~~~l~~a---f~~~---------------------~~dF-~---~a---IN~wv---T~g~-~~~l~~~~l~~~t~l 122 (357)
+ ++.++++ |+++ .+|| + .| ||+|| |+|+ ++++++++++++|++
T Consensus 90 ~~~~~~l~~an~l~~~~~~~l~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~IN~WV~~~T~g~I~~ll~~~~l~~~t~l 169 (389)
T 4ga7_A 90 RGASYILKLANRLYGEKTYNFLPEFLVSTQKTYGADLASVDFQHASEDARKTINQWVKGQTEGKIPELLASGMVDNMTKL 169 (389)
T ss_dssp TTCSSEEEEEEEEEEETTSCBCHHHHHHHHHHTSCCEEEECHHHHHHHHHHHHHHHHHHHTTTSSTTSSCTTSSCTTCCE
T ss_pred CCCCcEEEEeeeeeecCCCccCHHHHHHHHHHhCCeeEecccccCHHHHHHHHHHHHHHhhCCchhhccCCCCCCCCceE
Confidence 2 5677776 7665 6789 2 33 99999 9999 999999899999999
Q ss_pred Eeecc-------cCCCCCCCceeeeeeec--------------c-cccccCCCCeEEEe--ecCCeEEEEEEec-CC---
Q psy5102 123 VLLGS-------DGQTKDELTHFMGVATG--------------R-SLSNNPEAYASFLE--KMRNEVYMYFILP-KN--- 174 (357)
Q Consensus 123 vLvna-------~~~F~~~~T~~~~F~~~--------------~-~~~~~~~~~~~vve--y~~~~~sm~iiLP-~~--- 174 (357)
+|+|| +.||++..|.+++||.. . +|+++++++|+||+ |.+++++|+|||| +.
T Consensus 170 vLvNaiyFkg~W~~~F~~~~T~~~~F~~~~~~~~~V~mM~~~~~~~~~~~~~~~~~vleLPy~~~~~sm~iiLP~~~~~~ 249 (389)
T 4ga7_A 170 VLVNAIYFKGNWKDKFMKEATTNAPFRLNKKDRKTVKMMYQKKKFAYGYIEDLKCRVLELPYQGEELSMVILLPDDIEDE 249 (389)
T ss_dssp EEEEEEEEECCBSSCCCTTTCEEEEEEEETTEEEEEEEEEEEEEEEEEEETTTTEEEEEEEBTTSSEEEEEEEESSCCSS
T ss_pred EEEEEEEEEeeecCCCCccCccccceEeCCCcEEEEEEEEEeeeEEEEEECCCCEEEEEEECCCCCEEEEEEecCCCccc
Confidence 99999 89999999999999976 2 57788999999999 9998999999999 76
Q ss_pred -CChhHHhhccChhHHHHHH--HhcCceeEEEEeceeeEeeccchHHHhhhCCccccCCCCCCCCCCCCCCCCceeeeee
Q psy5102 175 -PDLSEFTKDLDYDKFSRII--ESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDDRGVAVDQVF 251 (357)
Q Consensus 175 -~~L~~l~~~L~~~~l~~~~--~~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGl~~~F~~~~adfs~is~~~~l~vs~v~ 251 (357)
.+|.+++++|+.+.+..|. ..++.+.|+|.||||++++++||+++|++||++++|+++.||||+|+++.+++|++|+
T Consensus 250 ~~~L~~le~~L~~~~l~~~~~~~~~~~~~v~v~lPKFki~~~~dL~~~L~~lGi~~~F~~~~Adfsgis~~~~l~vs~v~ 329 (389)
T 4ga7_A 250 STGLKKIEEQLTLEKLHEWTKPENLDFIEVNVSLPRFKLEESYTLNSDLARLGVQDLFNSSKADLSGMSGARDIFISKIV 329 (389)
T ss_dssp SSSCHHHHHHCCHHHHHHHHSGGGCEEEEEEEEEECEEEEEEEECHHHHHHTTCCGGGCTTTCCCTTTBCCSSCCEEEEE
T ss_pred cccHHHHHHHhCHHHHHHHhhhhcCcceEEEEEeccEEEEEeechHHHHHHcCcHhhcCCCcCCcccccCCCCcceeeEE
Confidence 8999999999999999998 5788999999999999999999999999999999999657999999987789999999
Q ss_pred EEEEEEEccCccccccccceeee-ec--CCCEEEEcCceEEEEEECCCCcEEEEEEEcCC
Q psy5102 252 HKVDIEVTEQGTVAAASTGIIIT-RI--SKPTVKINRPFIFFIYHKPTDSIVFWGSIYKP 308 (357)
Q Consensus 252 qk~~iev~E~G~~aaa~t~~~~~-~s--~~~~f~~nrPFlf~I~d~~t~~iLF~G~v~~P 308 (357)
||+.|+|||+|++|+|+|++.+. ++ .+.+|++||||+|+|+|+.|+.|||+|+|.+|
T Consensus 330 hka~ieVnE~GteAaAaT~~~~~~~s~~~~~~f~~drPFlf~I~~~~t~~iLF~G~v~~P 389 (389)
T 4ga7_A 330 HKSFVEVNEEGTEAAAATAGIATFCMDDPEENFTADHPFLFFIRHNSSGSILFLGRFSSP 389 (389)
T ss_dssp EEEEEEECSCBC----------CCCSSSCEEEEECCSCEEEEEEETTTTEEEEEEEECCC
T ss_pred EEEEEEecCCCcccccccccccccccCCCCCcEEccCCEEEEEEECCCCcEEEEEEecCC
Confidence 99999999999999999987765 44 34689999999999999999999999999998
|
| >4au2_A HSP47, serpin peptidase inhibitor, clade H (heat shock P 47), member 1, (collagen binding...; chaperone-peptide complex; 2.30A {Canis lupus familiaris} PDB: 4au3_A 4au4_A 4awr_A 4au3_B | Back alignment and structure |
|---|
| >3f5n_A Neuroserpin; cleaved form, fenib, human, tissue PLAS activator, hydrolase inhibitor; 3.15A {Homo sapiens} | Back alignment and structure |
|---|
| >3ne4_A Alpha-1-antitrypsin; serpin, LUNG disease, liver disease, polymerisation, hydrolase inhibitor; 1.81A {Homo sapiens} PDB: 1qlp_A 2qug_A 3cwl_A 3cwm_A* 1psi_A 3drm_A 1kct_A 3dru_A 1hp7_A 1iz2_A* 1oph_A 1oo8_A 1atu_A 1d5s_B 1qmb_B | Back alignment and structure |
|---|
| >4dy0_A GLIA-derived nexin; serpin, protease inhibitor, thrombin, cell surface, hydrolas inhibitor; HET: IDS SGN; 2.35A {Homo sapiens} PDB: 4dy7_C | Back alignment and structure |
|---|
| >1uhg_A Ovalbumin, S-ovalbumin; allergen, egg white protein, serpin; HET: SEP NAG; 1.90A {Gallus gallus} SCOP: e.1.1.1 PDB: 1ova_A* 1jti_A | Back alignment and structure |
|---|
| >1lj5_A Plasminogen activator inhibitor-1; beta-barrell, blood clotting; 1.80A {Homo sapiens} SCOP: e.1.1.1 PDB: 1dvn_A 1c5g_A 1a7c_A* 3q02_A 3q03_A 3r4l_A* 1oc0_A 1b3k_A 3pb1_I 1dvm_A 3eox_A 3cvm_A 1db2_A 9pai_A 3lw2_A 9pai_B | Back alignment and structure |
|---|
| >3nda_A Serpin-2; vaccination target, TICK, hydrolase inhibitor; HET: 1PE; 1.80A {Ixodes ricinus} | Back alignment and structure |
|---|
| >3f1s_A Protein Z-dependent protease inhibitor; PZ, ZPI, complex, serpin, protease inhibitor, protease, GLYC secreted, serine protease inhibitor, blood coagulation; HET: FLC NAG; 2.30A {Homo sapiens} PDB: 3h5c_A* | Back alignment and structure |
|---|
| >2arr_A Plasminogen activator inhibitor-2; serpin, peptide binding, hydrolase inhibitor-PEPT complex; 1.55A {Homo sapiens} PDB: 2arq_A 1jrr_A 1by7_A | Back alignment and structure |
|---|
| >2vdx_A Corticosteroid-binding globulin; transport protein, cortisol binding globulin, glycoprotein, lipid-binding, disease mutation, CBG, SERP cleaved; 1.84A {Homo sapiens} PDB: 2vdy_A* | Back alignment and structure |
|---|
| >2h4r_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 2.70A {Gallus gallus} PDB: 2dut_A | Back alignment and structure |
|---|
| >4ajt_A Protein Z-dependent protease inhibitor; blood clotting, ZPI; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3sto_A Serine protease inhibitor; serpin fold, hydrolase inhibitor; 2.41A {Schistosoma haematobium} | Back alignment and structure |
|---|
| >2ceo_A Thyroxine-binding globulin; transport, serpin, hormone trans thyroxine, disease mutation, glycoprotein; HET: T44; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1wz9_A Maspin precursor; serpin, tumor suppressor, serpinb5, signaling protein; HET: CME; 2.10A {Homo sapiens} PDB: 1xu8_A 1xqg_A 1xqj_A | Back alignment and structure |
|---|
| >3kcg_I Antithrombin-III, ATIII; michaelis complex, blood coagulation, calcium, disulfide bond, EGF-like domain, glycoprotein, hemophilia, hydrolase; HET: NAG FUC MAN NTP; 1.70A {Homo sapiens} SCOP: e.1.1.1 PDB: 1e04_I* 1ath_A 1ant_L* 1br8_L 1azx_I* 1dzh_L* 1e03_L* 1dzg_L* 1e05_L* 1jvq_L* 1lk6_L* 1nq9_I* 1oyh_L* 1r1l_L* 1sr5_A* 2ant_L* 2beh_L* 2hij_L* 2znh_A* 3evj_I* ... | Back alignment and structure |
|---|
| >2zv6_A Serpin B3; serine proteinase inhibitor, reactive site loop, acetylation, alternative splicing, cytoplasm, polymorphism, protease inhibitor; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1sek_A Serpin K; serine protease inhibitor, protease; 2.10A {Manduca sexta} SCOP: e.1.1.1 PDB: 1k9o_I | Back alignment and structure |
|---|
| >1yxa_A Serine (OR cysteine) proteinase inhibitor, clade 3N; serpin, antichymotrypsin, protease inhibitor, reactive centr plasma, hydrolase inhibitor; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >1jmo_A HC-II, heparin cofactor II, HLS2, serin; serpin, thrombin, protease, inhibition, inhibitor, blood CLO; HET: TYS NDG NAG; 2.20A {Homo sapiens} SCOP: e.1.1.1 PDB: 1jmj_A* | Back alignment and structure |
|---|
| >1qmn_A AACT, alpha-1-antichymotrypsin; serpin, serine proteinase inhibitor, partial loop insertion, loop-sheet polymerization, emphysema, disease mutation; 2.27A {Homo sapiens} SCOP: e.1.1.1 PDB: 3dlw_A | Back alignment and structure |
|---|
| >3pzf_A Serpin 2; protease inhibitor, melanization, hydrolase inhibito; 1.75A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2v95_A Corticosteroid-binding globulin; transport protein, CBG, RCL, serpin, secreted, transport, glycoprotein, lipid-binding, glucocorticoids; HET: HCY; 1.93A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2pef_A Serine protease inhibitor; serpin; 1.60A {Thermoanaerobacter tengcongensis} PDB: 2vh4_A 2pee_A | Back alignment and structure |
|---|
| >3b9f_I Protein C inhibitor; michaelis complex, acute phase, blood coagulation, cleavage of basic residues, disease mutation; HET: NAG FUC SGN IDS; 1.60A {Homo sapiens} PDB: 2ol2_A* | Back alignment and structure |
|---|
| >3ozq_A Serpin48; SPE, hydrolase I; 1.90A {Tenebrio molitor} | Back alignment and structure |
|---|
| >3le2_A Serpin-ZX; apoplast, glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase; 2.20A {Arabidopsis thaliana} SCOP: e.1.1.0 | Back alignment and structure |
|---|
| >1imv_A PEDF, pigment epithelium-derived factor; serpin, angiogenesis, signaling protein; HET: NAG; 2.85A {Homo sapiens} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >1sng_A COG4826: serine protease inhibitor; serine protease inhibitor (serpin), native state., hydrolase inhibitor; 1.76A {Thermobifida fusca} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >2r9y_A Alpha-2-antiplasmin; inhibitory serpin, plasmin inhibitor, AC phase, glycoprotein, protease inhibitor, secreted, serine P inhibitor, sulfation; 2.65A {Mus musculus} | Back alignment and structure |
|---|
| >2wxy_C Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 2.10A {Mus musculus} PDB: 2wxx_A 2wy0_C 2wxz_A 2wxz_C 2wy1_A | Back alignment and structure |
|---|
| >2oay_A C1-inhibitor, plasma protease C1 inhibitor, C1 INH, C1INH; latent serpin, RCL insertion, immune system,hydrolase inhibi; HET: NAG; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2wxw_A Angiotensinogen, serpin A8; glycoprotein, hypertension, vasoconstrictor, renin, serpins, vasoactive, hormone; 3.30A {Homo sapiens} PDB: 2x0b_B | Back alignment and structure |
|---|
| >3f02_A Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 3fgq_A 1jjo_C 1jjo_A | Back alignment and structure |
|---|
| >1hle_A Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >3ndd_A Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 3ndf_A 7api_A* 8api_A* 9api_A* 1d5s_A 1ezx_A 3t1p_A 2d26_A 1qmb_A | Back alignment and structure |
|---|
| >2h4p_A MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_A | Back alignment and structure |
|---|
| >2xn6_A Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn7_A* 2xn5_A* 2riv_A 2xn3_A* 2riw_A* | Back alignment and structure |
|---|
| >3dy0_A N-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_A* 2hi9_A* | Back alignment and structure |
|---|
| >4afx_A Protein Z dependent protease inhibitor; hydrolase inhibitor, serpin, protein Z dependent inhibitor, coagulation; 2.09A {Homo sapiens} PDB: 4aju_A 3h5c_A* 3f1s_A* | Back alignment and structure |
|---|
| >1as4_A Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_A* 4caa_A 3caa_A | Back alignment and structure |
|---|
| >1mtp_A Serine proteinase inhibitor (serpin), chain A; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >1f0c_A ICE inhibitor; apoptosis, caspase inhibitor, protease inhibitor, serpin, viral protein; 2.26A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_A | Back alignment and structure |
|---|
| >1m93_B Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >1m93_A Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >3ndd_B Alpha-1-antitrypsin; serpin, hydrolase inhibitor; 1.50A {Homo sapiens} PDB: 1ezx_B 3ndf_B 7api_B* 8api_B* 9api_B* 2d26_B | Back alignment and structure |
|---|
| >1hle_B Horse leukocyte elastase inhibitor; hydrolase inhibitor(serine proteinase); 1.95A {Equus caballus} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >4afx_B Protein Z dependent protease inhibitor; hydrolase inhibitor, serpin, protein Z dependent inhibitor, coagulation; 2.09A {Homo sapiens} PDB: 4aju_B | Back alignment and structure |
|---|
| >2xn6_B Thyroxine-binding globulin; transport, cleaved protein; HET: F6Y T44; 1.29A {Homo sapiens} PDB: 2xn5_B* 2xn7_B* | Back alignment and structure |
|---|
| >2h4p_B MENT, heterochromatin-associated protein MENT; serine protease inhibitor, serpin, hydrolase inhibitor; 1.70A {Gallus gallus} PDB: 2h4q_B | Back alignment and structure |
|---|
| >2riv_B Thyroxine-binding globulin; TBG, serpin, cleaved, mutation, glycoprotein, secreted, signaling protein; 1.50A {Homo sapiens} PDB: 2riw_B* 2xn3_B* | Back alignment and structure |
|---|
| >1as4_B Antichymotrypsin, ACT; serpin, serine protease inhibitor; 2.10A {Homo sapiens} SCOP: e.1.1.1 PDB: 2ach_B* 3caa_B 4caa_B | Back alignment and structure |
|---|
| >3f02_C Neuroserpin; cleaved form, fenib, human, disease MUT glycoprotein, protease inhibitor, secreted, serine protease inhibitor, hydrolase inhibitor; 1.80A {Homo sapiens} PDB: 1jjo_E | Back alignment and structure |
|---|
| >1m93_C Serine proteinase inhibitor 2; serpin, CRMA, apoptosis, ICE inhibitor, viral protein; 1.65A {Cowpox virus} SCOP: e.1.1.1 PDB: 1c8o_B 1f0c_B | Back alignment and structure |
|---|
| >1mtp_B Serine proteinase inhibitor (serpin), chain B; structural genomics, protease inhibitor; 1.50A {Thermobifida fusca} SCOP: e.1.1.1 | Back alignment and structure |
|---|
| >3dy0_B C-terminus plasma serine protease inhibitor; serpin, blood clotting, hydrolase inhibitor; HET: IDS SGN; 1.55A {Homo sapiens} PDB: 1lq8_B* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 357 | ||||
| g1jjo.1 | 334 | e.1.1.1 (A:,C:,E:) Neuroserpin {Mouse (Mus musculu | 3e-38 | |
| d2b5ti1 | 426 | e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien | 7e-34 | |
| d2b5ti1 | 426 | e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien | 5e-09 | |
| d2b5ti1 | 426 | e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapien | 9e-09 | |
| d1qlpa_ | 372 | e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap | 3e-33 | |
| d1qlpa_ | 372 | e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap | 9e-09 | |
| d1qlpa_ | 372 | e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sap | 5e-08 | |
| g1lq8.1 | 358 | e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s | 6e-33 | |
| g1lq8.1 | 358 | e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s | 2e-07 | |
| g1lq8.1 | 358 | e.1.1.1 (A:,B:) Protein C inhibitor {Human (Homo s | 2e-07 | |
| d1xqga_ | 378 | e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: | 1e-32 | |
| d1xqga_ | 378 | e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: | 3e-08 | |
| d1xqga_ | 378 | e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: | 2e-07 | |
| g1as4.1 | 369 | e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( | 3e-32 | |
| g1as4.1 | 369 | e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( | 3e-07 | |
| g1as4.1 | 369 | e.1.1.1 (A:,B:) Antichymotrypsin, alpha-1 {Human ( | 6e-07 | |
| g1hle.1 | 375 | e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c | 9e-32 | |
| g1hle.1 | 375 | e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c | 4e-08 | |
| g1hle.1 | 375 | e.1.1.1 (A:,B:) Elastase inhibitor {Horse (Equus c | 4e-08 | |
| d1lj5a_ | 379 | e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu | 1e-31 | |
| d1lj5a_ | 379 | e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu | 1e-07 | |
| d1lj5a_ | 379 | e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Hu | 2e-07 | |
| d1jmja_ | 420 | e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin | 1e-31 | |
| d1jmja_ | 420 | e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin | 2e-08 | |
| d1jmja_ | 420 | e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin | 3e-07 | |
| d1uhga_ | 385 | e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId | 6e-31 | |
| d1uhga_ | 385 | e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId | 9e-09 | |
| d1uhga_ | 385 | e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId | 7e-08 | |
| d1by7a_ | 381 | e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu | 3e-30 | |
| d1by7a_ | 381 | e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu | 7e-08 | |
| d1by7a_ | 381 | e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Hu | 9e-08 | |
| d1imva_ | 383 | e.1.1.1 (A:) Pigment epithelium-derived factor, PE | 3e-29 | |
| d1imva_ | 383 | e.1.1.1 (A:) Pigment epithelium-derived factor, PE | 4e-09 | |
| d1imva_ | 383 | e.1.1.1 (A:) Pigment epithelium-derived factor, PE | 6e-08 | |
| d1k9oi_ | 376 | e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor | 3e-27 | |
| d1k9oi_ | 376 | e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor | 5e-08 | |
| d1k9oi_ | 376 | e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornwor | 1e-07 | |
| g1m93.1 | 322 | e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine res | 4e-26 | |
| g1m93.1 | 322 | e.1.1.1 (A:,B:,C:) Viral serpin crmA (cytokine res | 7e-08 | |
| g1mtp.1 | 355 | e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax | 2e-23 | |
| g1mtp.1 | 355 | e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax | 3e-09 | |
| g1mtp.1 | 355 | e.1.1.1 (A:,B:) Thermopin {Thermobifida fusca [Tax | 3e-08 |
| >d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} Length = 426 | Back information, alignment and structure |
|---|
| >d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 | Back information, alignment and structure |
|---|
| >d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 | Back information, alignment and structure |
|---|
| >d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 372 | Back information, alignment and structure |
|---|
| >d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 | Back information, alignment and structure |
|---|
| >d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 | Back information, alignment and structure |
|---|
| >d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} Length = 378 | Back information, alignment and structure |
|---|
| >d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 | Back information, alignment and structure |
|---|
| >d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 | Back information, alignment and structure |
|---|
| >d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 379 | Back information, alignment and structure |
|---|
| >d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 | Back information, alignment and structure |
|---|
| >d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 | Back information, alignment and structure |
|---|
| >d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} Length = 420 | Back information, alignment and structure |
|---|
| >d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 | Back information, alignment and structure |
|---|
| >d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 | Back information, alignment and structure |
|---|
| >d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} Length = 385 | Back information, alignment and structure |
|---|
| >d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 | Back information, alignment and structure |
|---|
| >d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 | Back information, alignment and structure |
|---|
| >d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 381 | Back information, alignment and structure |
|---|
| >d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 | Back information, alignment and structure |
|---|
| >d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 | Back information, alignment and structure |
|---|
| >d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} Length = 376 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 357 | |||
| d2b5ti1 | 426 | Antithrombin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1jmja_ | 420 | Heparin cofactor II (Hc-II, leuserpin 2) {Human (H | 100.0 | |
| d1uhga_ | 385 | Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} | 100.0 | |
| d1lj5a_ | 379 | Plasminogen activator inhibitor-1 {Human (Homo sap | 100.0 | |
| g1hle.1 | 375 | Elastase inhibitor {Horse (Equus caballus) [TaxId: | 100.0 | |
| d1xqga_ | 378 | Maspin {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1by7a_ | 381 | Plasminogen activator inhibitor-2 {Human (Homo sap | 100.0 | |
| d1imva_ | 383 | Pigment epithelium-derived factor, PEDF {Human (Ho | 100.0 | |
| d1k9oi_ | 376 | Alaserpin (serpin 1) {Tobacco hornworm (Manduca se | 100.0 | |
| d1qlpa_ | 372 | Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: | 100.0 | |
| g1as4.1 | 369 | Antichymotrypsin, alpha-1 {Human (Homo sapiens) [T | 100.0 | |
| g1lq8.1 | 358 | Protein C inhibitor {Human (Homo sapiens) [TaxId: | 100.0 | |
| g1mtp.1 | 355 | Thermopin {Thermobifida fusca [TaxId: 2021]} | 100.0 | |
| g1jjo.1 | 334 | Neuroserpin {Mouse (Mus musculus) [TaxId: 10090]} | 100.0 | |
| g1m93.1 | 322 | Viral serpin crmA (cytokine response modifier prot | 100.0 |
| >d2b5ti1 e.1.1.1 (I:6-431) Antithrombin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Multi-domain proteins (alpha and beta) fold: Serpins superfamily: Serpins family: Serpins domain: Antithrombin species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=2.6e-60 Score=469.58 Aligned_cols=300 Identities=25% Similarity=0.385 Sum_probs=263.6
Q ss_pred hhHHHHhhHHHHHHHHHHHhccCCCCCEEEchhhHHHHHHHHHcCCCchhHHHHHHhhCCCch------------hhHHh
Q psy5102 10 LILRRGITQMTLDMERAIRSVMTKNQNVVFAPLSIVGALALVLLGSDGQTKDELTHFMGVATG------------RSLSN 77 (357)
Q Consensus 10 ~~~~~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aL~~l~~Ga~g~T~~eL~~~Lg~~~~------------~~ll~ 77 (357)
..+..++++||++||+++....++++|+||||+||+.+|+|+++||+|+|++||.++||++.. +.|..
T Consensus 44 ~~l~~~~~~Fa~~l~~~l~~~~~~~~N~v~SP~si~~aLa~l~~GA~g~T~~el~~~L~~~~~~~~~~~~~~~~~~~l~~ 123 (426)
T d2b5ti1 44 WELSKANSRFATTFYQHLADSKNDNDNIFLSPLSISTAFAMTKLGACNDTLQQLMEVFKFDTISEKTSDQIHFFFAKLNC 123 (426)
T ss_dssp HHHHHHHHHHHHHHHHHHHHTSCTTSCEEECHHHHHHHHHHHHTTCCHHHHHHHHHHTTGGGSCHHHHHTHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHhcCCCCCEEEECHHHHHHHHHHHHHhCchHHHHHHHHhcCCCCCCcchHHHHHHHHHHHHH
Confidence 358999999999999999743257899999999999999999999999999999999999751 23333
Q ss_pred hc----c-cceeeee---eccc---------------------cCCH----HHH---HHHHH---hCCC-cccCCCCCCC
Q psy5102 78 KL----T-AHSLRRG---ITQM---------------------TLDM----ERA---IRSVM---TKNQ-NVVFAPLSIV 117 (357)
Q Consensus 78 ~l----~-~~~l~~a---f~~~---------------------~~dF----~~a---IN~wv---T~g~-~~~l~~~~l~ 117 (357)
.+ + +..++++ |+++ .+|| +.+ ||+|| |+|+ ++++++++++
T Consensus 124 ~l~~~~~~~~~l~~an~l~v~~~~~~~~~f~~~~~~~y~a~~~~vdF~~~~~~a~~~IN~wv~~~T~g~I~~~~~~~~l~ 203 (426)
T d2b5ti1 124 RLYRKANKASKLVSANRLFGDKSLTFNETYQDISELVYGAKLQPLDFKENAEQSRAAINKWVSNKTEGRITDVIPSEAIN 203 (426)
T ss_dssp HHTSCCCSSEEEEEEEEEEEETTSCCCHHHHHHHHHHHSSCCEEECTTTCHHHHHHHHHHHHHHHTTTSCSCSSCTTCSC
T ss_pred HHhccCCCCcEEeeeehhhhcccccchHHHHHHHHHhcCCeEEEecccccHHHHHHHHHHHHHHhcCCCccCCCCccCCC
Confidence 33 2 4556555 6654 6788 233 99999 9999 9999988999
Q ss_pred ccceeEeecc-------cCCCCCCCceeeeeeec------------c---cccccCCCCeEEEe--ecCCeEEEEEEec-
Q psy5102 118 GALALVLLGS-------DGQTKDELTHFMGVATG------------R---SLSNNPEAYASFLE--KMRNEVYMYFILP- 172 (357)
Q Consensus 118 ~~t~lvLvna-------~~~F~~~~T~~~~F~~~------------~---~~~~~~~~~~~vve--y~~~~~sm~iiLP- 172 (357)
++|.++|+|| +.||++..|..++||.. . .|++. +.++++|+ |++++++|+||||
T Consensus 204 ~~t~l~Lvna~yFkg~W~~~F~~~~T~~~~F~~~~~~~v~v~mM~~~~~~~~~~~-~~~~~vveLPy~~~~~sm~iiLP~ 282 (426)
T d2b5ti1 204 ELTVLVLVNTIYFKGLWKSKFSPENTRKELFYKADGESCSASMMYQEGKFRYRRV-AEGTQVLELPFKGDDITMVLILPK 282 (426)
T ss_dssp TTCCEEEEEEEEEEEEBSSCCCGGGCEEEEECCSSSCCEEEEEEEEEEEEEEEEC-GGGCEEEEEEBTTSSEEEEEEECC
T ss_pred chhHHHHHhhhhhccccccCccccccccceeecCCCeEEEeecceeecceeeEEc-cCCeEEEEeecCCCceEEEEEecC
Confidence 9999999999 89999999999999976 1 33333 34899999 9999999999999
Q ss_pred CCCChhHHhhccChhHHHHHHHhcCceeEEEEeceeeEeeccchHHHhhhCCccccCCCCCCCCCCCCCC--CCceeeee
Q psy5102 173 KNPDLSEFTKDLDYDKFSRIIESTNKVDVIYTIPKMKVTSSTELRTVLNTMNVTSMFDVSKSDLSNMLDD--RGVAVDQV 250 (357)
Q Consensus 173 ~~~~L~~l~~~L~~~~l~~~~~~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGl~~~F~~~~adfs~is~~--~~l~vs~v 250 (357)
+..++..+++.|+.+.+..|.++++.+.|+|.||||++++++||+++|++||++++|++..|||++|+.+ ++++|++|
T Consensus 283 ~~~~l~~le~~L~~~~l~~~~~~l~~~~v~l~lPkF~i~~~~dL~~~L~~lGi~~~F~~~~Adfs~i~~~~~~~l~vs~v 362 (426)
T d2b5ti1 283 PEKSLAKVEKELTPEVLQEWLDELEEMMLCVHMPRFRIEDGFSLKEQLQDMGLVDLFSPEKSKLPGIVAEGRDDLYVSDA 362 (426)
T ss_dssp SSSCHHHHHHHCCHHHHHHHHHHCEEEEEEEEEECEEEECCSCHHHHHHTTTCCGGGCTTTCCCTTTSCSSSSCCCCCEE
T ss_pred CCCCHHHHHHhhhHHHHHHHHHhhhhccceEeeeeEEEEEeecHHHHHHHcCChhhcCCccccCccccccCCCCcEEEeE
Confidence 8999999999999999999999999999999999999999999999999999999998757999999753 48999999
Q ss_pred eEEEEEEEccCccccccccceeee-ec---CCCEEEEcCceEEEEEECCCCcEEEEEEEcCCCC
Q psy5102 251 FHKVDIEVTEQGTVAAASTGIIIT-RI---SKPTVKINRPFIFFIYHKPTDSIVFWGSIYKPEP 310 (357)
Q Consensus 251 ~qk~~iev~E~G~~aaa~t~~~~~-~s---~~~~f~~nrPFlf~I~d~~t~~iLF~G~v~~P~~ 310 (357)
+|++.|+|||+|++|+|+|.+.+. ++ .+.+|++||||+|+|+|+.||.|||+|+|.+|+.
T Consensus 363 ~hka~ieVdE~GteAaa~T~~~~~~~s~~~~~~~f~~drPFlF~I~d~~t~~iLF~G~v~~Pt~ 426 (426)
T d2b5ti1 363 FHKAFLEVNEEGSEAAASTAVVIAGRSLNPNRVCFKANRPFLVFIREVPLNTIIFMGRVANPCV 426 (426)
T ss_dssp EEEEEEEECSSEESCCCCCCCCCSCCCCCTTCCCEECCSCEEEEEEETTTCCEEEEEEESCCCC
T ss_pred EEEEEEEECCCceeccccceeeeccccCCCCCcEEEecCCEEEEEEECCCCCEEEEEEecCCCC
Confidence 999999999999999999987665 43 3568999999999999999999999999999973
|
| >d1jmja_ e.1.1.1 (A:) Heparin cofactor II (Hc-II, leuserpin 2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uhga_ e.1.1.1 (A:) Ovalbumin {Hen (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lj5a_ e.1.1.1 (A:) Plasminogen activator inhibitor-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xqga_ e.1.1.1 (A:) Maspin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1by7a_ e.1.1.1 (A:) Plasminogen activator inhibitor-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imva_ e.1.1.1 (A:) Pigment epithelium-derived factor, PEDF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k9oi_ e.1.1.1 (I:) Alaserpin (serpin 1) {Tobacco hornworm (Manduca sexta) [TaxId: 7130]} | Back information, alignment and structure |
|---|
| >d1qlpa_ e.1.1.1 (A:) Antitrypsin, alpha-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|