Psyllid ID: psy5115


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-
MKFHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVELK
cccccccccccccEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHccccccHHHHHHHHHHHHcHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccEEEEEEEEcEEEEEcccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHcccccccccccHHHHccccccHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHH
mkfhtlaviepkfyiccdtcqdwfhgrcvgilqseadnideyicpncnnsssnlanmknltprDFESLRKLMKQIQAHksawpfmepvdpheapdyynvvkepmdlKTIELRIAQQRYKKLSEFIGDMTkifdncryynprespffkhaHQLEMFFVQKVKILREKLVELK
MKFHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVELK
MKFHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVELK
**FHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCN**************************IQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKL****
****TLAVIEPKFYICCDTCQDWFHGRCVGI***********************************SLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLV***
MKFHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVELK
*KFHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSS**ANMKNLTPRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKL****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKFHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVELK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query171 2.2.26 [Sep-21-2011]
Q9W0T12669 Nucleosome-remodeling fac yes N/A 0.935 0.059 0.677 3e-65
Q128303046 Nucleosome-remodeling fac no N/A 0.888 0.049 0.611 7e-58
Q6BER52194 Nucleosome-remodeling fac no N/A 0.918 0.071 0.345 5e-26
Q6CXW4516 Histone acetyltransferase yes N/A 0.590 0.195 0.445 5e-23
Q03330439 Histone acetyltransferase yes N/A 0.649 0.252 0.410 1e-22
Q756G9452 Histone acetyltransferase yes N/A 0.590 0.223 0.435 1e-22
Q92831832 Histone acetyltransferase no N/A 0.608 0.125 0.444 3e-22
Q6FTW5546 Histone acetyltransferase yes N/A 0.590 0.184 0.425 2e-21
Q9UUK2454 Histone acetyltransferase yes N/A 0.567 0.213 0.453 2e-21
Q8WZM0464 Histone acetyltransferase yes N/A 0.567 0.209 0.443 5e-21
>sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 Back     alignment and function desciption
 Score =  247 bits (630), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 109/161 (67%), Positives = 128/161 (79%), Gaps = 1/161 (0%)

Query: 10   EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCN-NSSSNLANMKNLTPRDFESL 68
            E +FYICCD CQDWFHGRCVGILQSEA+ IDEY+CP C   + +N ANMK LT  D E L
Sbjct: 2506 ESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSNDVEEL 2565

Query: 69   RKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDM 128
            + L+KQ+Q HKSAWPFMEPVDP EAPDYY V+KEPMDLK +E+++    Y KLSEFIGDM
Sbjct: 2566 KNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDM 2625

Query: 129  TKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVE 169
            TKIFDNCRYYNP+ES F+K A  LE +FVQK+K  RE + +
Sbjct: 2626 TKIFDNCRYYNPKESSFYKCAEALESYFVQKIKNFRENVFD 2666




Histone-binding component of NURF (nucleosome remodeling factor), a complex which catalyzes ATP-dependent nucleosome sliding and facilitates transcription of chromatin. Specifically recognizes H3 tails trimethylated on 'Lys-4' (H3K4me3), which mark transcription start sites of virtually all active genes. Required for homeotic gene expression, proper larval blood cell development, normal male X chromosome morphology, ecdysteroid signaling and metamorphosis.
Drosophila melanogaster (taxid: 7227)
>sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens GN=BPTF PE=1 SV=3 Back     alignment and function description
>sp|Q6BER5|NU301_CAEEL Nucleosome-remodeling factor subunit NURF301-like OS=Caenorhabditis elegans GN=nurf-1 PE=1 SV=2 Back     alignment and function description
>sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 Back     alignment and function description
>sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q92831|KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens GN=KAT2B PE=1 SV=3 Back     alignment and function description
>sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 Back     alignment and function description
>sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 Back     alignment and function description
>sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
332027303 2702 Nucleosome-remodeling factor subunit [Ac 0.947 0.059 0.785 2e-74
383857078 2734 PREDICTED: LOW QUALITY PROTEIN: nucleoso 0.947 0.059 0.785 4e-74
322790016 2261 hypothetical protein SINV_12870 [Solenop 0.947 0.071 0.779 5e-74
340712317 2081 PREDICTED: nucleosome-remodeling factor 0.947 0.077 0.779 8e-74
307206270 3705 Nucleosome-remodeling factor subunit NUR 0.947 0.043 0.779 1e-73
307180228 3651 Nucleosome-remodeling factor subunit NUR 0.935 0.043 0.782 1e-73
328788592 2735 PREDICTED: nucleosome-remodeling factor 0.947 0.059 0.779 1e-73
380014032 2734 PREDICTED: LOW QUALITY PROTEIN: nucleoso 0.947 0.059 0.779 2e-73
340712315 2733 PREDICTED: nucleosome-remodeling factor 0.947 0.059 0.779 2e-73
350417610 2733 PREDICTED: nucleosome-remodeling factor 0.947 0.059 0.779 3e-73
>gi|332027303|gb|EGI67387.1| Nucleosome-remodeling factor subunit [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  283 bits (723), Expect = 2e-74,   Method: Composition-based stats.
 Identities = 128/163 (78%), Positives = 140/163 (85%), Gaps = 1/163 (0%)

Query: 10   EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCN-NSSSNLANMKNLTPRDFESL 68
            E KFYICCD CQDWFHGRCVGILQSEADNIDEY+CPNC  NSS N ANMKNL  +D + L
Sbjct: 2540 ETKFYICCDKCQDWFHGRCVGILQSEADNIDEYVCPNCQRNSSVNFANMKNLNAKDLDLL 2599

Query: 69   RKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDM 128
            +KL+KQIQAHKSAWPFMEPVDP+EAPDYY V+KEPMDL+TIELRI  + YKKLSEFIGDM
Sbjct: 2600 KKLIKQIQAHKSAWPFMEPVDPNEAPDYYKVIKEPMDLQTIELRINDRSYKKLSEFIGDM 2659

Query: 129  TKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVELK 171
            TKIFDNCRYYNP+ESPFFK A  LE +FV K+K LREK  E K
Sbjct: 2660 TKIFDNCRYYNPKESPFFKCAESLETYFVHKIKSLREKFSEGK 2702




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383857078|ref|XP_003704033.1| PREDICTED: LOW QUALITY PROTEIN: nucleosome-remodeling factor subunit NURF301-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|322790016|gb|EFZ15092.1| hypothetical protein SINV_12870 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|340712317|ref|XP_003394708.1| PREDICTED: nucleosome-remodeling factor subunit NURF301-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307206270|gb|EFN84335.1| Nucleosome-remodeling factor subunit NURF301 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307180228|gb|EFN68261.1| Nucleosome-remodeling factor subunit NURF301 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328788592|ref|XP_395718.4| PREDICTED: nucleosome-remodeling factor subunit NURF301-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380014032|ref|XP_003691048.1| PREDICTED: LOW QUALITY PROTEIN: nucleosome-remodeling factor subunit NURF301-like [Apis florea] Back     alignment and taxonomy information
>gi|340712315|ref|XP_003394707.1| PREDICTED: nucleosome-remodeling factor subunit NURF301-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417610|ref|XP_003491506.1| PREDICTED: nucleosome-remodeling factor subunit NURF301-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query171
FB|FBgn00005412669 E(bx) "Enhancer of bithorax" [ 0.935 0.059 0.677 8.1e-59
UNIPROTKB|E9PE19650 BPTF "Nucleosome-remodeling fa 0.888 0.233 0.605 8.9e-54
UNIPROTKB|J3QQQ8420 BPTF "Nucleosome-remodeling fa 0.888 0.361 0.605 8.9e-54
UNIPROTKB|E1C5C72789 BPTF "Uncharacterized protein" 0.888 0.054 0.631 1.8e-53
UNIPROTKB|E1C5C82802 BPTF "Uncharacterized protein" 0.888 0.054 0.631 1.8e-53
UNIPROTKB|F1LX762894 F1LX76 "Uncharacterized protei 0.888 0.052 0.625 8.1e-53
UNIPROTKB|F1M1V52952 F1M1V5 "Uncharacterized protei 0.888 0.051 0.625 8.3e-53
UNIPROTKB|F1M1V43013 F1M1V4 "Uncharacterized protei 0.888 0.050 0.625 8.5e-53
UNIPROTKB|F1PFZ42716 BPTF "Uncharacterized protein" 0.888 0.055 0.611 2e-52
UNIPROTKB|E7ETD62764 BPTF "Nucleosome-remodeling fa 0.888 0.054 0.611 2e-52
FB|FBgn0000541 E(bx) "Enhancer of bithorax" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 620 (223.3 bits), Expect = 8.1e-59, P = 8.1e-59
 Identities = 109/161 (67%), Positives = 128/161 (79%)

Query:    10 EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSS-SNLANMKNLTPRDFESL 68
             E +FYICCD CQDWFHGRCVGILQSEA+ IDEY+CP C   + +N ANMK LT  D E L
Sbjct:  2506 ESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSNDVEEL 2565

Query:    69 RKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDM 128
             + L+KQ+Q HKSAWPFMEPVDP EAPDYY V+KEPMDLK +E+++    Y KLSEFIGDM
Sbjct:  2566 KNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDM 2625

Query:   129 TKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVE 169
             TKIFDNCRYYNP+ES F+K A  LE +FVQK+K  RE + +
Sbjct:  2626 TKIFDNCRYYNPKESSFYKCAEALESYFVQKIKNFRENVFD 2666


GO:0042766 "nucleosome mobilization" evidence=IDA;TAS
GO:0006351 "transcription, DNA-dependent" evidence=IMP;IDA
GO:0016589 "NURF complex" evidence=NAS;IDA;TAS
GO:0006334 "nucleosome assembly" evidence=NAS
GO:0030097 "hemopoiesis" evidence=IMP
GO:0006338 "chromatin remodeling" evidence=IMP
GO:0003677 "DNA binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0035076 "ecdysone receptor-mediated signaling pathway" evidence=IGI
GO:0035073 "pupariation" evidence=IMP
GO:0016922 "ligand-dependent nuclear receptor binding" evidence=IPI
GO:0048813 "dendrite morphogenesis" evidence=IMP
GO:0006325 "chromatin organization" evidence=IMP
GO:0045747 "positive regulation of Notch signaling pathway" evidence=IGI;IMP
GO:0007095 "mitotic G2 DNA damage checkpoint" evidence=IGI
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|E9PE19 BPTF "Nucleosome-remodeling factor subunit BPTF" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QQQ8 BPTF "Nucleosome-remodeling factor subunit BPTF" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5C7 BPTF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C5C8 BPTF "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1LX76 F1LX76 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M1V5 F1M1V5 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M1V4 F1M1V4 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFZ4 BPTF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7ETD6 BPTF "Nucleosome-remodeling factor subunit BPTF" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9W0T1NU301_DROMENo assigned EC number0.67700.93560.0599yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
cd05509101 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s 9e-46
smart00297107 smart00297, BROMO, bromo domain 8e-31
cd0436999 cd04369, Bromodomain, Bromodomain 2e-29
cd05504115 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o 2e-25
cd0550397 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA 1e-23
cd05511112 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf 3e-22
pfam0043984 pfam00439, Bromodomain, Bromodomain 3e-22
cd0550699 cd05506, Bromo_plant1, Bromodomain, uncharacterize 1e-21
cd05498102 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik 8e-21
cd05497107 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like 2e-20
cd05499102 cd05499, Bromo_BDF1_2_II, Bromodomain 6e-20
cd05500103 cd05500, Bromo_BDF1_2_I, Bromodomain 7e-19
COG5076 371 COG5076, COG5076, Transcription factor involved in 7e-19
cd0551298 cd05512, Bromo_brd1_like, Bromodomain; brd1_like s 1e-18
cd05518103 cd05518, Bromo_polybromo_IV, Bromodomain, polybrom 2e-18
cd05510112 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s 3e-18
cd05495108 cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub 9e-16
cd05502109 cd05502, Bromo_tif1_like, Bromodomain; tif1_like s 2e-15
cd0550597 cd05505, Bromo_WSTF_like, Bromodomain; Williams sy 2e-15
cd05528112 cd05528, Bromo_AAA, Bromodomain; sub-family co-occ 3e-14
cd05515105 cd05515, Bromo_polybromo_V, Bromodomain, polybromo 2e-13
cd05529128 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe 3e-11
cd05496119 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I 2e-10
cd05521106 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in 4e-10
cd05507104 cd05507, Bromo_brd8_like, Bromodomain, brd8_like s 6e-10
cd05522104 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i 1e-09
cd05516107 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su 1e-09
cd0551398 cd05513, Bromo_brd7_like, Bromodomain, brd7_like s 1e-09
COG5076371 COG5076, COG5076, Transcription factor involved in 3e-09
cd05519103 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam 6e-09
cd05520103 cd05520, Bromo_polybromo_III, Bromodomain, polybro 2e-08
cd05517103 cd05517, Bromo_polybromo_II, Bromodomain, polybrom 3e-08
cd05525106 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa 8e-08
smart0024947 smart00249, PHD, PHD zinc finger 2e-07
cd0550899 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf 3e-07
cd05524113 cd05524, Bromo_polybromo_I, Bromodomain, polybromo 3e-07
cd05494114 cd05494, Bromodomain_1, Bromodomain; uncharacteriz 8e-07
cd05501102 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li 6e-06
pfam0062851 pfam00628, PHD, PHD-finger 9e-06
cd05526110 cd05526, Bromo_polybromo_VI, Bromodomain, polybrom 0.001
>gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily Back     alignment and domain information
 Score =  145 bits (367), Expect = 9e-46
 Identities = 48/98 (48%), Positives = 71/98 (72%)

Query: 64  DFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSE 123
            +  L+K++  ++ HKSAWPF+EPVD  EAPDYY+V+K+PMDL T+E ++    Y  L E
Sbjct: 2   LYTQLKKVLDSLKNHKSAWPFLEPVDKEEAPDYYDVIKKPMDLSTMEEKLENGYYVTLEE 61

Query: 124 FIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVK 161
           F+ D+  IFDNCR YN  ++ ++K A++LE FF +K+K
Sbjct: 62  FVADLKLIFDNCRLYNGPDTEYYKCANKLEKFFWKKLK 99


Gcn5p is a histone acetyltransferase (HAT) which mediates acetylation of histones at lysine residues; such acetylation is generally correlated with the activation of transcription. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 101

>gnl|CDD|197636 smart00297, BROMO, bromo domain Back     alignment and domain information
>gnl|CDD|99922 cd04369, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily Back     alignment and domain information
>gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain Back     alignment and domain information
>gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain Back     alignment and domain information
>gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily Back     alignment and domain information
>gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV Back     alignment and domain information
>gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily Back     alignment and domain information
>gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily Back     alignment and domain information
>gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily Back     alignment and domain information
>gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V Back     alignment and domain information
>gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
>gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup Back     alignment and domain information
>gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup Back     alignment and domain information
>gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III Back     alignment and domain information
>gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II Back     alignment and domain information
>gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family Back     alignment and domain information
>gnl|CDD|214584 smart00249, PHD, PHD zinc finger Back     alignment and domain information
>gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily Back     alignment and domain information
>gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I Back     alignment and domain information
>gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily Back     alignment and domain information
>gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily Back     alignment and domain information
>gnl|CDD|201356 pfam00628, PHD, PHD-finger Back     alignment and domain information
>gnl|CDD|99956 cd05526, Bromo_polybromo_VI, Bromodomain, polybromo repeat VI Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 171
cd05496119 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub 100.0
cd05497107 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily 99.98
cd0550597 Bromo_WSTF_like Bromodomain; Williams syndrome tra 99.98
cd05495108 Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb 99.98
cd05502109 Bromo_tif1_like Bromodomain; tif1_like subfamily. 99.97
cd05504115 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li 99.97
cd0550397 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s 99.97
cd0550899 Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC 99.97
cd05511112 Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum 99.97
cd05507104 Bromo_brd8_like Bromodomain, brd8_like subgroup. I 99.97
cd05509101 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. 99.97
cd05500103 Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami 99.97
cd05510112 Bromo_SPT7_like Bromodomain; SPT7_like subfamily. 99.97
cd05501102 Bromo_SP100C_like Bromodomain, SP100C_like subfami 99.97
cd05499102 Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam 99.96
cd0550699 Bromo_plant1 Bromodomain, uncharacterized subfamil 99.96
cd05516107 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s 99.96
cd05498102 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil 99.96
cd05528112 Bromo_AAA Bromodomain; sub-family co-occurring wit 99.96
cd0551398 Bromo_brd7_like Bromodomain, brd7_like subgroup. T 99.96
cd0551298 Bromo_brd1_like Bromodomain; brd1_like subfamily. 99.96
cd05529128 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like 99.96
cd05524113 Bromo_polybromo_I Bromodomain, polybromo repeat I. 99.96
KOG1474|consensus 640 99.95
cd05519103 Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci 99.95
cd05525106 Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 99.95
cd05515105 Bromo_polybromo_V Bromodomain, polybromo repeat V. 99.95
cd05520103 Bromo_polybromo_III Bromodomain, polybromo repeat 99.95
smart00297107 BROMO bromo domain. 99.95
cd05517103 Bromo_polybromo_II Bromodomain, polybromo repeat I 99.95
cd05518103 Bromo_polybromo_IV Bromodomain, polybromo repeat I 99.95
cd05522104 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l 99.94
PF0043984 Bromodomain: Bromodomain; InterPro: IPR001487 Brom 99.93
cd05521106 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik 99.93
cd05492109 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family 99.93
cd0436999 Bromodomain Bromodomain. Bromodomains are found in 99.92
KOG1245|consensus1404 99.91
cd05526110 Bromo_polybromo_VI Bromodomain, polybromo repeat V 99.88
COG5076 371 Transcription factor involved in chromatin remodel 99.82
KOG1472|consensus720 99.66
cd05494114 Bromodomain_1 Bromodomain; uncharacterized subfami 99.45
KOG0955|consensus 1051 99.44
cd05491119 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, 99.41
KOG0008|consensus1563 99.33
KOG1827|consensus 629 99.3
KOG0008|consensus 1563 99.17
KOG0386|consensus1157 99.13
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 99.05
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.98
KOG1472|consensus 720 98.96
KOG1828|consensus 418 98.66
KOG1828|consensus 418 98.65
KOG1474|consensus 640 98.52
cd05493131 Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- 98.21
KOG4299|consensus 613 97.94
KOG1632|consensus 345 97.82
KOG4323|consensus 464 97.7
KOG3612|consensus 588 97.64
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 97.46
COG5076371 Transcription factor involved in chromatin remodel 97.44
KOG0383|consensus 696 97.36
KOG1512|consensus381 97.19
KOG0644|consensus1113 97.09
KOG0825|consensus 1134 96.84
KOG1844|consensus 508 96.53
KOG0954|consensus 893 96.37
KOG2752|consensus345 96.24
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 95.84
KOG0955|consensus 1051 95.69
KOG0957|consensus707 95.35
KOG1473|consensus 1414 95.27
PF0749650 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi 94.3
KOG1632|consensus345 93.7
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 93.42
KOG0732|consensus 1080 92.83
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 92.75
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 92.23
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 92.07
PF07227446 DUF1423: Protein of unknown function (DUF1423); In 91.97
COG5141 669 PHD zinc finger-containing protein [General functi 91.72
cd0073050 rubredoxin Rubredoxin; nonheme iron binding domain 91.2
KOG0956|consensus 900 90.89
COG177355 Rubredoxin [Energy production and conversion] 89.36
KOG0957|consensus 707 89.34
PF0764930 C1_3: C1-like domain; InterPro: IPR011424 This sho 89.2
TIGR0260669 antidote_CC2985 putative addiction module antidote 88.74
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 88.1
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 87.46
KOG0644|consensus 1113 87.42
PF10497105 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida 86.47
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 85.38
KOG1512|consensus381 85.01
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 85.0
KOG1827|consensus 629 84.86
PF0369380 RHH_2: Uncharacterised protein family (UPF0156); I 84.13
PF14372101 DUF4413: Domain of unknown function (DUF4413) 82.8
KOG4443|consensus 694 82.22
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 81.4
>cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily Back     alignment and domain information
Probab=100.00  E-value=4.2e-32  Score=183.66  Aligned_cols=107  Identities=25%  Similarity=0.450  Sum_probs=102.5

Q ss_pred             hhHHHHHHHHHHHHHhCcCCCCCccCCCCCCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCC
Q psy5115          62 PRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPR  141 (171)
Q Consensus        62 ~~~~~~~~~~l~~l~~~~~~~~F~~pv~~~~~p~Y~~~i~~Pmdl~~I~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yn~~  141 (171)
                      +++.+.|..+++.|++++.+++|..||++..+|+|+++|++||||+||++||++|.|.++.+|.+||+|||.||..||++
T Consensus         4 ~~w~~~c~~il~~l~~~~~s~~F~~PVd~~~~pdY~~iIk~PmDL~tIk~kL~~~~Y~~~~ef~~D~~lif~Na~~yN~~   83 (119)
T cd05496           4 SDWKKQCKELVNLMWDCEDSEPFRQPVDLLKYPDYRDIIDTPMDLGTVKETLFGGNYDDPMEFAKDVRLIFSNSKSYTPN   83 (119)
T ss_pred             HHHHHHHHHHHHHHHhCCccccccCCCChhhcCcHHHHhCCcccHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHCCC
Confidence            46788999999999999999999999999999999999999999999999999999999999999999999999999985


Q ss_pred             -CCHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy5115         142 -ESPFFKHAHQLEMFFVQKVKILREKLV  168 (171)
Q Consensus       142 -~s~~~~~a~~l~~~f~~~~~~~~~~~~  168 (171)
                       +|.++.+|..|++.|++.++++.+.+.
T Consensus        84 ~~s~i~~~a~~L~~~F~~~~~~l~~~~~  111 (119)
T cd05496          84 KRSRIYSMTLRLSALFEEHIKKIISDWK  111 (119)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence             899999999999999999999988774



WDR9 is a human gene located in the Down Syndrome critical region-2 of chromosome 21. It encodes for a nuclear protein containing WD40 repeats and two bromodomains, which may function as a transcriptional regulator involved in chromatin remodeling and play a role in embryonic development. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine.

>cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I Back     alignment and domain information
>cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) Back     alignment and domain information
>cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily Back     alignment and domain information
>cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily Back     alignment and domain information
>cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily Back     alignment and domain information
>cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily Back     alignment and domain information
>cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily Back     alignment and domain information
>cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily Back     alignment and domain information
>cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup Back     alignment and domain information
>cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily Back     alignment and domain information
>cd05500 Bromo_BDF1_2_I Bromodomain Back     alignment and domain information
>cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily Back     alignment and domain information
>cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily Back     alignment and domain information
>cd05499 Bromo_BDF1_2_II Bromodomain Back     alignment and domain information
>cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants Back     alignment and domain information
>cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals Back     alignment and domain information
>cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II Back     alignment and domain information
>cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains Back     alignment and domain information
>cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup Back     alignment and domain information
>cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily Back     alignment and domain information
>cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily Back     alignment and domain information
>cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi Back     alignment and domain information
>cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family Back     alignment and domain information
>cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V Back     alignment and domain information
>cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III Back     alignment and domain information
>smart00297 BROMO bromo domain Back     alignment and domain information
>cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II Back     alignment and domain information
>cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV Back     alignment and domain information
>cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] Back     alignment and domain information
>cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi Back     alignment and domain information
>cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family Back     alignment and domain information
>cd04369 Bromodomain Bromodomain Back     alignment and domain information
>KOG1245|consensus Back     alignment and domain information
>cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>KOG0008|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG1472|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG1828|consensus Back     alignment and domain information
>KOG1474|consensus Back     alignment and domain information
>cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins Back     alignment and domain information
>KOG4299|consensus Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>KOG4323|consensus Back     alignment and domain information
>KOG3612|consensus Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1844|consensus Back     alignment and domain information
>KOG0954|consensus Back     alignment and domain information
>KOG2752|consensus Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG0955|consensus Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>KOG1473|consensus Back     alignment and domain information
>PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1632|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0732|consensus Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG0956|consensus Back     alignment and domain information
>COG1773 Rubredoxin [Energy production and conversion] Back     alignment and domain information
>KOG0957|consensus Back     alignment and domain information
>PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines Back     alignment and domain information
>TIGR02606 antidote_CC2985 putative addiction module antidote protein, CC2985 family Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1512|consensus Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG1827|consensus Back     alignment and domain information
>PF03693 RHH_2: Uncharacterised protein family (UPF0156); InterPro: IPR022789 This family of proteins are about 80 amino acids in length and their function is unknown Back     alignment and domain information
>PF14372 DUF4413: Domain of unknown function (DUF4413) Back     alignment and domain information
>KOG4443|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
3qzv_A174 Crystal Structure Of Bptf Phd-Linker-Bromo In Compl 7e-58
2ri7_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 7e-58
2f6j_A174 Crystal Structure Of Phd Finger-Linker-Bromodomain 7e-56
3uv2_A126 Crystal Structure Of The Bromodomain Of Human Nucle 2e-38
3qzt_A115 Crystal Structure Of Bptf Bromo In Complex With His 4e-37
3qzs_A115 Crystal Structure Of Bptf Bromo In Complex With His 1e-36
1e6i_A121 Bromodomain From Gcn5 Complexed With Acetylated H4 4e-24
3gg3_A119 Crystal Structure Of The Bromodomain Of Human Pcaf 3e-23
1n72_A118 Structure And Ligand Of A Histone Acetyltransferase 9e-23
1f68_A103 Nmr Solution Structure Of The Bromodomain From Huma 9e-21
3d7c_A112 Crystal Structure Of The Bromodomain Of Human Gcn5, 9e-21
3nxb_A116 Crystal Structure Of The Bromodomain Of Human Cecr2 5e-18
2wp2_A120 Structure Of Brdt Bromodomain Bd1 Bound To A Diacet 1e-14
2rfj_A119 Crystal Structure Of The Bromo Domain 1 In Human Br 7e-14
4don_A145 Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy 2e-13
3jvj_A131 Crystal Structure Of The Bromodomain 1 In Mouse Brd 2e-13
4hbw_A127 Crystal Structure Of The First Bromodomain Of Human 3e-13
3g0l_A117 Crystal Structure Of Human Bromodomain Adjacent To 3e-13
2oss_A127 Crystal Structure Of The Bromo Domain 1 In Human Br 3e-13
2e7o_A112 Solution Structure Of The Bromodomain From Human Br 3e-13
2l5e_A128 Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt 4e-13
2ydw_A153 Crystal Structure Of The First Bromodomain Of Human 5e-13
4a9e_A154 N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- 5e-13
2fui_A62 Nmr Solution Structure Of Phd Finger Fragment Of Hu 5e-13
2yw5_A138 Solution Structure Of The Bromodomain From Human Br 6e-13
3o33_A184 Crystal Structure Of Trim24 Phd-Bromo In The Free S 9e-13
3rcw_A135 Crystal Structure Of The Bromodomain Of Human Brd1 1e-12
2nxb_A123 Crystal Structure Of Human Bromodomain Containing P 5e-12
3uv4_A158 Crystal Structure Of The Second Bromodomain Of Huma 5e-11
3u5m_A207 Crystal Structure Of Trim33 Phd-Bromo In The Free S 9e-11
1eqf_A280 Crystal Structure Of The Double Bromodomain Module 1e-10
3aqa_A128 Crystal Structure Of The Human Brd2 Bd1 Bromodomain 1e-10
3uv5_A265 Crystal Structure Of The Tandem Bromodomains Of Hum 1e-10
2yyn_A135 Crystal Sturcture Of Human Bromodomain Protein Leng 1e-10
1x0j_A122 Crystal Structure Analysis Of The N-Terminal Bromod 1e-10
3aad_A292 Structure Of The Histone Chaperone Cia/asf1-double 1e-10
3hmh_A155 Crystal Structure Of The Second Bromodomain Of Huma 2e-10
2wp1_A126 Structure Of Brdt Bromodomain 2 Bound To An Acetyla 3e-10
3i3j_A124 Crystal Structure Of The Bromodomain Of Human Ep300 5e-10
3oni_A114 Crystal Structure Of The Second Bromodomain Of Huma 6e-10
2dvv_A112 Crystal Structure Of The Second Bromodomain Of The 6e-10
2g4a_A116 Solution Structure Of A Bromodomain From Ring3 Prot 7e-10
3kv5_D 488 Structure Of Kiaa1718, Human Jumonji Demethylase, I 7e-10
2d9e_A121 Solution Structure Of The Bromodomain Of Peregrin L 9e-10
3dwy_A119 Crystal Structure Of The Bromodomain Of Human Crebb 2e-09
2oo1_A113 Crystal Structure Of The Bromo Domain 2 Of Human Br 2e-09
1jsp_B121 Nmr Structure Of Cbp Bromodomain In Complex With P5 2e-09
2e7n_A117 Solution Structure Of The Second Bromodomain From H 2e-09
3tlp_A150 Crystal Structure Of The Fourth Bromodomain Of Huma 2e-09
3jvl_A120 Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le 4e-09
2i8n_A114 Solution Structure Of The Second Bromodomain Of Brd 4e-09
3kv4_A 447 Structure Of Phf8 In Complex With Histone H3 Length 4e-09
3dai_A130 Crystal Structure Of The Bromodomain Of The Human A 4e-09
3lxj_A136 Crystal Structure Of The Bromodomain Of Human Aaa D 5e-09
2ouo_A130 Crystal Structure Of The Bromo Domain 2 In Human Br 5e-09
2lsp_B128 Solution Structures Of Brd4 Second Bromodomain With 6e-09
3kqi_A75 Crystal Structure Of Phf2 Phd Domain Complexed With 2e-08
2r0v_A346 Structure Of The Rsc4 Tandem Bromodomain Acetylated 2e-08
2r10_A361 Structure Of An Acetylated Rsc4 Tandem Bromodomain 2e-08
2ktb_B121 Solution Structure Of The Second Bromodomain Of Hum 2e-08
3ljw_A120 Crystal Structure Of The Second Bromodomain Of Huma 2e-08
3hmf_A116 Crystal Structure Of The Second Bromodomain Of Huma 3e-08
1we9_A64 Solution Structure Of Phd Domain In Nucleic Acid Bi 4e-08
2dww_A114 Crystal Structure Of Bromodomain-Containing Protein 6e-08
3fkm_X166 Plasmodium Falciparum Bromodomain-Containing Protei 9e-08
3q2e_A123 Crystal Structure Of The Second Bromodomain Of Huma 2e-07
1wem_A76 Solution Structure Of Phd Domain In Death Inducer- 4e-07
3mb3_A135 Crystal Structure Of The Second Bromodomain Of Plec 1e-06
3hme_A123 Crystal Structure Of Human Bromodomain Containing 9 2e-06
2i7k_A117 Solution Structure Of The Bromodomain Of Human Brd7 2e-06
2dkw_A131 Solution Structure Of The Bromodomain Of Human Prot 2e-06
2r0y_A311 Structure Of The Rsc4 Tandem Bromodomain In Complex 2e-06
2r0s_A285 Crystal Structure Of The Rsc4 Tandem Bromodomain Le 3e-06
1wep_A79 Solution Structure Of Phd Domain In Phf8 Length = 7 3e-06
3mqm_A126 Crystal Structure Of The Bromodomain Of Human Ash1l 6e-06
3k2j_A130 Crystal Structure Of The 3rd Bromodomain Of Human P 2e-05
3g0j_A124 Crystal Structure Of The Fifth Bromodomain Of Human 5e-05
2yqd_A120 Solution Structure Of The Fifth Bromodomain From Mo 5e-05
3iu5_A116 Crystal Structure Of The First Bromodomain Of Human 7e-05
3n9l_A 528 Cekdm7a From C.Elegans, Complex With H3k4me3 Peptid 6e-04
>pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 Back     alignment and structure

Iteration: 1

Score = 219 bits (557), Expect = 7e-58, Method: Compositional matrix adjust. Identities = 93/155 (60%), Positives = 125/155 (80%) Query: 10 EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLR 69 E KFYI CD CQ+W+HGRCVGILQSEA+ IDEY+CP C ++ + + LT +D+E L+ Sbjct: 19 ESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLK 78 Query: 70 KLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMT 129 ++++ +QAHK AWPF+EPVDP++APDYY V+KEPMDL T+E R+ ++ Y+KL+EF+ DMT Sbjct: 79 RVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMT 138 Query: 130 KIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILR 164 KIFDNCRYYNP +SPF++ A LE FFVQK+K + Sbjct: 139 KIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK 173
>pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 Back     alignment and structure
>pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 Back     alignment and structure
>pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 Back     alignment and structure
>pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 Back     alignment and structure
>pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 Back     alignment and structure
>pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 Back     alignment and structure
>pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 Back     alignment and structure
>pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 Back     alignment and structure
>pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 Back     alignment and structure
>pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 Back     alignment and structure
>pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 Back     alignment and structure
>pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 Back     alignment and structure
>pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 Back     alignment and structure
>pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 Back     alignment and structure
>pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 Back     alignment and structure
>pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 Back     alignment and structure
>pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 Back     alignment and structure
>pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 Back     alignment and structure
>pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 Back     alignment and structure
>pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 Back     alignment and structure
>pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 Back     alignment and structure
>pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 Back     alignment and structure
>pdb|2FUI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Human Bptf In Free State Length = 62 Back     alignment and structure
>pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 Back     alignment and structure
>pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 Back     alignment and structure
>pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 Back     alignment and structure
>pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 Back     alignment and structure
>pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 Back     alignment and structure
>pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 Back     alignment and structure
>pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 Back     alignment and structure
>pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 Back     alignment and structure
>pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 Back     alignment and structure
>pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 Back     alignment and structure
>pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 Back     alignment and structure
>pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 Back     alignment and structure
>pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 Back     alignment and structure
>pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 Back     alignment and structure
>pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 Back     alignment and structure
>pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 Back     alignment and structure
>pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 Back     alignment and structure
>pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 Back     alignment and structure
>pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 Back     alignment and structure
>pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 Back     alignment and structure
>pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 Back     alignment and structure
>pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 Back     alignment and structure
>pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 Back     alignment and structure
>pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 Back     alignment and structure
>pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 Back     alignment and structure
>pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 Back     alignment and structure
>pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 Back     alignment and structure
>pdb|3KV4|A Chain A, Structure Of Phf8 In Complex With Histone H3 Length = 447 Back     alignment and structure
>pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 Back     alignment and structure
>pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 Back     alignment and structure
>pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 Back     alignment and structure
>pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 Back     alignment and structure
>pdb|3KQI|A Chain A, Crystal Structure Of Phf2 Phd Domain Complexed With H3k4me3 Peptide Length = 75 Back     alignment and structure
>pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 Back     alignment and structure
>pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 Back     alignment and structure
>pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 Back     alignment and structure
>pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 Back     alignment and structure
>pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|1WE9|A Chain A, Solution Structure Of Phd Domain In Nucleic Acid Binding Protein-like Np_197993 Length = 64 Back     alignment and structure
>pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 Back     alignment and structure
>pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 Back     alignment and structure
>pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 Back     alignment and structure
>pdb|1WEM|A Chain A, Solution Structure Of Phd Domain In Death Inducer- Obliterator 1(Dio-1) Length = 76 Back     alignment and structure
>pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 Back     alignment and structure
>pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 Back     alignment and structure
>pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 Back     alignment and structure
>pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 Back     alignment and structure
>pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 Back     alignment and structure
>pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 Back     alignment and structure
>pdb|1WEP|A Chain A, Solution Structure Of Phd Domain In Phf8 Length = 79 Back     alignment and structure
>pdb|3MQM|A Chain A, Crystal Structure Of The Bromodomain Of Human Ash1l Length = 126 Back     alignment and structure
>pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 Back     alignment and structure
>pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 Back     alignment and structure
>pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 Back     alignment and structure
>pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 Back     alignment and structure
>pdb|3N9L|A Chain A, Cekdm7a From C.Elegans, Complex With H3k4me3 Peptide And Nog Length = 528 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query171
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 1e-62
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 4e-46
2d9e_A121 Peregrin; four-helix bundle, transcription activat 1e-44
3d7c_A112 General control of amino acid synthesis protein 5; 1e-44
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 4e-44
3nxb_A116 CAT eye syndrome critical region protein 2; struct 9e-44
3rcw_A135 Bromodomain-containing protein 1; transcription, s 2e-43
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 7e-43
3uv4_A158 Second bromodomain of human transcription initiat 2e-42
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 5e-42
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 7e-41
4alg_A154 Bromodomain-containing protein 2; signaling protei 1e-40
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 3e-40
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 5e-40
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 6e-40
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 2e-33
3fkm_X166 Signaling protein; bromodomain, malaria, structura 1e-39
3aad_A292 Transcription initiation factor TFIID subunit 1; p 1e-39
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 4e-32
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 4e-39
3p1f_A119 CREB-binding protein; structural genomics consorti 3e-38
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 8e-38
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 9e-38
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 2e-37
2grc_A129 Probable global transcription activator SNF2L4; br 3e-37
2dat_A123 Possible global transcription activator SNF2L2; br 3e-37
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-36
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 1e-36
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-36
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 3e-36
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 4e-36
3dai_A130 ATPase family AAA domain-containing protein 2; anc 5e-36
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 2e-35
2r0y_A311 Chromatin structure-remodeling complex protein RSC 1e-34
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 4e-26
2r10_A361 Chromatin structure-remodeling complex protein RSC 1e-34
2r10_A 361 Chromatin structure-remodeling complex protein RSC 3e-25
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 1e-31
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 6e-29
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 2e-26
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-25
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 2e-24
1we9_A64 PHD finger family protein; structural genomics, PH 7e-18
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 6e-15
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 1e-14
1wem_A76 Death associated transcription factor 1; structura 2e-14
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 3e-13
3kv5_D 488 JMJC domain-containing histone demethylation prote 5e-13
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 2e-12
1wee_A72 PHD finger family protein; structural genomics, PH 4e-12
3o70_A68 PHD finger protein 13; PHF13, structural genomics 5e-12
2k16_A75 Transcription initiation factor TFIID subunit 3; p 1e-11
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 2e-11
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 4e-11
1wew_A78 DNA-binding family protein; structural genomics, P 8e-08
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 9e-08
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 7e-07
1weu_A91 Inhibitor of growth family, member 4; structural g 3e-06
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 3e-06
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 6e-05
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 6e-05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 1e-04
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 3e-04
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 Back     alignment and structure
 Score =  190 bits (483), Expect = 1e-62
 Identities = 93/155 (60%), Positives = 125/155 (80%)

Query: 10  EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLR 69
           E KFYI CD CQ+W+HGRCVGILQSEA+ IDEY+CP C ++   +  +  LT +D+E L+
Sbjct: 19  ESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLK 78

Query: 70  KLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMT 129
           ++++ +QAHK AWPF+EPVDP++APDYY V+KEPMDL T+E R+ ++ Y+KL+EF+ DMT
Sbjct: 79  RVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMT 138

Query: 130 KIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILR 164
           KIFDNCRYYNP +SPF++ A  LE FFVQK+K  +
Sbjct: 139 KIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK 173


>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 100.0
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 100.0
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 100.0
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 100.0
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 100.0
3g0l_A117 Hwalp4, bromodomain adjacent to zinc finger domain 100.0
2d9e_A121 Peregrin; four-helix bundle, transcription activat 100.0
3d7c_A112 General control of amino acid synthesis protein 5; 100.0
3q2e_A123 Bromodomain and WD repeat-containing protein 1; st 99.98
2i7k_A117 Bromodomain-containing protein 7; helix, LEFT-hand 99.97
1e6i_A121 Transcriptional activator GCN5; gene regulation, b 99.97
4alg_A154 Bromodomain-containing protein 2; signaling protei 99.97
2oss_A127 HUNK1 protein, bromodomain-containing protein 4; B 99.97
3rcw_A135 Bromodomain-containing protein 1; transcription, s 99.97
3jvl_A120 Bromodomain-containing protein 4; alpha helical, N 99.97
3mb3_A135 PH-interacting protein; PHIP, pleckstrin homology 99.97
3nxb_A116 CAT eye syndrome critical region protein 2; struct 99.97
3iu5_A116 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.97
2grc_A129 Probable global transcription activator SNF2L4; br 99.97
3mb4_A124 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.97
3mqm_A126 Probable histone-lysine N-methyltransferase ASH1L; 99.97
2dat_A123 Possible global transcription activator SNF2L2; br 99.97
3p1f_A119 CREB-binding protein; structural genomics consorti 99.97
2yyn_A135 Transcription intermediary factor 1-alpha; bromo d 99.97
2ouo_A130 HUNK1 protein, bromodomain-containing protein 4; B 99.97
3ljw_A120 Protein polybromo-1; alpha helix, alternative spli 99.97
3hme_A123 Bromodomain-containing protein 9; BRD9, bromodomai 99.97
3fkm_X166 Signaling protein; bromodomain, malaria, structura 99.97
3k2j_A130 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.97
3uv4_A158 Second bromodomain of human transcription initiat 99.97
3dai_A130 ATPase family AAA domain-containing protein 2; anc 99.96
3tlp_A150 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.96
3uv5_A 265 Transcription initiation factor TFIID subunit 1; t 99.95
2dkw_A131 Hypothetical protein KIAA1240; bromodomain-like, f 99.95
3uv5_A265 Transcription initiation factor TFIID subunit 1; t 99.95
3aad_A292 Transcription initiation factor TFIID subunit 1; p 99.94
3aad_A 292 Transcription initiation factor TFIID subunit 1; p 99.93
2r0y_A311 Chromatin structure-remodeling complex protein RSC 99.92
2r10_A361 Chromatin structure-remodeling complex protein RSC 99.92
3iu6_A147 Protein polybromo-1; PB1, polybromo 1 isoform 1, B 99.88
2r0y_A 311 Chromatin structure-remodeling complex protein RSC 99.87
2r10_A 361 Chromatin structure-remodeling complex protein RSC 99.87
1we9_A64 PHD finger family protein; structural genomics, PH 99.53
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 99.53
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 99.47
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 99.47
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 99.46
3o70_A68 PHD finger protein 13; PHF13, structural genomics 99.42
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 99.39
1wee_A72 PHD finger family protein; structural genomics, PH 99.36
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 99.32
1wew_A78 DNA-binding family protein; structural genomics, P 99.3
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 99.27
1wem_A76 Death associated transcription factor 1; structura 99.25
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 99.23
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 99.22
2k16_A75 Transcription initiation factor TFIID subunit 3; p 99.22
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 99.21
1weu_A91 Inhibitor of growth family, member 4; structural g 99.19
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 99.18
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 99.17
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 99.08
3kv5_D 488 JMJC domain-containing histone demethylation prote 99.07
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 99.06
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.05
1x4i_A70 Inhibitor of growth protein 3; structural genomics 99.04
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.04
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.04
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.03
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.02
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 98.99
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.99
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 98.97
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.92
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.92
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 98.92
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 98.9
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.87
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 98.82
2yt5_A66 Metal-response element-binding transcription facto 98.81
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.8
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.8
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.77
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.7
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.69
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.6
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.53
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 98.36
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.3
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 98.26
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.2
3rsn_A177 SET1/ASH2 histone methyltransferase complex subun; 98.17
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 97.94
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 97.87
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.13
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 96.11
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 95.24
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 93.87
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 93.05
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 93.01
2l7p_A100 Histone-lysine N-methyltransferase ASHH2; CW-domai 92.29
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 92.02
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 92.02
1e8j_A52 Rubredoxin; iron-sulfur-protein, zinc-substitution 91.95
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 91.23
2e61_A69 Zinc finger CW-type PWWP domain protein 1; ZF-CW d 90.7
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 90.56
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 90.08
2ecm_A55 Ring finger and CHY zinc finger domain- containing 89.76
1s24_A87 Rubredoxin 2; electron transport; NMR {Pseudomonas 89.36
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 88.03
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 87.78
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 87.03
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 86.73
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 86.52
2ysl_A73 Tripartite motif-containing protein 31; ring-type 84.59
3nw0_A238 Non-structural maintenance of chromosomes element 84.33
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 83.87
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 80.5
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
Probab=100.00  E-value=5.1e-50  Score=289.54  Aligned_cols=162  Identities=57%  Similarity=1.143  Sum_probs=148.3

Q ss_pred             ccccccCCCceeEecCCCCceecccccCccccCcCCCCCCCCCccCCCCcccccccCCChhHHHHHHHHHHHHHhCcCCC
Q psy5115           3 FHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLRKLMKQIQAHKSAW   82 (171)
Q Consensus         3 ~~~~~~~~~~~~i~C~~C~r~~H~~C~~~~~~~~~~~~~~~Cp~C~~~~~~~~~~~~l~~~~~~~~~~~l~~l~~~~~~~   82 (171)
                      .|.+++|++|+||+||.|++|||..|+|++....+..+.|.||.|...........++++.+++.|..+|+.|.+++.++
T Consensus        12 ~C~~~~~~~~~mi~Cd~C~~WfH~~Cv~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~l~~~~~~~l~~il~~l~~~~~~~   91 (174)
T 2ri7_A           12 ICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAW   91 (174)
T ss_dssp             TTTEECCTTSCEEECTTTCCEEEHHHHTCCHHHHTTCSSCCCHHHHHHHHHHTTTSBCCHHHHHHHHHHHHHHHTSGGGT
T ss_pred             eCCCCCCCCCCEeECCCCCchhChhhcCCchhhccCccCeecCCCcchhccccccccCCHHHHHHHHHHHHHHHhhhhhh
Confidence            47888888999999999999999999999876666678999999985433333446799999999999999999999999


Q ss_pred             CCccCCCCCCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCCCCHHHHHHHHHHHHHHHHHHH
Q psy5115          83 PFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKI  162 (171)
Q Consensus        83 ~F~~pv~~~~~p~Y~~~i~~Pmdl~~I~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yn~~~s~~~~~a~~l~~~f~~~~~~  162 (171)
                      +|..||++..+|+|+++|++||||++|++||++|.|.|+++|.+||+|||+||.+||+++|.++++|..|++.|++.+++
T Consensus        92 ~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~s~~~~~A~~L~~~f~~~~~~  171 (174)
T 2ri7_A           92 PFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKG  171 (174)
T ss_dssp             TTSSCCCTTTCHHHHHHCSSCCCHHHHHHHHHTTCCCBHHHHHHHHHHHHHHHHHHSCTTSHHHHHHHHHHHHHHHHTTT
T ss_pred             hhhcCCCcccCCchHHHhCCcCCHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999876


Q ss_pred             HH
Q psy5115         163 LR  164 (171)
Q Consensus       163 ~~  164 (171)
                      ++
T Consensus       172 ~~  173 (174)
T 2ri7_A          172 FK  173 (174)
T ss_dssp             CC
T ss_pred             cc
Confidence            53



>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Back     alignment and structure
>2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Back     alignment and structure
>3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Back     alignment and structure
>2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Back     alignment and structure
>1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Back     alignment and structure
>4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Back     alignment and structure
>2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Back     alignment and structure
>3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Back     alignment and structure
>3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Back     alignment and structure
>3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Back     alignment and structure
>3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 Back     alignment and structure
>3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Back     alignment and structure
>2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Back     alignment and structure
>3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Back     alignment and structure
>3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Back     alignment and structure
>2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Back     alignment and structure
>2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Back     alignment and structure
>2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Back     alignment and structure
>3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Back     alignment and structure
>3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Back     alignment and structure
>3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Back     alignment and structure
>3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Back     alignment and structure
>3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Back     alignment and structure
>3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Back     alignment and structure
>2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Back     alignment and structure
>2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 171
d1eqfa1139 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain 5e-32
d1eqfa2128 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain 3e-30
d1e6ia_111 a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c 7e-30
d3d7ca1102 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T 8e-30
d1wuma1118 a.29.2.1 (A:715-832) P300/CAF histone acetyltransf 6e-29
d3dwya1114 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { 3e-26
d1we9a_64 g.50.1.2 (A:) PHD finger protein At5g26210 {Thale 7e-13
d1wepa_79 g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus 3e-12
d1wema_76 g.50.1.2 (A:) Death associated transcription facto 3e-10
d1weea_72 g.50.1.2 (A:) PHD finger protein At1g33420 {Thale 1e-08
d1wewa_78 g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c 2e-07
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 6e-06
d1f62a_51 g.50.1.2 (A:) Williams-Beuren syndrome transcripti 4e-05
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 4e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 6e-04
d2pnxa151 g.50.1.2 (A:195-245) Inhibitor of growth protein 4 0.001
>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure

class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: TAFII250 double bromodomain module
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  109 bits (274), Expect = 5e-32
 Identities = 25/103 (24%), Positives = 47/103 (45%)

Query: 68  LRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGD 127
           L  ++  ++   + +PF  PV+     DYY ++  PMDL+T+   + ++ Y    EF   
Sbjct: 31  LESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREH 90

Query: 128 MTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVEL 170
           +  I  N   YN  +    + +  +     +K+K   +KL  L
Sbjct: 91  LELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARL 133


>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 Back     information, alignment and structure
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query171
d3d7ca1102 GCN5 {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1eqfa1139 TAFII250 double bromodomain module {Human (Homo sa 99.98
d1e6ia_111 GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.97
d1wuma1118 P300/CAF histone acetyltransferase bromodomain {Hu 99.97
d3dwya1114 CREB-binding protein, CBP {Human (Homo sapiens) [T 99.97
d1eqfa2128 TAFII250 double bromodomain module {Human (Homo sa 99.97
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 99.46
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 99.36
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 99.22
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.22
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.13
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 99.09
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 99.05
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 99.05
d1wema_76 Death associated transcription factor 1, Datf1 (DI 99.03
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 98.94
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.76
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 96.01
d6rxna_45 Rubredoxin {Desulfovibrio desulfuricans, strain 27 95.27
d1iroa_53 Rubredoxin {Clostridium pasteurianum [TaxId: 1501] 94.15
d1brfa_53 Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 93.66
d1dx8a_70 Rubredoxin {Guillardia theta [TaxId: 55529]} 93.53
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 93.31
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 93.2
d1s24a_56 Two-iron rubredoxin {Pseudomonas oleovorans [TaxId 92.36
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 91.17
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 90.43
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 87.99
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 86.62
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 86.26
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 83.81
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 83.64
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 82.27
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 81.64
>d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Bromodomain-like
superfamily: Bromodomain
family: Bromodomain
domain: GCN5
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1e-32  Score=180.58  Aligned_cols=100  Identities=44%  Similarity=0.837  Sum_probs=96.7

Q ss_pred             hHHHHHHHHHHHHHhCcCCCCCccCCCCCCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCCC
Q psy5115          63 RDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRE  142 (171)
Q Consensus        63 ~~~~~~~~~l~~l~~~~~~~~F~~pv~~~~~p~Y~~~i~~Pmdl~~I~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yn~~~  142 (171)
                      +....|..+|..|.+++.+++|..||++..+|+|+++|++||||++|++||++|.|.|+++|.+||++||+||..||+++
T Consensus         2 ~L~~~l~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~   81 (102)
T d3d7ca1           2 QLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPD   81 (102)
T ss_dssp             HHHHHHHHHHHHHHHSGGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTT
T ss_pred             hHHHHHHHHHHHHHhCCCCCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCCCC
Confidence            56788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CHHHHHHHHHHHHHHHHHHH
Q psy5115         143 SPFFKHAHQLEMFFVQKVKI  162 (171)
Q Consensus       143 s~~~~~a~~l~~~f~~~~~~  162 (171)
                      |.++++|..|++.|++.+++
T Consensus        82 s~~~~~A~~l~~~f~~~~ke  101 (102)
T d3d7ca1          82 SEYCRCASALEKFFYFKLKE  101 (102)
T ss_dssp             SHHHHHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999998875



>d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} Back     information, alignment and structure
>d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure