Psyllid ID: psy5115
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| 332027303 | 2702 | Nucleosome-remodeling factor subunit [Ac | 0.947 | 0.059 | 0.785 | 2e-74 | |
| 383857078 | 2734 | PREDICTED: LOW QUALITY PROTEIN: nucleoso | 0.947 | 0.059 | 0.785 | 4e-74 | |
| 322790016 | 2261 | hypothetical protein SINV_12870 [Solenop | 0.947 | 0.071 | 0.779 | 5e-74 | |
| 340712317 | 2081 | PREDICTED: nucleosome-remodeling factor | 0.947 | 0.077 | 0.779 | 8e-74 | |
| 307206270 | 3705 | Nucleosome-remodeling factor subunit NUR | 0.947 | 0.043 | 0.779 | 1e-73 | |
| 307180228 | 3651 | Nucleosome-remodeling factor subunit NUR | 0.935 | 0.043 | 0.782 | 1e-73 | |
| 328788592 | 2735 | PREDICTED: nucleosome-remodeling factor | 0.947 | 0.059 | 0.779 | 1e-73 | |
| 380014032 | 2734 | PREDICTED: LOW QUALITY PROTEIN: nucleoso | 0.947 | 0.059 | 0.779 | 2e-73 | |
| 340712315 | 2733 | PREDICTED: nucleosome-remodeling factor | 0.947 | 0.059 | 0.779 | 2e-73 | |
| 350417610 | 2733 | PREDICTED: nucleosome-remodeling factor | 0.947 | 0.059 | 0.779 | 3e-73 |
| >gi|332027303|gb|EGI67387.1| Nucleosome-remodeling factor subunit [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
Score = 283 bits (723), Expect = 2e-74, Method: Composition-based stats.
Identities = 128/163 (78%), Positives = 140/163 (85%), Gaps = 1/163 (0%)
Query: 10 EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCN-NSSSNLANMKNLTPRDFESL 68
E KFYICCD CQDWFHGRCVGILQSEADNIDEY+CPNC NSS N ANMKNL +D + L
Sbjct: 2540 ETKFYICCDKCQDWFHGRCVGILQSEADNIDEYVCPNCQRNSSVNFANMKNLNAKDLDLL 2599
Query: 69 RKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDM 128
+KL+KQIQAHKSAWPFMEPVDP+EAPDYY V+KEPMDL+TIELRI + YKKLSEFIGDM
Sbjct: 2600 KKLIKQIQAHKSAWPFMEPVDPNEAPDYYKVIKEPMDLQTIELRINDRSYKKLSEFIGDM 2659
Query: 129 TKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVELK 171
TKIFDNCRYYNP+ESPFFK A LE +FV K+K LREK E K
Sbjct: 2660 TKIFDNCRYYNPKESPFFKCAESLETYFVHKIKSLREKFSEGK 2702
|
Source: Acromyrmex echinatior Species: Acromyrmex echinatior Genus: Acromyrmex Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383857078|ref|XP_003704033.1| PREDICTED: LOW QUALITY PROTEIN: nucleosome-remodeling factor subunit NURF301-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322790016|gb|EFZ15092.1| hypothetical protein SINV_12870 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|340712317|ref|XP_003394708.1| PREDICTED: nucleosome-remodeling factor subunit NURF301-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307206270|gb|EFN84335.1| Nucleosome-remodeling factor subunit NURF301 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307180228|gb|EFN68261.1| Nucleosome-remodeling factor subunit NURF301 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|328788592|ref|XP_395718.4| PREDICTED: nucleosome-remodeling factor subunit NURF301-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380014032|ref|XP_003691048.1| PREDICTED: LOW QUALITY PROTEIN: nucleosome-remodeling factor subunit NURF301-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340712315|ref|XP_003394707.1| PREDICTED: nucleosome-remodeling factor subunit NURF301-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350417610|ref|XP_003491506.1| PREDICTED: nucleosome-remodeling factor subunit NURF301-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 171 | ||||||
| FB|FBgn0000541 | 2669 | E(bx) "Enhancer of bithorax" [ | 0.935 | 0.059 | 0.677 | 8.1e-59 | |
| UNIPROTKB|E9PE19 | 650 | BPTF "Nucleosome-remodeling fa | 0.888 | 0.233 | 0.605 | 8.9e-54 | |
| UNIPROTKB|J3QQQ8 | 420 | BPTF "Nucleosome-remodeling fa | 0.888 | 0.361 | 0.605 | 8.9e-54 | |
| UNIPROTKB|E1C5C7 | 2789 | BPTF "Uncharacterized protein" | 0.888 | 0.054 | 0.631 | 1.8e-53 | |
| UNIPROTKB|E1C5C8 | 2802 | BPTF "Uncharacterized protein" | 0.888 | 0.054 | 0.631 | 1.8e-53 | |
| UNIPROTKB|F1LX76 | 2894 | F1LX76 "Uncharacterized protei | 0.888 | 0.052 | 0.625 | 8.1e-53 | |
| UNIPROTKB|F1M1V5 | 2952 | F1M1V5 "Uncharacterized protei | 0.888 | 0.051 | 0.625 | 8.3e-53 | |
| UNIPROTKB|F1M1V4 | 3013 | F1M1V4 "Uncharacterized protei | 0.888 | 0.050 | 0.625 | 8.5e-53 | |
| UNIPROTKB|F1PFZ4 | 2716 | BPTF "Uncharacterized protein" | 0.888 | 0.055 | 0.611 | 2e-52 | |
| UNIPROTKB|E7ETD6 | 2764 | BPTF "Nucleosome-remodeling fa | 0.888 | 0.054 | 0.611 | 2e-52 |
| FB|FBgn0000541 E(bx) "Enhancer of bithorax" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 620 (223.3 bits), Expect = 8.1e-59, P = 8.1e-59
Identities = 109/161 (67%), Positives = 128/161 (79%)
Query: 10 EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSS-SNLANMKNLTPRDFESL 68
E +FYICCD CQDWFHGRCVGILQSEA+ IDEY+CP C + +N ANMK LT D E L
Sbjct: 2506 ESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDANAANMKKLTSNDVEEL 2565
Query: 69 RKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDM 128
+ L+KQ+Q HKSAWPFMEPVDP EAPDYY V+KEPMDLK +E+++ Y KLSEFIGDM
Sbjct: 2566 KNLIKQMQLHKSAWPFMEPVDPKEAPDYYKVIKEPMDLKRMEIKLESNTYTKLSEFIGDM 2625
Query: 129 TKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVE 169
TKIFDNCRYYNP+ES F+K A LE +FVQK+K RE + +
Sbjct: 2626 TKIFDNCRYYNPKESSFYKCAEALESYFVQKIKNFRENVFD 2666
|
|
| UNIPROTKB|E9PE19 BPTF "Nucleosome-remodeling factor subunit BPTF" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QQQ8 BPTF "Nucleosome-remodeling factor subunit BPTF" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C5C7 BPTF "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C5C8 BPTF "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LX76 F1LX76 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M1V5 F1M1V5 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M1V4 F1M1V4 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PFZ4 BPTF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ETD6 BPTF "Nucleosome-remodeling factor subunit BPTF" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| cd05509 | 101 | cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like s | 9e-46 | |
| smart00297 | 107 | smart00297, BROMO, bromo domain | 8e-31 | |
| cd04369 | 99 | cd04369, Bromodomain, Bromodomain | 2e-29 | |
| cd05504 | 115 | cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like o | 2e-25 | |
| cd05503 | 97 | cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BA | 1e-23 | |
| cd05511 | 112 | cd05511, Bromo_TFIID, Bromodomain, TFIID-like subf | 3e-22 | |
| pfam00439 | 84 | pfam00439, Bromodomain, Bromodomain | 3e-22 | |
| cd05506 | 99 | cd05506, Bromo_plant1, Bromodomain, uncharacterize | 1e-21 | |
| cd05498 | 102 | cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_lik | 8e-21 | |
| cd05497 | 107 | cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like | 2e-20 | |
| cd05499 | 102 | cd05499, Bromo_BDF1_2_II, Bromodomain | 6e-20 | |
| cd05500 | 103 | cd05500, Bromo_BDF1_2_I, Bromodomain | 7e-19 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 7e-19 | |
| cd05512 | 98 | cd05512, Bromo_brd1_like, Bromodomain; brd1_like s | 1e-18 | |
| cd05518 | 103 | cd05518, Bromo_polybromo_IV, Bromodomain, polybrom | 2e-18 | |
| cd05510 | 112 | cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like s | 3e-18 | |
| cd05495 | 108 | cd05495, Bromo_cbp_like, Bromodomain, cbp_like sub | 9e-16 | |
| cd05502 | 109 | cd05502, Bromo_tif1_like, Bromodomain; tif1_like s | 2e-15 | |
| cd05505 | 97 | cd05505, Bromo_WSTF_like, Bromodomain; Williams sy | 2e-15 | |
| cd05528 | 112 | cd05528, Bromo_AAA, Bromodomain; sub-family co-occ | 3e-14 | |
| cd05515 | 105 | cd05515, Bromo_polybromo_V, Bromodomain, polybromo | 2e-13 | |
| cd05529 | 128 | cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repe | 3e-11 | |
| cd05496 | 119 | cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat I | 2e-10 | |
| cd05521 | 106 | cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in | 4e-10 | |
| cd05507 | 104 | cd05507, Bromo_brd8_like, Bromodomain, brd8_like s | 6e-10 | |
| cd05522 | 104 | cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II i | 1e-09 | |
| cd05516 | 107 | cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like su | 1e-09 | |
| cd05513 | 98 | cd05513, Bromo_brd7_like, Bromodomain, brd7_like s | 1e-09 | |
| COG5076 | 371 | COG5076, COG5076, Transcription factor involved in | 3e-09 | |
| cd05519 | 103 | cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfam | 6e-09 | |
| cd05520 | 103 | cd05520, Bromo_polybromo_III, Bromodomain, polybro | 2e-08 | |
| cd05517 | 103 | cd05517, Bromo_polybromo_II, Bromodomain, polybrom | 3e-08 | |
| cd05525 | 106 | cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-fa | 8e-08 | |
| smart00249 | 47 | smart00249, PHD, PHD zinc finger | 2e-07 | |
| cd05508 | 99 | cd05508, Bromo_RACK7, Bromodomain, RACK7_like subf | 3e-07 | |
| cd05524 | 113 | cd05524, Bromo_polybromo_I, Bromodomain, polybromo | 3e-07 | |
| cd05494 | 114 | cd05494, Bromodomain_1, Bromodomain; uncharacteriz | 8e-07 | |
| cd05501 | 102 | cd05501, Bromo_SP100C_like, Bromodomain, SP100C_li | 6e-06 | |
| pfam00628 | 51 | pfam00628, PHD, PHD-finger | 9e-06 | |
| cd05526 | 110 | cd05526, Bromo_polybromo_VI, Bromodomain, polybrom | 0.001 |
| >gnl|CDD|99941 cd05509, Bromo_gcn5_like, Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
Score = 145 bits (367), Expect = 9e-46
Identities = 48/98 (48%), Positives = 71/98 (72%)
Query: 64 DFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSE 123
+ L+K++ ++ HKSAWPF+EPVD EAPDYY+V+K+PMDL T+E ++ Y L E
Sbjct: 2 LYTQLKKVLDSLKNHKSAWPFLEPVDKEEAPDYYDVIKKPMDLSTMEEKLENGYYVTLEE 61
Query: 124 FIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVK 161
F+ D+ IFDNCR YN ++ ++K A++LE FF +K+K
Sbjct: 62 FVADLKLIFDNCRLYNGPDTEYYKCANKLEKFFWKKLK 99
|
Gcn5p is a histone acetyltransferase (HAT) which mediates acetylation of histones at lysine residues; such acetylation is generally correlated with the activation of transcription. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. Length = 101 |
| >gnl|CDD|197636 smart00297, BROMO, bromo domain | Back alignment and domain information |
|---|
| >gnl|CDD|99922 cd04369, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99936 cd05504, Bromo_Acf1_like, Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99935 cd05503, Bromo_BAZ2A_B_like, Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99943 cd05511, Bromo_TFIID, Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|215921 pfam00439, Bromodomain, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99938 cd05506, Bromo_plant1, Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >gnl|CDD|99930 cd05498, Bromo_Brdt_II_like, Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99929 cd05497, Bromo_Brdt_I_like, Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99931 cd05499, Bromo_BDF1_2_II, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|99932 cd05500, Bromo_BDF1_2_I, Bromodomain | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99944 cd05512, Bromo_brd1_like, Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99949 cd05518, Bromo_polybromo_IV, Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >gnl|CDD|99942 cd05510, Bromo_SPT7_like, Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99927 cd05495, Bromo_cbp_like, Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99934 cd05502, Bromo_tif1_like, Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99937 cd05505, Bromo_WSTF_like, Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >gnl|CDD|99957 cd05528, Bromo_AAA, Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >gnl|CDD|99946 cd05515, Bromo_polybromo_V, Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >gnl|CDD|99958 cd05529, Bromo_WDR9_I_like, Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99928 cd05496, Bromo_WDR9_II, Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99952 cd05521, Bromo_Rsc1_2_I, Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99939 cd05507, Bromo_brd8_like, Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|99953 cd05522, Bromo_Rsc1_2_II, Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99947 cd05516, Bromo_SNF2L2, Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >gnl|CDD|99945 cd05513, Bromo_brd7_like, Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >gnl|CDD|227408 COG5076, COG5076, Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|99950 cd05519, Bromo_SNF2, Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >gnl|CDD|99951 cd05520, Bromo_polybromo_III, Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >gnl|CDD|99948 cd05517, Bromo_polybromo_II, Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >gnl|CDD|99955 cd05525, Bromo_ASH1, Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >gnl|CDD|214584 smart00249, PHD, PHD zinc finger | Back alignment and domain information |
|---|
| >gnl|CDD|99940 cd05508, Bromo_RACK7, Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99954 cd05524, Bromo_polybromo_I, Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >gnl|CDD|99926 cd05494, Bromodomain_1, Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|99933 cd05501, Bromo_SP100C_like, Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >gnl|CDD|201356 pfam00628, PHD, PHD-finger | Back alignment and domain information |
|---|
| >gnl|CDD|99956 cd05526, Bromo_polybromo_VI, Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| cd05496 | 119 | Bromo_WDR9_II Bromodomain; WDR9 repeat II_like sub | 100.0 | |
| cd05497 | 107 | Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily | 99.98 | |
| cd05505 | 97 | Bromo_WSTF_like Bromodomain; Williams syndrome tra | 99.98 | |
| cd05495 | 108 | Bromo_cbp_like Bromodomain, cbp_like subfamily. Cb | 99.98 | |
| cd05502 | 109 | Bromo_tif1_like Bromodomain; tif1_like subfamily. | 99.97 | |
| cd05504 | 115 | Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_li | 99.97 | |
| cd05503 | 97 | Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like s | 99.97 | |
| cd05508 | 99 | Bromo_RACK7 Bromodomain, RACK7_like subfamily. RAC | 99.97 | |
| cd05511 | 112 | Bromo_TFIID Bromodomain, TFIID-like subfamily. Hum | 99.97 | |
| cd05507 | 104 | Bromo_brd8_like Bromodomain, brd8_like subgroup. I | 99.97 | |
| cd05509 | 101 | Bromo_gcn5_like Bromodomain; Gcn5_like subfamily. | 99.97 | |
| cd05500 | 103 | Bromo_BDF1_2_I Bromodomain. BDF1/BDF2 like subfami | 99.97 | |
| cd05510 | 112 | Bromo_SPT7_like Bromodomain; SPT7_like subfamily. | 99.97 | |
| cd05501 | 102 | Bromo_SP100C_like Bromodomain, SP100C_like subfami | 99.97 | |
| cd05499 | 102 | Bromo_BDF1_2_II Bromodomain. BDF1/BDF2 like subfam | 99.96 | |
| cd05506 | 99 | Bromo_plant1 Bromodomain, uncharacterized subfamil | 99.96 | |
| cd05516 | 107 | Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, s | 99.96 | |
| cd05498 | 102 | Bromo_Brdt_II_like Bromodomain, Brdt_like subfamil | 99.96 | |
| cd05528 | 112 | Bromo_AAA Bromodomain; sub-family co-occurring wit | 99.96 | |
| cd05513 | 98 | Bromo_brd7_like Bromodomain, brd7_like subgroup. T | 99.96 | |
| cd05512 | 98 | Bromo_brd1_like Bromodomain; brd1_like subfamily. | 99.96 | |
| cd05529 | 128 | Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like | 99.96 | |
| cd05524 | 113 | Bromo_polybromo_I Bromodomain, polybromo repeat I. | 99.96 | |
| KOG1474|consensus | 640 | 99.95 | ||
| cd05519 | 103 | Bromo_SNF2 Bromodomain, SNF2-like subfamily, speci | 99.95 | |
| cd05525 | 106 | Bromo_ASH1 Bromodomain; ASH1_like sub-family. ASH1 | 99.95 | |
| cd05515 | 105 | Bromo_polybromo_V Bromodomain, polybromo repeat V. | 99.95 | |
| cd05520 | 103 | Bromo_polybromo_III Bromodomain, polybromo repeat | 99.95 | |
| smart00297 | 107 | BROMO bromo domain. | 99.95 | |
| cd05517 | 103 | Bromo_polybromo_II Bromodomain, polybromo repeat I | 99.95 | |
| cd05518 | 103 | Bromo_polybromo_IV Bromodomain, polybromo repeat I | 99.95 | |
| cd05522 | 104 | Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_l | 99.94 | |
| PF00439 | 84 | Bromodomain: Bromodomain; InterPro: IPR001487 Brom | 99.93 | |
| cd05521 | 106 | Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_lik | 99.93 | |
| cd05492 | 109 | Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | 99.93 | |
| cd04369 | 99 | Bromodomain Bromodomain. Bromodomains are found in | 99.92 | |
| KOG1245|consensus | 1404 | 99.91 | ||
| cd05526 | 110 | Bromo_polybromo_VI Bromodomain, polybromo repeat V | 99.88 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 99.82 | |
| KOG1472|consensus | 720 | 99.66 | ||
| cd05494 | 114 | Bromodomain_1 Bromodomain; uncharacterized subfami | 99.45 | |
| KOG0955|consensus | 1051 | 99.44 | ||
| cd05491 | 119 | Bromo_TBP7_like Bromodomain; TBP7_like subfamily, | 99.41 | |
| KOG0008|consensus | 1563 | 99.33 | ||
| KOG1827|consensus | 629 | 99.3 | ||
| KOG0008|consensus | 1563 | 99.17 | ||
| KOG0386|consensus | 1157 | 99.13 | ||
| PF00628 | 51 | PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( | 99.05 | |
| smart00249 | 47 | PHD PHD zinc finger. The plant homeodomain (PHD) f | 98.98 | |
| KOG1472|consensus | 720 | 98.96 | ||
| KOG1828|consensus | 418 | 98.66 | ||
| KOG1828|consensus | 418 | 98.65 | ||
| KOG1474|consensus | 640 | 98.52 | ||
| cd05493 | 131 | Bromo_ALL-1 Bromodomain, ALL-1 like proteins. ALL- | 98.21 | |
| KOG4299|consensus | 613 | 97.94 | ||
| KOG1632|consensus | 345 | 97.82 | ||
| KOG4323|consensus | 464 | 97.7 | ||
| KOG3612|consensus | 588 | 97.64 | ||
| PF13831 | 36 | PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. | 97.46 | |
| COG5076 | 371 | Transcription factor involved in chromatin remodel | 97.44 | |
| KOG0383|consensus | 696 | 97.36 | ||
| KOG1512|consensus | 381 | 97.19 | ||
| KOG0644|consensus | 1113 | 97.09 | ||
| KOG0825|consensus | 1134 | 96.84 | ||
| KOG1844|consensus | 508 | 96.53 | ||
| KOG0954|consensus | 893 | 96.37 | ||
| KOG2752|consensus | 345 | 96.24 | ||
| cd04718 | 148 | BAH_plant_2 BAH, or Bromo Adjacent Homology domain | 95.84 | |
| KOG0955|consensus | 1051 | 95.69 | ||
| KOG0957|consensus | 707 | 95.35 | ||
| KOG1473|consensus | 1414 | 95.27 | ||
| PF07496 | 50 | zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zi | 94.3 | |
| KOG1632|consensus | 345 | 93.7 | ||
| PF13639 | 44 | zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C | 93.42 | |
| KOG0732|consensus | 1080 | 92.83 | ||
| PF15446 | 175 | zf-PHD-like: PHD/FYVE-zinc-finger like domain | 92.75 | |
| PF00301 | 47 | Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred | 92.23 | |
| PF13832 | 110 | zf-HC5HC2H_2: PHD-zinc-finger like domain | 92.07 | |
| PF07227 | 446 | DUF1423: Protein of unknown function (DUF1423); In | 91.97 | |
| COG5141 | 669 | PHD zinc finger-containing protein [General functi | 91.72 | |
| cd00730 | 50 | rubredoxin Rubredoxin; nonheme iron binding domain | 91.2 | |
| KOG0956|consensus | 900 | 90.89 | ||
| COG1773 | 55 | Rubredoxin [Energy production and conversion] | 89.36 | |
| KOG0957|consensus | 707 | 89.34 | ||
| PF07649 | 30 | C1_3: C1-like domain; InterPro: IPR011424 This sho | 89.2 | |
| TIGR02606 | 69 | antidote_CC2985 putative addiction module antidote | 88.74 | |
| cd00350 | 33 | rubredoxin_like Rubredoxin_like; nonheme iron bind | 88.1 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 87.46 | |
| KOG0644|consensus | 1113 | 87.42 | ||
| PF10497 | 105 | zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida | 86.47 | |
| PF12861 | 85 | zf-Apc11: Anaphase-promoting complex subunit 11 RI | 85.38 | |
| KOG1512|consensus | 381 | 85.01 | ||
| PF13771 | 90 | zf-HC5HC2H: PHD-like zinc-binding domain | 85.0 | |
| KOG1827|consensus | 629 | 84.86 | ||
| PF03693 | 80 | RHH_2: Uncharacterised protein family (UPF0156); I | 84.13 | |
| PF14372 | 101 | DUF4413: Domain of unknown function (DUF4413) | 82.8 | |
| KOG4443|consensus | 694 | 82.22 | ||
| PF13913 | 25 | zf-C2HC_2: zinc-finger of a C2HC-type | 81.4 |
| >cd05496 Bromo_WDR9_II Bromodomain; WDR9 repeat II_like subfamily | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-32 Score=183.66 Aligned_cols=107 Identities=25% Similarity=0.450 Sum_probs=102.5
Q ss_pred hhHHHHHHHHHHHHHhCcCCCCCccCCCCCCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCC
Q psy5115 62 PRDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPR 141 (171)
Q Consensus 62 ~~~~~~~~~~l~~l~~~~~~~~F~~pv~~~~~p~Y~~~i~~Pmdl~~I~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yn~~ 141 (171)
+++.+.|..+++.|++++.+++|..||++..+|+|+++|++||||+||++||++|.|.++.+|.+||+|||.||..||++
T Consensus 4 ~~w~~~c~~il~~l~~~~~s~~F~~PVd~~~~pdY~~iIk~PmDL~tIk~kL~~~~Y~~~~ef~~D~~lif~Na~~yN~~ 83 (119)
T cd05496 4 SDWKKQCKELVNLMWDCEDSEPFRQPVDLLKYPDYRDIIDTPMDLGTVKETLFGGNYDDPMEFAKDVRLIFSNSKSYTPN 83 (119)
T ss_pred HHHHHHHHHHHHHHHhCCccccccCCCChhhcCcHHHHhCCcccHHHHHHHHhCCCCCCHHHHHHHHHHHHHHHHHHCCC
Confidence 46788999999999999999999999999999999999999999999999999999999999999999999999999985
Q ss_pred -CCHHHHHHHHHHHHHHHHHHHHHHHhh
Q psy5115 142 -ESPFFKHAHQLEMFFVQKVKILREKLV 168 (171)
Q Consensus 142 -~s~~~~~a~~l~~~f~~~~~~~~~~~~ 168 (171)
+|.++.+|..|++.|++.++++.+.+.
T Consensus 84 ~~s~i~~~a~~L~~~F~~~~~~l~~~~~ 111 (119)
T cd05496 84 KRSRIYSMTLRLSALFEEHIKKIISDWK 111 (119)
T ss_pred CCCHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 899999999999999999999988774
|
WDR9 is a human gene located in the Down Syndrome critical region-2 of chromosome 21. It encodes for a nuclear protein containing WD40 repeats and two bromodomains, which may function as a transcriptional regulator involved in chromatin remodeling and play a role in embryonic development. Bromodomains are 110 amino acid long domains, that are found in many chromatin associated proteins. Bromodomains can interact specifically with acetylated lysine. |
| >cd05497 Bromo_Brdt_I_like Bromodomain, Brdt_like subfamily, repeat I | Back alignment and domain information |
|---|
| >cd05505 Bromo_WSTF_like Bromodomain; Williams syndrome transcription factor-like subfamily (WSTF-like) | Back alignment and domain information |
|---|
| >cd05495 Bromo_cbp_like Bromodomain, cbp_like subfamily | Back alignment and domain information |
|---|
| >cd05502 Bromo_tif1_like Bromodomain; tif1_like subfamily | Back alignment and domain information |
|---|
| >cd05504 Bromo_Acf1_like Bromodomain; Acf1_like or BAZ1A_like subfamily | Back alignment and domain information |
|---|
| >cd05503 Bromo_BAZ2A_B_like Bromodomain, BAZ2A/BAZ2B_like subfamily | Back alignment and domain information |
|---|
| >cd05508 Bromo_RACK7 Bromodomain, RACK7_like subfamily | Back alignment and domain information |
|---|
| >cd05511 Bromo_TFIID Bromodomain, TFIID-like subfamily | Back alignment and domain information |
|---|
| >cd05507 Bromo_brd8_like Bromodomain, brd8_like subgroup | Back alignment and domain information |
|---|
| >cd05509 Bromo_gcn5_like Bromodomain; Gcn5_like subfamily | Back alignment and domain information |
|---|
| >cd05500 Bromo_BDF1_2_I Bromodomain | Back alignment and domain information |
|---|
| >cd05510 Bromo_SPT7_like Bromodomain; SPT7_like subfamily | Back alignment and domain information |
|---|
| >cd05501 Bromo_SP100C_like Bromodomain, SP100C_like subfamily | Back alignment and domain information |
|---|
| >cd05499 Bromo_BDF1_2_II Bromodomain | Back alignment and domain information |
|---|
| >cd05506 Bromo_plant1 Bromodomain, uncharacterized subfamily specific to plants | Back alignment and domain information |
|---|
| >cd05516 Bromo_SNF2L2 Bromodomain, SNF2L2-like subfamily, specific to animals | Back alignment and domain information |
|---|
| >cd05498 Bromo_Brdt_II_like Bromodomain, Brdt_like subfamily, repeat II | Back alignment and domain information |
|---|
| >cd05528 Bromo_AAA Bromodomain; sub-family co-occurring with AAA domains | Back alignment and domain information |
|---|
| >cd05513 Bromo_brd7_like Bromodomain, brd7_like subgroup | Back alignment and domain information |
|---|
| >cd05512 Bromo_brd1_like Bromodomain; brd1_like subfamily | Back alignment and domain information |
|---|
| >cd05529 Bromo_WDR9_I_like Bromodomain; WDR9 repeat I_like subfamily | Back alignment and domain information |
|---|
| >cd05524 Bromo_polybromo_I Bromodomain, polybromo repeat I | Back alignment and domain information |
|---|
| >KOG1474|consensus | Back alignment and domain information |
|---|
| >cd05519 Bromo_SNF2 Bromodomain, SNF2-like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05525 Bromo_ASH1 Bromodomain; ASH1_like sub-family | Back alignment and domain information |
|---|
| >cd05515 Bromo_polybromo_V Bromodomain, polybromo repeat V | Back alignment and domain information |
|---|
| >cd05520 Bromo_polybromo_III Bromodomain, polybromo repeat III | Back alignment and domain information |
|---|
| >smart00297 BROMO bromo domain | Back alignment and domain information |
|---|
| >cd05517 Bromo_polybromo_II Bromodomain, polybromo repeat II | Back alignment and domain information |
|---|
| >cd05518 Bromo_polybromo_IV Bromodomain, polybromo repeat IV | Back alignment and domain information |
|---|
| >cd05522 Bromo_Rsc1_2_II Bromodomain, repeat II in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >PF00439 Bromodomain: Bromodomain; InterPro: IPR001487 Bromodomains are found in a variety of mammalian, invertebrate and yeast DNA-binding proteins [] | Back alignment and domain information |
|---|
| >cd05521 Bromo_Rsc1_2_I Bromodomain, repeat I in Rsc1/2_like subfamily, specific to fungi | Back alignment and domain information |
|---|
| >cd05492 Bromo_ZMYND11 Bromodomain; ZMYND11_like sub-family | Back alignment and domain information |
|---|
| >cd04369 Bromodomain Bromodomain | Back alignment and domain information |
|---|
| >KOG1245|consensus | Back alignment and domain information |
|---|
| >cd05526 Bromo_polybromo_VI Bromodomain, polybromo repeat VI | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG1472|consensus | Back alignment and domain information |
|---|
| >cd05494 Bromodomain_1 Bromodomain; uncharacterized subfamily | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >cd05491 Bromo_TBP7_like Bromodomain; TBP7_like subfamily, limited to fungi | Back alignment and domain information |
|---|
| >KOG0008|consensus | Back alignment and domain information |
|---|
| >KOG1827|consensus | Back alignment and domain information |
|---|
| >KOG0008|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >smart00249 PHD PHD zinc finger | Back alignment and domain information |
|---|
| >KOG1472|consensus | Back alignment and domain information |
|---|
| >KOG1828|consensus | Back alignment and domain information |
|---|
| >KOG1828|consensus | Back alignment and domain information |
|---|
| >KOG1474|consensus | Back alignment and domain information |
|---|
| >cd05493 Bromo_ALL-1 Bromodomain, ALL-1 like proteins | Back alignment and domain information |
|---|
| >KOG4299|consensus | Back alignment and domain information |
|---|
| >KOG1632|consensus | Back alignment and domain information |
|---|
| >KOG4323|consensus | Back alignment and domain information |
|---|
| >KOG3612|consensus | Back alignment and domain information |
|---|
| >PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A | Back alignment and domain information |
|---|
| >COG5076 Transcription factor involved in chromatin remodeling, contains bromodomain [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >KOG0383|consensus | Back alignment and domain information |
|---|
| >KOG1512|consensus | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >KOG0825|consensus | Back alignment and domain information |
|---|
| >KOG1844|consensus | Back alignment and domain information |
|---|
| >KOG0954|consensus | Back alignment and domain information |
|---|
| >KOG2752|consensus | Back alignment and domain information |
|---|
| >cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function | Back alignment and domain information |
|---|
| >KOG0955|consensus | Back alignment and domain information |
|---|
| >KOG0957|consensus | Back alignment and domain information |
|---|
| >KOG1473|consensus | Back alignment and domain information |
|---|
| >PF07496 zf-CW: CW-type Zinc Finger; InterPro: IPR011124 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1632|consensus | Back alignment and domain information |
|---|
| >PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A | Back alignment and domain information |
|---|
| >KOG0732|consensus | Back alignment and domain information |
|---|
| >PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] | Back alignment and domain information |
|---|
| >PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain | Back alignment and domain information |
|---|
| >PF07227 DUF1423: Protein of unknown function (DUF1423); InterPro: IPR004082 A total of 715 potential protein-coding genes have been identified in the nucleotide sequence of Arabidopsis thaliana chromosome 5, with an average gene density of 1 gene per 4001 bp [] | Back alignment and domain information |
|---|
| >COG5141 PHD zinc finger-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >KOG0956|consensus | Back alignment and domain information |
|---|
| >COG1773 Rubredoxin [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG0957|consensus | Back alignment and domain information |
|---|
| >PF07649 C1_3: C1-like domain; InterPro: IPR011424 This short domain is rich in cysteines and histidines | Back alignment and domain information |
|---|
| >TIGR02606 antidote_CC2985 putative addiction module antidote protein, CC2985 family | Back alignment and domain information |
|---|
| >cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG0644|consensus | Back alignment and domain information |
|---|
| >PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression | Back alignment and domain information |
|---|
| >PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger | Back alignment and domain information |
|---|
| >KOG1512|consensus | Back alignment and domain information |
|---|
| >PF13771 zf-HC5HC2H: PHD-like zinc-binding domain | Back alignment and domain information |
|---|
| >KOG1827|consensus | Back alignment and domain information |
|---|
| >PF03693 RHH_2: Uncharacterised protein family (UPF0156); InterPro: IPR022789 This family of proteins are about 80 amino acids in length and their function is unknown | Back alignment and domain information |
|---|
| >PF14372 DUF4413: Domain of unknown function (DUF4413) | Back alignment and domain information |
|---|
| >KOG4443|consensus | Back alignment and domain information |
|---|
| >PF13913 zf-C2HC_2: zinc-finger of a C2HC-type | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 171 | ||||
| 3qzv_A | 174 | Crystal Structure Of Bptf Phd-Linker-Bromo In Compl | 7e-58 | ||
| 2ri7_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 7e-58 | ||
| 2f6j_A | 174 | Crystal Structure Of Phd Finger-Linker-Bromodomain | 7e-56 | ||
| 3uv2_A | 126 | Crystal Structure Of The Bromodomain Of Human Nucle | 2e-38 | ||
| 3qzt_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 4e-37 | ||
| 3qzs_A | 115 | Crystal Structure Of Bptf Bromo In Complex With His | 1e-36 | ||
| 1e6i_A | 121 | Bromodomain From Gcn5 Complexed With Acetylated H4 | 4e-24 | ||
| 3gg3_A | 119 | Crystal Structure Of The Bromodomain Of Human Pcaf | 3e-23 | ||
| 1n72_A | 118 | Structure And Ligand Of A Histone Acetyltransferase | 9e-23 | ||
| 1f68_A | 103 | Nmr Solution Structure Of The Bromodomain From Huma | 9e-21 | ||
| 3d7c_A | 112 | Crystal Structure Of The Bromodomain Of Human Gcn5, | 9e-21 | ||
| 3nxb_A | 116 | Crystal Structure Of The Bromodomain Of Human Cecr2 | 5e-18 | ||
| 2wp2_A | 120 | Structure Of Brdt Bromodomain Bd1 Bound To A Diacet | 1e-14 | ||
| 2rfj_A | 119 | Crystal Structure Of The Bromo Domain 1 In Human Br | 7e-14 | ||
| 4don_A | 145 | Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihy | 2e-13 | ||
| 3jvj_A | 131 | Crystal Structure Of The Bromodomain 1 In Mouse Brd | 2e-13 | ||
| 4hbw_A | 127 | Crystal Structure Of The First Bromodomain Of Human | 3e-13 | ||
| 3g0l_A | 117 | Crystal Structure Of Human Bromodomain Adjacent To | 3e-13 | ||
| 2oss_A | 127 | Crystal Structure Of The Bromo Domain 1 In Human Br | 3e-13 | ||
| 2e7o_A | 112 | Solution Structure Of The Bromodomain From Human Br | 3e-13 | ||
| 2l5e_A | 128 | Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Lengt | 4e-13 | ||
| 2ydw_A | 153 | Crystal Structure Of The First Bromodomain Of Human | 5e-13 | ||
| 4a9e_A | 154 | N-Terminal Bromodomain Of Human Brd2 With 3-Methyl- | 5e-13 | ||
| 2fui_A | 62 | Nmr Solution Structure Of Phd Finger Fragment Of Hu | 5e-13 | ||
| 2yw5_A | 138 | Solution Structure Of The Bromodomain From Human Br | 6e-13 | ||
| 3o33_A | 184 | Crystal Structure Of Trim24 Phd-Bromo In The Free S | 9e-13 | ||
| 3rcw_A | 135 | Crystal Structure Of The Bromodomain Of Human Brd1 | 1e-12 | ||
| 2nxb_A | 123 | Crystal Structure Of Human Bromodomain Containing P | 5e-12 | ||
| 3uv4_A | 158 | Crystal Structure Of The Second Bromodomain Of Huma | 5e-11 | ||
| 3u5m_A | 207 | Crystal Structure Of Trim33 Phd-Bromo In The Free S | 9e-11 | ||
| 1eqf_A | 280 | Crystal Structure Of The Double Bromodomain Module | 1e-10 | ||
| 3aqa_A | 128 | Crystal Structure Of The Human Brd2 Bd1 Bromodomain | 1e-10 | ||
| 3uv5_A | 265 | Crystal Structure Of The Tandem Bromodomains Of Hum | 1e-10 | ||
| 2yyn_A | 135 | Crystal Sturcture Of Human Bromodomain Protein Leng | 1e-10 | ||
| 1x0j_A | 122 | Crystal Structure Analysis Of The N-Terminal Bromod | 1e-10 | ||
| 3aad_A | 292 | Structure Of The Histone Chaperone Cia/asf1-double | 1e-10 | ||
| 3hmh_A | 155 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-10 | ||
| 2wp1_A | 126 | Structure Of Brdt Bromodomain 2 Bound To An Acetyla | 3e-10 | ||
| 3i3j_A | 124 | Crystal Structure Of The Bromodomain Of Human Ep300 | 5e-10 | ||
| 3oni_A | 114 | Crystal Structure Of The Second Bromodomain Of Huma | 6e-10 | ||
| 2dvv_A | 112 | Crystal Structure Of The Second Bromodomain Of The | 6e-10 | ||
| 2g4a_A | 116 | Solution Structure Of A Bromodomain From Ring3 Prot | 7e-10 | ||
| 3kv5_D | 488 | Structure Of Kiaa1718, Human Jumonji Demethylase, I | 7e-10 | ||
| 2d9e_A | 121 | Solution Structure Of The Bromodomain Of Peregrin L | 9e-10 | ||
| 3dwy_A | 119 | Crystal Structure Of The Bromodomain Of Human Crebb | 2e-09 | ||
| 2oo1_A | 113 | Crystal Structure Of The Bromo Domain 2 Of Human Br | 2e-09 | ||
| 1jsp_B | 121 | Nmr Structure Of Cbp Bromodomain In Complex With P5 | 2e-09 | ||
| 2e7n_A | 117 | Solution Structure Of The Second Bromodomain From H | 2e-09 | ||
| 3tlp_A | 150 | Crystal Structure Of The Fourth Bromodomain Of Huma | 2e-09 | ||
| 3jvl_A | 120 | Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Le | 4e-09 | ||
| 2i8n_A | 114 | Solution Structure Of The Second Bromodomain Of Brd | 4e-09 | ||
| 3kv4_A | 447 | Structure Of Phf8 In Complex With Histone H3 Length | 4e-09 | ||
| 3dai_A | 130 | Crystal Structure Of The Bromodomain Of The Human A | 4e-09 | ||
| 3lxj_A | 136 | Crystal Structure Of The Bromodomain Of Human Aaa D | 5e-09 | ||
| 2ouo_A | 130 | Crystal Structure Of The Bromo Domain 2 In Human Br | 5e-09 | ||
| 2lsp_B | 128 | Solution Structures Of Brd4 Second Bromodomain With | 6e-09 | ||
| 3kqi_A | 75 | Crystal Structure Of Phf2 Phd Domain Complexed With | 2e-08 | ||
| 2r0v_A | 346 | Structure Of The Rsc4 Tandem Bromodomain Acetylated | 2e-08 | ||
| 2r10_A | 361 | Structure Of An Acetylated Rsc4 Tandem Bromodomain | 2e-08 | ||
| 2ktb_B | 121 | Solution Structure Of The Second Bromodomain Of Hum | 2e-08 | ||
| 3ljw_A | 120 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-08 | ||
| 3hmf_A | 116 | Crystal Structure Of The Second Bromodomain Of Huma | 3e-08 | ||
| 1we9_A | 64 | Solution Structure Of Phd Domain In Nucleic Acid Bi | 4e-08 | ||
| 2dww_A | 114 | Crystal Structure Of Bromodomain-Containing Protein | 6e-08 | ||
| 3fkm_X | 166 | Plasmodium Falciparum Bromodomain-Containing Protei | 9e-08 | ||
| 3q2e_A | 123 | Crystal Structure Of The Second Bromodomain Of Huma | 2e-07 | ||
| 1wem_A | 76 | Solution Structure Of Phd Domain In Death Inducer- | 4e-07 | ||
| 3mb3_A | 135 | Crystal Structure Of The Second Bromodomain Of Plec | 1e-06 | ||
| 3hme_A | 123 | Crystal Structure Of Human Bromodomain Containing 9 | 2e-06 | ||
| 2i7k_A | 117 | Solution Structure Of The Bromodomain Of Human Brd7 | 2e-06 | ||
| 2dkw_A | 131 | Solution Structure Of The Bromodomain Of Human Prot | 2e-06 | ||
| 2r0y_A | 311 | Structure Of The Rsc4 Tandem Bromodomain In Complex | 2e-06 | ||
| 2r0s_A | 285 | Crystal Structure Of The Rsc4 Tandem Bromodomain Le | 3e-06 | ||
| 1wep_A | 79 | Solution Structure Of Phd Domain In Phf8 Length = 7 | 3e-06 | ||
| 3mqm_A | 126 | Crystal Structure Of The Bromodomain Of Human Ash1l | 6e-06 | ||
| 3k2j_A | 130 | Crystal Structure Of The 3rd Bromodomain Of Human P | 2e-05 | ||
| 3g0j_A | 124 | Crystal Structure Of The Fifth Bromodomain Of Human | 5e-05 | ||
| 2yqd_A | 120 | Solution Structure Of The Fifth Bromodomain From Mo | 5e-05 | ||
| 3iu5_A | 116 | Crystal Structure Of The First Bromodomain Of Human | 7e-05 | ||
| 3n9l_A | 528 | Cekdm7a From C.Elegans, Complex With H3k4me3 Peptid | 6e-04 |
| >pdb|3QZV|A Chain A, Crystal Structure Of Bptf Phd-Linker-Bromo In Complex With Histone H4k12ac Peptide Length = 174 | Back alignment and structure |
|
| >pdb|2RI7|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Y17e Mutant From Human Bptf In The H3(1-9)k4me2 Bound State Length = 174 | Back alignment and structure |
| >pdb|2F6J|A Chain A, Crystal Structure Of Phd Finger-Linker-Bromodomain Fragment Of Human Bptf In The H3(1-15)k4me3 Bound State Length = 174 | Back alignment and structure |
| >pdb|3UV2|A Chain A, Crystal Structure Of The Bromodomain Of Human Nucleosome-Remodeling Factor Subunit Bptf Length = 126 | Back alignment and structure |
| >pdb|3QZT|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form Ii Length = 115 | Back alignment and structure |
| >pdb|3QZS|A Chain A, Crystal Structure Of Bptf Bromo In Complex With Histone H4k16ac - Form I Length = 115 | Back alignment and structure |
| >pdb|1E6I|A Chain A, Bromodomain From Gcn5 Complexed With Acetylated H4 Peptide Length = 121 | Back alignment and structure |
| >pdb|3GG3|A Chain A, Crystal Structure Of The Bromodomain Of Human Pcaf Length = 119 | Back alignment and structure |
| >pdb|1N72|A Chain A, Structure And Ligand Of A Histone Acetyltransferase Bromodomain Length = 118 | Back alignment and structure |
| >pdb|1F68|A Chain A, Nmr Solution Structure Of The Bromodomain From Human Gcn5 Length = 103 | Back alignment and structure |
| >pdb|3D7C|A Chain A, Crystal Structure Of The Bromodomain Of Human Gcn5, The General Control Of Amino-Acid Synthesis Protein 5-Like 2 Length = 112 | Back alignment and structure |
| >pdb|3NXB|A Chain A, Crystal Structure Of The Bromodomain Of Human Cecr2 Length = 116 | Back alignment and structure |
| >pdb|2WP2|A Chain A, Structure Of Brdt Bromodomain Bd1 Bound To A Diacetylated Histone H4 Peptide. Length = 120 | Back alignment and structure |
| >pdb|2RFJ|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein, Testis Specific (Brdt) Length = 119 | Back alignment and structure |
| >pdb|4DON|A Chain A, Brd4 Bromodomain 1 Complex With A Fragment 3,4-dihydro-3-methyl-2(1h)- Quinazolinon Length = 145 | Back alignment and structure |
| >pdb|3JVJ|A Chain A, Crystal Structure Of The Bromodomain 1 In Mouse Brd4 Length = 131 | Back alignment and structure |
| >pdb|4HBW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd4 In Complex With A Quinazoline Ligand Length = 127 | Back alignment and structure |
| >pdb|3G0L|A Chain A, Crystal Structure Of Human Bromodomain Adjacent To Zinc Finger Domain 2b (Baz2b) Length = 117 | Back alignment and structure |
| >pdb|2OSS|A Chain A, Crystal Structure Of The Bromo Domain 1 In Human Bromodomain Containing Protein 4 (Brd4) Length = 127 | Back alignment and structure |
| >pdb|2E7O|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Adjacent To Zinc Finger Domain 2b Length = 112 | Back alignment and structure |
| >pdb|2L5E|A Chain A, Complex Between Bd1 Of Brd3 And Gata-1 C-Tail Length = 128 | Back alignment and structure |
| >pdb|2YDW|A Chain A, Crystal Structure Of The First Bromodomain Of Human Brd2 With The Inhibitor Gw841819x Length = 153 | Back alignment and structure |
| >pdb|4A9E|A Chain A, N-Terminal Bromodomain Of Human Brd2 With 3-Methyl-1,2,3,4- Tetrahydroquinazolin-2-One Length = 154 | Back alignment and structure |
| >pdb|2FUI|A Chain A, Nmr Solution Structure Of Phd Finger Fragment Of Human Bptf In Free State Length = 62 | Back alignment and structure |
| >pdb|2YW5|A Chain A, Solution Structure Of The Bromodomain From Human Bromodomain Containing Protein 3 Length = 138 | Back alignment and structure |
| >pdb|3O33|A Chain A, Crystal Structure Of Trim24 Phd-Bromo In The Free State Length = 184 | Back alignment and structure |
| >pdb|3RCW|A Chain A, Crystal Structure Of The Bromodomain Of Human Brd1 Length = 135 | Back alignment and structure |
| >pdb|2NXB|A Chain A, Crystal Structure Of Human Bromodomain Containing Protein 3 (Brd3) Length = 123 | Back alignment and structure |
| >pdb|3UV4|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 158 | Back alignment and structure |
| >pdb|3U5M|A Chain A, Crystal Structure Of Trim33 Phd-Bromo In The Free State Length = 207 | Back alignment and structure |
| >pdb|1EQF|A Chain A, Crystal Structure Of The Double Bromodomain Module From Human Tafii250 Length = 280 | Back alignment and structure |
| >pdb|3AQA|A Chain A, Crystal Structure Of The Human Brd2 Bd1 Bromodomain In Complex With A Brd2-Interactive Compound, Bic1 Length = 128 | Back alignment and structure |
| >pdb|3UV5|A Chain A, Crystal Structure Of The Tandem Bromodomains Of Human Transcription Initiation Factor Tfiid Subunit 1 (Taf1) Length = 265 | Back alignment and structure |
| >pdb|2YYN|A Chain A, Crystal Sturcture Of Human Bromodomain Protein Length = 135 | Back alignment and structure |
| >pdb|1X0J|A Chain A, Crystal Structure Analysis Of The N-Terminal Bromodomain Of Human Brd2 Length = 122 | Back alignment and structure |
| >pdb|3AAD|A Chain A, Structure Of The Histone Chaperone Cia/asf1-double Bromodomain Complex Linking Histone Modifications And Site-specific Histone Eviction Length = 292 | Back alignment and structure |
| >pdb|3HMH|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Tbp-Associated Factor Rna Polymerase 1-Like (Taf1l) Length = 155 | Back alignment and structure |
| >pdb|2WP1|A Chain A, Structure Of Brdt Bromodomain 2 Bound To An Acetylated Histone H3 Peptide Length = 126 | Back alignment and structure |
| >pdb|3I3J|A Chain A, Crystal Structure Of The Bromodomain Of Human Ep300 Length = 124 | Back alignment and structure |
| >pdb|3ONI|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Brd2 In Complex With The Inhibitor Jq1 Length = 114 | Back alignment and structure |
| >pdb|2DVV|A Chain A, Crystal Structure Of The Second Bromodomain Of The Human Brd2 Protein Length = 112 | Back alignment and structure |
| >pdb|2G4A|A Chain A, Solution Structure Of A Bromodomain From Ring3 Protein Length = 116 | Back alignment and structure |
| >pdb|3KV5|D Chain D, Structure Of Kiaa1718, Human Jumonji Demethylase, In Complex With N-Oxalylglycine Length = 488 | Back alignment and structure |
| >pdb|2D9E|A Chain A, Solution Structure Of The Bromodomain Of Peregrin Length = 121 | Back alignment and structure |
| >pdb|3DWY|A Chain A, Crystal Structure Of The Bromodomain Of Human Crebbp Length = 119 | Back alignment and structure |
| >pdb|2OO1|A Chain A, Crystal Structure Of The Bromo Domain 2 Of Human Bromodomain Containing Protein 3 (Brd3) Length = 113 | Back alignment and structure |
| >pdb|1JSP|B Chain B, Nmr Structure Of Cbp Bromodomain In Complex With P53 Peptide Length = 121 | Back alignment and structure |
| >pdb|2E7N|A Chain A, Solution Structure Of The Second Bromodomain From Human Bromodomain-Containing Protein 3 Length = 117 | Back alignment and structure |
| >pdb|3TLP|A Chain A, Crystal Structure Of The Fourth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 150 | Back alignment and structure |
| >pdb|3JVL|A Chain A, Crystal Structure Of Bromodomain 2 Of Mouse Brd4 Length = 120 | Back alignment and structure |
| >pdb|2I8N|A Chain A, Solution Structure Of The Second Bromodomain Of Brd4 Length = 114 | Back alignment and structure |
| >pdb|3KV4|A Chain A, Structure Of Phf8 In Complex With Histone H3 Length = 447 | Back alignment and structure |
| >pdb|3DAI|A Chain A, Crystal Structure Of The Bromodomain Of The Human Atad2 Length = 130 | Back alignment and structure |
| >pdb|3LXJ|A Chain A, Crystal Structure Of The Bromodomain Of Human Aaa Domain Containing 2b (Atad2b) Length = 136 | Back alignment and structure |
| >pdb|2OUO|A Chain A, Crystal Structure Of The Bromo Domain 2 In Human Bromodomain Containing Protein 4 (Brd4) Length = 130 | Back alignment and structure |
| >pdb|2LSP|B Chain B, Solution Structures Of Brd4 Second Bromodomain With Nf-Kb-K310ac Peptide Length = 128 | Back alignment and structure |
| >pdb|3KQI|A Chain A, Crystal Structure Of Phf2 Phd Domain Complexed With H3k4me3 Peptide Length = 75 | Back alignment and structure |
| >pdb|2R0V|A Chain A, Structure Of The Rsc4 Tandem Bromodomain Acetylated At K25 Length = 346 | Back alignment and structure |
| >pdb|2R10|A Chain A, Structure Of An Acetylated Rsc4 Tandem Bromodomain Histone Chimera Length = 361 | Back alignment and structure |
| >pdb|2KTB|B Chain B, Solution Structure Of The Second Bromodomain Of Human Polybr Complex With An Acetylated Peptide From Histone 3 Length = 121 | Back alignment and structure |
| >pdb|3LJW|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Polybromo Length = 120 | Back alignment and structure |
| >pdb|3HMF|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|1WE9|A Chain A, Solution Structure Of Phd Domain In Nucleic Acid Binding Protein-like Np_197993 Length = 64 | Back alignment and structure |
| >pdb|2DWW|A Chain A, Crystal Structure Of Bromodomain-Containing Protein 4 Length = 114 | Back alignment and structure |
| >pdb|3FKM|X Chain X, Plasmodium Falciparum Bromodomain-Containing Protein Pf10_0328 Length = 166 | Back alignment and structure |
| >pdb|3Q2E|A Chain A, Crystal Structure Of The Second Bromodomain Of Human Bromodomain And Wd Repeat-Containing Protein 1 Isoform A (Wdr9) Length = 123 | Back alignment and structure |
| >pdb|1WEM|A Chain A, Solution Structure Of Phd Domain In Death Inducer- Obliterator 1(Dio-1) Length = 76 | Back alignment and structure |
| >pdb|3MB3|A Chain A, Crystal Structure Of The Second Bromodomain Of Pleckstrin Homology Domain Interacting Protein (Phip) Length = 135 | Back alignment and structure |
| >pdb|3HME|A Chain A, Crystal Structure Of Human Bromodomain Containing 9 Isoform 1 (Brd9) Length = 123 | Back alignment and structure |
| >pdb|2I7K|A Chain A, Solution Structure Of The Bromodomain Of Human Brd7 Protein Length = 117 | Back alignment and structure |
| >pdb|2DKW|A Chain A, Solution Structure Of The Bromodomain Of Human Protein Kiaa1240 Length = 131 | Back alignment and structure |
| >pdb|2R0Y|A Chain A, Structure Of The Rsc4 Tandem Bromodomain In Complex With An Acetylated H3 Peptide Length = 311 | Back alignment and structure |
| >pdb|2R0S|A Chain A, Crystal Structure Of The Rsc4 Tandem Bromodomain Length = 285 | Back alignment and structure |
| >pdb|1WEP|A Chain A, Solution Structure Of Phd Domain In Phf8 Length = 79 | Back alignment and structure |
| >pdb|3MQM|A Chain A, Crystal Structure Of The Bromodomain Of Human Ash1l Length = 126 | Back alignment and structure |
| >pdb|3K2J|A Chain A, Crystal Structure Of The 3rd Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 130 | Back alignment and structure |
| >pdb|3G0J|A Chain A, Crystal Structure Of The Fifth Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 124 | Back alignment and structure |
| >pdb|2YQD|A Chain A, Solution Structure Of The Fifth Bromodomain From Mouse Polybromo-1 Length = 120 | Back alignment and structure |
| >pdb|3IU5|A Chain A, Crystal Structure Of The First Bromodomain Of Human Poly-Bromodomain Containing Protein 1 (Pb1) Length = 116 | Back alignment and structure |
| >pdb|3N9L|A Chain A, Cekdm7a From C.Elegans, Complex With H3k4me3 Peptide And Nog Length = 528 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 171 | |||
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 1e-62 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 4e-46 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 1e-44 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 1e-44 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 4e-44 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 9e-44 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 2e-43 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 7e-43 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 2e-42 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 5e-42 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 7e-41 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 1e-40 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 3e-40 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 5e-40 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 6e-40 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 2e-33 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 1e-39 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 1e-39 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 4e-32 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 4e-39 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 3e-38 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 8e-38 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 9e-38 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 2e-37 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 3e-37 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 3e-37 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-36 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 1e-36 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-36 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 3e-36 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 4e-36 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 5e-36 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 2e-35 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 1e-34 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 4e-26 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 1e-34 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 3e-25 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 1e-31 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 6e-29 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 2e-26 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 1e-25 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 2e-24 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 7e-18 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 6e-15 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 1e-14 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 2e-14 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 3e-13 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 5e-13 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 2e-12 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 4e-12 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 5e-12 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 1e-11 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 2e-11 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 4e-11 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 8e-08 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 9e-08 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 7e-07 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 3e-06 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 3e-06 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 6e-05 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 6e-05 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 1e-04 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 3e-04 |
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Length = 174 | Back alignment and structure |
|---|
Score = 190 bits (483), Expect = 1e-62
Identities = 93/155 (60%), Positives = 125/155 (80%)
Query: 10 EPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLR 69
E KFYI CD CQ+W+HGRCVGILQSEA+ IDEY+CP C ++ + + LT +D+E L+
Sbjct: 19 ESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLK 78
Query: 70 KLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMT 129
++++ +QAHK AWPF+EPVDP++APDYY V+KEPMDL T+E R+ ++ Y+KL+EF+ DMT
Sbjct: 79 RVLRSLQAHKMAWPFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMT 138
Query: 130 KIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILR 164
KIFDNCRYYNP +SPF++ A LE FFVQK+K +
Sbjct: 139 KIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKGFK 173
|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 Length = 121 | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A Length = 112 | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A Length = 117 | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A Length = 158 | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} Length = 117 | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A Length = 154 | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... Length = 127 | Back alignment and structure |
|---|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A Length = 265 | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} Length = 166 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} Length = 292 | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A Length = 119 | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} Length = 135 | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* Length = 120 | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A Length = 129 | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} Length = 150 | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A Length = 124 | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* Length = 130 | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A Length = 130 | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A Length = 120 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A Length = 311 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* Length = 361 | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 131 | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Length = 183 | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 64 | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} Length = 75 | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Length = 79 | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Length = 76 | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Length = 528 | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Length = 52 | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 72 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Length = 68 | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Length = 75 | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Length = 447 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Length = 52 | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Length = 78 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Length = 68 | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Length = 91 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Length = 71 | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Length = 60 | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Length = 59 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Length = 65 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| 2ri7_A | 174 | Nucleosome-remodeling factor subunit BPTF; zinc fi | 100.0 | |
| 3o36_A | 184 | Transcription intermediary factor 1-alpha; TRIM24, | 100.0 | |
| 3u5n_A | 207 | E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b | 100.0 | |
| 2ro1_A | 189 | Transcription intermediary factor 1-beta; KAP, TIF | 100.0 | |
| 3lqh_A | 183 | Histone-lysine N-methyltransferase MLL; PHD finger | 100.0 | |
| 3g0l_A | 117 | Hwalp4, bromodomain adjacent to zinc finger domain | 100.0 | |
| 2d9e_A | 121 | Peregrin; four-helix bundle, transcription activat | 100.0 | |
| 3d7c_A | 112 | General control of amino acid synthesis protein 5; | 100.0 | |
| 3q2e_A | 123 | Bromodomain and WD repeat-containing protein 1; st | 99.98 | |
| 2i7k_A | 117 | Bromodomain-containing protein 7; helix, LEFT-hand | 99.97 | |
| 1e6i_A | 121 | Transcriptional activator GCN5; gene regulation, b | 99.97 | |
| 4alg_A | 154 | Bromodomain-containing protein 2; signaling protei | 99.97 | |
| 2oss_A | 127 | HUNK1 protein, bromodomain-containing protein 4; B | 99.97 | |
| 3rcw_A | 135 | Bromodomain-containing protein 1; transcription, s | 99.97 | |
| 3jvl_A | 120 | Bromodomain-containing protein 4; alpha helical, N | 99.97 | |
| 3mb3_A | 135 | PH-interacting protein; PHIP, pleckstrin homology | 99.97 | |
| 3nxb_A | 116 | CAT eye syndrome critical region protein 2; struct | 99.97 | |
| 3iu5_A | 116 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.97 | |
| 2grc_A | 129 | Probable global transcription activator SNF2L4; br | 99.97 | |
| 3mb4_A | 124 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.97 | |
| 3mqm_A | 126 | Probable histone-lysine N-methyltransferase ASH1L; | 99.97 | |
| 2dat_A | 123 | Possible global transcription activator SNF2L2; br | 99.97 | |
| 3p1f_A | 119 | CREB-binding protein; structural genomics consorti | 99.97 | |
| 2yyn_A | 135 | Transcription intermediary factor 1-alpha; bromo d | 99.97 | |
| 2ouo_A | 130 | HUNK1 protein, bromodomain-containing protein 4; B | 99.97 | |
| 3ljw_A | 120 | Protein polybromo-1; alpha helix, alternative spli | 99.97 | |
| 3hme_A | 123 | Bromodomain-containing protein 9; BRD9, bromodomai | 99.97 | |
| 3fkm_X | 166 | Signaling protein; bromodomain, malaria, structura | 99.97 | |
| 3k2j_A | 130 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.97 | |
| 3uv4_A | 158 | Second bromodomain of human transcription initiat | 99.97 | |
| 3dai_A | 130 | ATPase family AAA domain-containing protein 2; anc | 99.96 | |
| 3tlp_A | 150 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.96 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.95 | |
| 2dkw_A | 131 | Hypothetical protein KIAA1240; bromodomain-like, f | 99.95 | |
| 3uv5_A | 265 | Transcription initiation factor TFIID subunit 1; t | 99.95 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.94 | |
| 3aad_A | 292 | Transcription initiation factor TFIID subunit 1; p | 99.93 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.92 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.92 | |
| 3iu6_A | 147 | Protein polybromo-1; PB1, polybromo 1 isoform 1, B | 99.88 | |
| 2r0y_A | 311 | Chromatin structure-remodeling complex protein RSC | 99.87 | |
| 2r10_A | 361 | Chromatin structure-remodeling complex protein RSC | 99.87 | |
| 1we9_A | 64 | PHD finger family protein; structural genomics, PH | 99.53 | |
| 2kgg_A | 52 | Histone demethylase jarid1A; PHD finger, histone m | 99.53 | |
| 1wep_A | 79 | PHF8; structural genomics, PHD domain, riken struc | 99.47 | |
| 3o7a_A | 52 | PHD finger protein 13 variant; PHF13, zinc finger, | 99.47 | |
| 3kqi_A | 75 | GRC5, PHD finger protein 2; metal-binding, zinc-fi | 99.46 | |
| 3o70_A | 68 | PHD finger protein 13; PHF13, structural genomics | 99.42 | |
| 2vpb_A | 65 | Hpygo1, pygopus homolog 1; gene regulation, WNT si | 99.39 | |
| 1wee_A | 72 | PHD finger family protein; structural genomics, PH | 99.36 | |
| 2xb1_A | 105 | Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; | 99.32 | |
| 1wew_A | 78 | DNA-binding family protein; structural genomics, P | 99.3 | |
| 2lv9_A | 98 | Histone-lysine N-methyltransferase MLL5; zinc fing | 99.27 | |
| 1wem_A | 76 | Death associated transcription factor 1; structura | 99.25 | |
| 1wen_A | 71 | Inhibitor of growth family, member 4; ING1-like pr | 99.23 | |
| 2g6q_A | 62 | Inhibitor of growth protein 2; protein-peptide com | 99.22 | |
| 2k16_A | 75 | Transcription initiation factor TFIID subunit 3; p | 99.22 | |
| 3c6w_A | 59 | P28ING5, inhibitor of growth protein 5; chromatin, | 99.21 | |
| 1weu_A | 91 | Inhibitor of growth family, member 4; structural g | 99.19 | |
| 2rsd_A | 68 | E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant | 99.18 | |
| 2vnf_A | 60 | ING 4, P29ING4, inhibitor of growth protein 4; ace | 99.17 | |
| 3kv4_A | 447 | PHD finger protein 8; epigenetics, histone CODE, c | 99.08 | |
| 3kv5_D | 488 | JMJC domain-containing histone demethylation prote | 99.07 | |
| 2jmi_A | 90 | Protein YNG1, ING1 homolog 1; PHD, histone, recogn | 99.06 | |
| 1f62_A | 51 | Transcription factor WSTF; Zn-finger; NMR {Homo sa | 99.05 | |
| 1x4i_A | 70 | Inhibitor of growth protein 3; structural genomics | 99.04 | |
| 1mm2_A | 61 | MI2-beta; PHD, zinc finger, protein scaffold, DNA | 99.04 | |
| 2l5u_A | 61 | Chromodomain-helicase-DNA-binding protein 4; CHD4, | 99.04 | |
| 1xwh_A | 66 | Autoimmune regulator; PHD domain, Zn binding domai | 99.03 | |
| 1fp0_A | 88 | KAP-1 corepressor; PHD domain, C3HC4 type zinc bin | 99.02 | |
| 2puy_A | 60 | PHD finger protein 21A; PHD finger, histone CODE, | 98.99 | |
| 2yql_A | 56 | PHD finger protein 21A; PHD domain, structural gen | 98.99 | |
| 2lri_C | 66 | Autoimmune regulator; Zn binding protein domain, a | 98.97 | |
| 2lbm_A | 142 | Transcriptional regulator ATRX; metal binding prot | 98.92 | |
| 2ku3_A | 71 | Bromodomain-containing protein 1; PHD finger, chro | 98.92 | |
| 3pur_A | 528 | Lysine-specific demethylase 7 homolog; oxidoreduct | 98.92 | |
| 3asl_A | 70 | E3 ubiquitin-protein ligase UHRF1; histone reader | 98.9 | |
| 2e6r_A | 92 | Jumonji/ARID domain-containing protein 1D; PHD dom | 98.87 | |
| 2e6s_A | 77 | E3 ubiquitin-protein ligase UHRF2; PHD domain, str | 98.82 | |
| 2yt5_A | 66 | Metal-response element-binding transcription facto | 98.81 | |
| 4gne_A | 107 | Histone-lysine N-methyltransferase NSD3; zinc fing | 98.8 | |
| 2l43_A | 88 | N-teminal domain from histone H3.3, linker, PHD1 f | 98.8 | |
| 1wev_A | 88 | Riken cDNA 1110020M19; structural genomics, PHD do | 98.77 | |
| 3shb_A | 77 | E3 ubiquitin-protein ligase UHRF1; unmodified hist | 98.7 | |
| 3ql9_A | 129 | Transcriptional regulator ATRX; zinc finger, trans | 98.69 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 98.6 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 98.53 | |
| 2ku7_A | 140 | MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio | 98.36 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.3 | |
| 4bbq_A | 117 | Lysine-specific demethylase 2A; oxidoreductase, ub | 98.26 | |
| 2ysm_A | 111 | Myeloid/lymphoid or mixed-lineage leukemia protein | 98.2 | |
| 3rsn_A | 177 | SET1/ASH2 histone methyltransferase complex subun; | 98.17 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 97.94 | |
| 3v43_A | 112 | Histone acetyltransferase KAT6A; MOZ, PHD finger, | 97.87 | |
| 1wil_A | 89 | KIAA1045 protein; ring finger domain, structural g | 97.13 | |
| 3a1b_A | 159 | DNA (cytosine-5)-methyltransferase 3A, histone H3; | 96.11 | |
| 2pv0_B | 386 | DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, | 95.24 | |
| 6rxn_A | 46 | Rubredoxin; electron transfer(iron-sulfur protein) | 93.87 | |
| 1iym_A | 55 | EL5; ring-H2 finger, ubiquitin ligase, DNA binding | 93.05 | |
| 4rxn_A | 54 | Rubredoxin; electron transfer(iron-sulfur protein) | 93.01 | |
| 2l7p_A | 100 | Histone-lysine N-methyltransferase ASHH2; CW-domai | 92.29 | |
| 2v3b_B | 55 | Rubredoxin 2, rubredoxin; alkane degradation, iron | 92.02 | |
| 2kn9_A | 81 | Rubredoxin; metalloprotein, ssgcid, structural gen | 92.02 | |
| 1e8j_A | 52 | Rubredoxin; iron-sulfur-protein, zinc-substitution | 91.95 | |
| 2d8s_A | 80 | Cellular modulator of immune recognition; C-MIR, m | 91.23 | |
| 2e61_A | 69 | Zinc finger CW-type PWWP domain protein 1; ZF-CW d | 90.7 | |
| 1dx8_A | 70 | Rubredoxin; electron transport, zinc-substitution; | 90.56 | |
| 1yk4_A | 52 | Rubredoxin, RD; electron transport; 0.69A {Pyrococ | 90.08 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 89.76 | |
| 1s24_A | 87 | Rubredoxin 2; electron transport; NMR {Pseudomonas | 89.36 | |
| 2ecl_A | 81 | Ring-box protein 2; RNF7, ring domian, zinc-bindin | 88.03 | |
| 1jm7_A | 112 | BRCA1, breast cancer type 1 susceptibility protein | 87.78 | |
| 1v87_A | 114 | Deltex protein 2; ring-H2 domain, zinc-binding dom | 87.03 | |
| 2lq6_A | 87 | Bromodomain-containing protein 1; PHD finger, meta | 86.73 | |
| 3lrq_A | 100 | E3 ubiquitin-protein ligase TRIM37; structural gen | 86.52 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 84.59 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 84.33 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 83.87 | |
| 2l0b_A | 91 | E3 ubiquitin-protein ligase praja-1; zinc finger, | 80.5 |
| >2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-50 Score=289.54 Aligned_cols=162 Identities=57% Similarity=1.143 Sum_probs=148.3
Q ss_pred ccccccCCCceeEecCCCCceecccccCccccCcCCCCCCCCCccCCCCcccccccCCChhHHHHHHHHHHHHHhCcCCC
Q psy5115 3 FHTLAVIEPKFYICCDTCQDWFHGRCVGILQSEADNIDEYICPNCNNSSSNLANMKNLTPRDFESLRKLMKQIQAHKSAW 82 (171)
Q Consensus 3 ~~~~~~~~~~~~i~C~~C~r~~H~~C~~~~~~~~~~~~~~~Cp~C~~~~~~~~~~~~l~~~~~~~~~~~l~~l~~~~~~~ 82 (171)
.|.+++|++|+||+||.|++|||..|+|++....+..+.|.||.|...........++++.+++.|..+|+.|.+++.++
T Consensus 12 ~C~~~~~~~~~mi~Cd~C~~WfH~~Cv~~~~~~~~~~~~~~C~~C~~~~~~~~~~~~l~~~~~~~l~~il~~l~~~~~~~ 91 (174)
T 2ri7_A 12 ICKTPEDESKFYIGCDRCQNWYHGRCVGILQSEAELIDEYVCPQCQSTEDAMTVLTPLTEKDYEGLKRVLRSLQAHKMAW 91 (174)
T ss_dssp TTTEECCTTSCEEECTTTCCEEEHHHHTCCHHHHTTCSSCCCHHHHHHHHHHTTTSBCCHHHHHHHHHHHHHHHTSGGGT
T ss_pred eCCCCCCCCCCEeECCCCCchhChhhcCCchhhccCccCeecCCCcchhccccccccCCHHHHHHHHHHHHHHHhhhhhh
Confidence 47888888999999999999999999999876666678999999985433333446799999999999999999999999
Q ss_pred CCccCCCCCCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCCCCHHHHHHHHHHHHHHHHHHH
Q psy5115 83 PFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKI 162 (171)
Q Consensus 83 ~F~~pv~~~~~p~Y~~~i~~Pmdl~~I~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yn~~~s~~~~~a~~l~~~f~~~~~~ 162 (171)
+|..||++..+|+|+++|++||||++|++||++|.|.|+++|.+||+|||+||.+||+++|.++++|..|++.|++.+++
T Consensus 92 ~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~s~~~~~A~~L~~~f~~~~~~ 171 (174)
T 2ri7_A 92 PFLEPVDPNDAPDYYGVIKEPMDLATMEERVQRRYYEKLTEFVADMTKIFDNCRYYNPSDSPFYQCAEVLESFFVQKLKG 171 (174)
T ss_dssp TTSSCCCTTTCHHHHHHCSSCCCHHHHHHHHHTTCCCBHHHHHHHHHHHHHHHHHHSCTTSHHHHHHHHHHHHHHHHTTT
T ss_pred hhhcCCCcccCCchHHHhCCcCCHHHHHHHHHcCCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999876
Q ss_pred HH
Q psy5115 163 LR 164 (171)
Q Consensus 163 ~~ 164 (171)
++
T Consensus 172 ~~ 173 (174)
T 2ri7_A 172 FK 173 (174)
T ss_dssp CC
T ss_pred cc
Confidence 53
|
| >3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A | Back alignment and structure |
|---|
| >3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* | Back alignment and structure |
|---|
| >2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A | Back alignment and structure |
|---|
| >3g0l_A Hwalp4, bromodomain adjacent to zinc finger domain protei; BAZB2, KIAA1 WALP4, structural genomics consortium, SGC, transcription; 2.03A {Homo sapiens} PDB: 3q2f_A* 2e7o_A | Back alignment and structure |
|---|
| >2d9e_A Peregrin; four-helix bundle, transcription activator, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d7c_A General control of amino acid synthesis protein 5; GCN5, bromodomain, structural genomics consortium, SGC, HOST-virus interaction, nucleus; 2.06A {Homo sapiens} SCOP: a.29.2.1 PDB: 1f68_A 1jm4_B* 1n72_A 1wug_A* 1wum_A* 1zs5_A* 2rnw_A* 2rnx_A* 3gg3_A | Back alignment and structure |
|---|
| >3q2e_A Bromodomain and WD repeat-containing protein 1; structural genomics consortium, SGC, cell cycle progression, signal transduction, apoptosis; 1.74A {Homo sapiens} | Back alignment and structure |
|---|
| >2i7k_A Bromodomain-containing protein 7; helix, LEFT-handed four-helix bundle, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1e6i_A Transcriptional activator GCN5; gene regulation, bromodomain, histone binding, N-acetyl lysine; HET: ALY; 1.87A {Saccharomyces cerevisiae} SCOP: a.29.2.1 | Back alignment and structure |
|---|
| >4alg_A Bromodomain-containing protein 2; signaling protein, inhibitor, histone, epigenetic reader; HET: 1GH; 1.60A {Homo sapiens} PDB: 4a9e_A 4a9h_A* 4a9i_A* 4a9j_A* 4a9m_A* 4a9n_A* 4a9o_A* 4a9p_A* 4a9f_A* 4alh_A* 4akn_A* 2yek_A* 2ydw_A* 2yw5_A | Back alignment and structure |
|---|
| >2oss_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.35A {Homo sapiens} PDB: 2yel_A* 3mxf_A* 3p5o_A* 3svf_A* 3svg_A* 3u5j_A* 3u5k_A* 3u5l_A* 3uvw_A* 3uvx_A* 3uvy_A* 3uw9_A* 3zyu_A* 4a9l_A* 4e96_A* 3jvj_A 3jvk_A* 3muk_A* 3mul_A* 2nxb_A ... | Back alignment and structure |
|---|
| >3rcw_A Bromodomain-containing protein 1; transcription, structural genomics, structural consortium, SGC; 2.21A {Homo sapiens} | Back alignment and structure |
|---|
| >3jvl_A Bromodomain-containing protein 4; alpha helical, N-acetyl lysine binding domain, signaling protein; 1.20A {Mus musculus} PDB: 3jvm_A 2dww_A 2i8n_A 3oni_A* 2dvv_A* 2e3k_A* 2g4a_A 3s92_A* 2oo1_A* 2e7n_A 2wp1_A* | Back alignment and structure |
|---|
| >3mb3_A PH-interacting protein; PHIP, pleckstrin homology domain interacting protein, DCAF14 DDB1 and CUL4 associated factor 14, SGC; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3nxb_A CAT eye syndrome critical region protein 2; structural genomics consortium, SGC, CECR2, CAT eye syndrome chromosome region candidate 2, bromodomain; 1.83A {Homo sapiens} SCOP: a.29.2.0 | Back alignment and structure |
|---|
| >3iu5_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; 1.63A {Homo sapiens} | Back alignment and structure |
|---|
| >2grc_A Probable global transcription activator SNF2L4; bromodomain, BRG1, chromatin remodelling, acely-lysine binding, protein-protein interactions; 1.50A {Homo sapiens} PDB: 3uvd_A 2h60_A | Back alignment and structure |
|---|
| >3mb4_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 1.66A {Homo sapiens} PDB: 3g0j_A 2yqd_A | Back alignment and structure |
|---|
| >3mqm_A Probable histone-lysine N-methyltransferase ASH1L; KIAA1420, absent small and homeotic disks prote homolog, lysine N-methyltransferase 2H, KMT2H; 2.54A {Homo sapiens} | Back alignment and structure |
|---|
| >2dat_A Possible global transcription activator SNF2L2; bromodomain, all alpha protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3p1f_A CREB-binding protein; structural genomics consortium, SGC, CBP, crebbp, CREB bindi protein isoform A, KAT3A, RSTS, RST, bromodomain, transcrip; HET: 3PF; 1.63A {Homo sapiens} SCOP: a.29.2.1 PDB: 3dwy_A 3p1d_A 3p1c_A 3p1e_A* 3svh_A* 4a9k_A* 1jsp_B* 2d82_A* 2l84_A* 2l85_A* 2rny_A* 3i3j_A | Back alignment and structure |
|---|
| >2yyn_A Transcription intermediary factor 1-alpha; bromo domain, structural genomics, NPPSFA; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ouo_A HUNK1 protein, bromodomain-containing protein 4; BRD4, structural genomics consortium, SGC, signaling protein; 1.89A {Homo sapiens} PDB: 2yem_A* | Back alignment and structure |
|---|
| >3ljw_A Protein polybromo-1; alpha helix, alternative splicing, bromodomain, chromatin RE DNA-binding, nucleus, phosphoprotein, transcription; 1.50A {Homo sapiens} PDB: 2ktb_B* 3hmf_A | Back alignment and structure |
|---|
| >3hme_A Bromodomain-containing protein 9; BRD9, bromodomain containing 9 isoform 1, LAVS3040, rhabdomyosarcoma antigen MU-RMS-40.8; 2.23A {Homo sapiens} | Back alignment and structure |
|---|
| >3fkm_X Signaling protein; bromodomain, malaria, structural genomics, structural genomi consortium, SGC; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3k2j_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo01D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3uv4_A Second bromodomain of human transcription initiat TFIID subunit 1 (TAF1); structural genomics consortium, SGC; 1.89A {Homo sapiens} PDB: 3hmh_A | Back alignment and structure |
|---|
| >3dai_A ATPase family AAA domain-containing protein 2; ancca, AAA+ nuclear coregulator cancer-associated Pro2000 protein, two AAA DOMA containing protein; 1.95A {Homo sapiens} PDB: 3lxj_A | Back alignment and structure |
|---|
| >3tlp_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo-1D, PBRM1, BRG associated factor 180, structural genomics consortium, SGC; 2.13A {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >2dkw_A Hypothetical protein KIAA1240; bromodomain-like, five-helix, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3uv5_A Transcription initiation factor TFIID subunit 1; tandem bromodomain, TAF1, cell cycle gene 1 protein, TBP-ASS factor 250 kDa; 2.03A {Homo sapiens} PDB: 1eqf_A | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3aad_A Transcription initiation factor TFIID subunit 1; protein-protein complex, bromodomain, transcription, transcr regulation, chromatin regulator, transcription-C complex; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >3iu6_A Protein polybromo-1; PB1, polybromo 1 isoform 1, BAF180, polybromo0ID, PBRM1, BRG associated factor 180, structural genomics, SGC; HET: OCS; 1.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2r0y_A Chromatin structure-remodeling complex protein RSC4; bromodomain, chromatin, remodeler, RSC, acetylation, transcription, chromatin regulator, nucleus, phosphorylation; HET: ALY; 1.75A {Saccharomyces cerevisiae} PDB: 2r0s_A | Back alignment and structure |
|---|
| >2r10_A Chromatin structure-remodeling complex protein RSC4, linker, histone H3; bromodomain, remodeler, acetylation, transcription; HET: ALY; 2.20A {Saccharomyces cerevisiae} PDB: 2r0v_A* | Back alignment and structure |
|---|
| >1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* | Back alignment and structure |
|---|
| >1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} | Back alignment and structure |
|---|
| >3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* | Back alignment and structure |
|---|
| >1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A | Back alignment and structure |
|---|
| >2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* | Back alignment and structure |
|---|
| >3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* | Back alignment and structure |
|---|
| >1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* | Back alignment and structure |
|---|
| >3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* | Back alignment and structure |
|---|
| >2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* | Back alignment and structure |
|---|
| >1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A | Back alignment and structure |
|---|
| >2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A | Back alignment and structure |
|---|
| >1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} | Back alignment and structure |
|---|
| >2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A | Back alignment and structure |
|---|
| >2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* | Back alignment and structure |
|---|
| >3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B | Back alignment and structure |
|---|
| >2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} | Back alignment and structure |
|---|
| >4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* | Back alignment and structure |
|---|
| >2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 | Back alignment and structure |
|---|
| >3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rsn_A SET1/ASH2 histone methyltransferase complex subun; PHD domain, winged helix domain, binding, transcription; 2.10A {Homo sapiens} PDB: 3s32_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A | Back alignment and structure |
|---|
| >1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 | Back alignment and structure |
|---|
| >3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* | Back alignment and structure |
|---|
| >2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* | Back alignment and structure |
|---|
| >6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... | Back alignment and structure |
|---|
| >2l7p_A Histone-lysine N-methyltransferase ASHH2; CW-domain; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >1e8j_A Rubredoxin; iron-sulfur-protein, zinc-substitution, thermostability; NMR {Desulfovibrio gigas} SCOP: g.41.5.1 PDB: 1rdg_A 2dsx_A 1spw_A | Back alignment and structure |
|---|
| >2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e61_A Zinc finger CW-type PWWP domain protein 1; ZF-CW domain, structural genomics, NPPSFA, national project protein structural and functional analyses; NMR {Homo sapiens} PDB: 2rr4_A* | Back alignment and structure |
|---|
| >1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A | Back alignment and structure |
|---|
| >1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >1s24_A Rubredoxin 2; electron transport; NMR {Pseudomonas oleovorans} SCOP: g.41.5.1 | Back alignment and structure |
|---|
| >2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 171 | ||||
| d1eqfa1 | 139 | a.29.2.1 (A:1359-1497) TAFII250 double bromodomain | 5e-32 | |
| d1eqfa2 | 128 | a.29.2.1 (A:1498-1625) TAFII250 double bromodomain | 3e-30 | |
| d1e6ia_ | 111 | a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces c | 7e-30 | |
| d3d7ca1 | 102 | a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [T | 8e-30 | |
| d1wuma1 | 118 | a.29.2.1 (A:715-832) P300/CAF histone acetyltransf | 6e-29 | |
| d3dwya1 | 114 | a.29.2.1 (A:1084-1197) CREB-binding protein, CBP { | 3e-26 | |
| d1we9a_ | 64 | g.50.1.2 (A:) PHD finger protein At5g26210 {Thale | 7e-13 | |
| d1wepa_ | 79 | g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus mus | 3e-12 | |
| d1wema_ | 76 | g.50.1.2 (A:) Death associated transcription facto | 3e-10 | |
| d1weea_ | 72 | g.50.1.2 (A:) PHD finger protein At1g33420 {Thale | 1e-08 | |
| d1wewa_ | 78 | g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale c | 2e-07 | |
| d1mm2a_ | 61 | g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens | 6e-06 | |
| d1f62a_ | 51 | g.50.1.2 (A:) Williams-Beuren syndrome transcripti | 4e-05 | |
| d1fp0a1 | 70 | g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- | 4e-04 | |
| d1weva_ | 88 | g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu | 6e-04 | |
| d2pnxa1 | 51 | g.50.1.2 (A:195-245) Inhibitor of growth protein 4 | 0.001 |
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 139 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: TAFII250 double bromodomain module species: Human (Homo sapiens) [TaxId: 9606]
Score = 109 bits (274), Expect = 5e-32
Identities = 25/103 (24%), Positives = 47/103 (45%)
Query: 68 LRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGD 127
L ++ ++ + +PF PV+ DYY ++ PMDL+T+ + ++ Y EF
Sbjct: 31 LESIINDMRDLPNTYPFHTPVNAKVVKDYYKIITRPMDLQTLRENVRKRLYPSREEFREH 90
Query: 128 MTKIFDNCRYYNPRESPFFKHAHQLEMFFVQKVKILREKLVEL 170
+ I N YN + + + + +K+K +KL L
Sbjct: 91 LELIVKNSATYNGPKHSLTQISQSMLDLCDEKLKEKEDKLARL 133
|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} Length = 128 | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 111 | Back information, alignment and structure |
|---|
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 64 | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 76 | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 72 | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 171 | |||
| d3d7ca1 | 102 | GCN5 {Human (Homo sapiens) [TaxId: 9606]} | 100.0 | |
| d1eqfa1 | 139 | TAFII250 double bromodomain module {Human (Homo sa | 99.98 | |
| d1e6ia_ | 111 | GCN5 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.97 | |
| d1wuma1 | 118 | P300/CAF histone acetyltransferase bromodomain {Hu | 99.97 | |
| d3dwya1 | 114 | CREB-binding protein, CBP {Human (Homo sapiens) [T | 99.97 | |
| d1eqfa2 | 128 | TAFII250 double bromodomain module {Human (Homo sa | 99.97 | |
| d1wepa_ | 79 | PHD finger protein 8 {Mouse (Mus musculus) [TaxId: | 99.46 | |
| d1we9a_ | 64 | PHD finger protein At5g26210 {Thale cress (Arabido | 99.36 | |
| d1weea_ | 72 | PHD finger protein At1g33420 {Thale cress (Arabido | 99.22 | |
| d1mm2a_ | 61 | Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 | 99.22 | |
| d1fp0a1 | 70 | Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo | 99.13 | |
| d1f62a_ | 51 | Williams-Beuren syndrome transcription factor, WST | 99.09 | |
| d2pnxa1 | 51 | Inhibitor of growth protein 4, Ing4 {Homo sapiens | 99.05 | |
| d1wesa_ | 71 | PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu | 99.05 | |
| d1wema_ | 76 | Death associated transcription factor 1, Datf1 (DI | 99.03 | |
| d1wewa_ | 78 | Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop | 98.94 | |
| d1weva_ | 88 | PHD finger protein 22 {Mouse (Mus musculus) [TaxId | 98.76 | |
| d1iyma_ | 55 | EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 | 96.01 | |
| d6rxna_ | 45 | Rubredoxin {Desulfovibrio desulfuricans, strain 27 | 95.27 | |
| d1iroa_ | 53 | Rubredoxin {Clostridium pasteurianum [TaxId: 1501] | 94.15 | |
| d1brfa_ | 53 | Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2 | 93.66 | |
| d1dx8a_ | 70 | Rubredoxin {Guillardia theta [TaxId: 55529]} | 93.53 | |
| d2dsxa1 | 52 | Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | 93.31 | |
| d1wila_ | 89 | Hypothetical protein KIAA1045 {Human (Homo sapiens | 93.2 | |
| d1s24a_ | 56 | Two-iron rubredoxin {Pseudomonas oleovorans [TaxId | 92.36 | |
| d1v87a_ | 114 | Deltex protein 2 RING-H2 domain {Mouse (Mus muscul | 91.17 | |
| d1vyxa_ | 60 | IE1B protein (ORF K3), N-terminal domain {Kaposi's | 90.43 | |
| d1jm7a_ | 103 | brca1 RING domain {Human (Homo sapiens) [TaxId: 96 | 87.99 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 86.62 | |
| d3dplr1 | 88 | RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase | 86.26 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 83.81 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 83.64 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 82.27 | |
| d1ur6b_ | 52 | Not-4 N-terminal RING finger domain {Human (Homo s | 81.64 |
| >d3d7ca1 a.29.2.1 (A:731-832) GCN5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Bromodomain-like superfamily: Bromodomain family: Bromodomain domain: GCN5 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1e-32 Score=180.58 Aligned_cols=100 Identities=44% Similarity=0.837 Sum_probs=96.7
Q ss_pred hHHHHHHHHHHHHHhCcCCCCCccCCCCCCCCccccccCCCCCHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHhhhCCCC
Q psy5115 63 RDFESLRKLMKQIQAHKSAWPFMEPVDPHEAPDYYNVVKEPMDLKTIELRIAQQRYKKLSEFIGDMTKIFDNCRYYNPRE 142 (171)
Q Consensus 63 ~~~~~~~~~l~~l~~~~~~~~F~~pv~~~~~p~Y~~~i~~Pmdl~~I~~kl~~~~Y~s~~~f~~Dv~li~~Na~~yn~~~ 142 (171)
+....|..+|..|.+++.+++|..||++..+|+|+++|++||||++|++||++|.|.|+++|.+||++||+||..||+++
T Consensus 2 ~L~~~l~~il~~l~~~~~s~~F~~pv~~~~~pdY~~~I~~PmdL~tI~~kl~~~~Y~s~~~f~~D~~li~~Na~~yN~~~ 81 (102)
T d3d7ca1 2 QLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYYVTRKLFVADLQRVIANCREYNPPD 81 (102)
T ss_dssp HHHHHHHHHHHHHHHSGGGGGGSSCCCTTTSTTHHHHCSSCCCHHHHHHHHHTTCCCSHHHHHHHHHHHHHHHHHHSCTT
T ss_pred hHHHHHHHHHHHHHhCCCCCccCCCCChhhCcCHHHHcCCccCHHHHHHHhccCccCCHHHHHHHHHHHHHHHHHHCCCC
Confidence 56788999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred CHHHHHHHHHHHHHHHHHHH
Q psy5115 143 SPFFKHAHQLEMFFVQKVKI 162 (171)
Q Consensus 143 s~~~~~a~~l~~~f~~~~~~ 162 (171)
|.++++|..|++.|++.+++
T Consensus 82 s~~~~~A~~l~~~f~~~~ke 101 (102)
T d3d7ca1 82 SEYCRCASALEKFFYFKLKE 101 (102)
T ss_dssp SHHHHHHHHHHHHHHHHHHH
T ss_pred CHHHHHHHHHHHHHHHHHhc
Confidence 99999999999999998875
|
| >d1eqfa1 a.29.2.1 (A:1359-1497) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e6ia_ a.29.2.1 (A:) GCN5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wuma1 a.29.2.1 (A:715-832) P300/CAF histone acetyltransferase bromodomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dwya1 a.29.2.1 (A:1084-1197) CREB-binding protein, CBP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eqfa2 a.29.2.1 (A:1498-1625) TAFII250 double bromodomain module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d6rxna_ g.41.5.1 (A:) Rubredoxin {Desulfovibrio desulfuricans, strain 27774 [TaxId: 876]} | Back information, alignment and structure |
|---|
| >d1iroa_ g.41.5.1 (A:) Rubredoxin {Clostridium pasteurianum [TaxId: 1501]} | Back information, alignment and structure |
|---|
| >d1brfa_ g.41.5.1 (A:) Rubredoxin {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1dx8a_ g.41.5.1 (A:) Rubredoxin {Guillardia theta [TaxId: 55529]} | Back information, alignment and structure |
|---|
| >d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s24a_ g.41.5.1 (A:) Two-iron rubredoxin {Pseudomonas oleovorans [TaxId: 301]} | Back information, alignment and structure |
|---|
| >d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} | Back information, alignment and structure |
|---|
| >d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|