Psyllid ID: psy5126

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120---
WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIFSHF
cEEEEcccccccccccEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccccccEEEEcccc
EEEEEEccccccccEEEEccccccHHHHHHHHHHHHHHHHccccEEEEEEcccccccEccccccHHHHHHHHHHHcHHHHHHHHHHHHHHEEEEEEEEEEccHHHHcccccEcccEEEEEccc
wvgsidlnpndqadaniivnkddawLEQETTVLAELKTILAGDKIDAVICVaggwaggnaaaKDFVKSADIMWRQSVWSSVLAATIAAnhlkpgglvslpgakpalegtpgmylpmTIIFSHF
wvgsidlnpndqadANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIFSHF
WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVaggwaggnaaaKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIFSHF
**************ANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIF***
WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIFSHF
WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIFSHF
WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIFSHF
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTIIFSHF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query123 2.2.26 [Sep-21-2011]
Q3T0Z7242 Dihydropteridine reductas yes N/A 0.910 0.462 0.517 4e-31
Q8MJ30243 Dihydropteridine reductas yes N/A 0.910 0.460 0.517 1e-30
P09417244 Dihydropteridine reductas yes N/A 0.910 0.459 0.517 3e-30
P11348241 Dihydropteridine reductas yes N/A 0.910 0.464 0.517 4e-30
Q8BVI4241 Dihydropteridine reductas yes N/A 0.910 0.464 0.5 4e-29
Q86A17231 Dihydropteridine reductas yes N/A 0.853 0.454 0.366 8e-12
>sp|Q3T0Z7|DHPR_BOVIN Dihydropteridine reductase OS=Bos taurus GN=QDPR PE=2 SV=1 Back     alignment and function desciption
 Score =  132 bits (333), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 58/112 (51%), Positives = 84/112 (75%)

Query: 1   WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 60
           WV SID+  N++A AN++V   D++ EQ   V AE+  +L  +K+DA++CVAGGWAGGNA
Sbjct: 34  WVASIDVQENEEASANVVVKMTDSFTEQADQVTAEVGKLLGTEKVDAILCVAGGWAGGNA 93

Query: 61  AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGM 112
            +K   K+ D+MW+QSVW+S +++ +A  HLK GGL++L GA+ AL+GTPGM
Sbjct: 94  KSKSLFKNCDLMWKQSVWTSTISSHLATKHLKEGGLLTLAGARAALDGTPGM 145
The product of this enzyme, tetrahydrobiopterin (BH-4), is an essential cofactor for phenylalanine, tyrosine, and tryptophan hydroxylases.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 3EC: 4
>sp|Q8MJ30|DHPR_PIG Dihydropteridine reductase OS=Sus scrofa GN=QDPR PE=2 SV=1 Back     alignment and function description
>sp|P09417|DHPR_HUMAN Dihydropteridine reductase OS=Homo sapiens GN=QDPR PE=1 SV=2 Back     alignment and function description
>sp|P11348|DHPR_RAT Dihydropteridine reductase OS=Rattus norvegicus GN=Qdpr PE=1 SV=1 Back     alignment and function description
>sp|Q8BVI4|DHPR_MOUSE Dihydropteridine reductase OS=Mus musculus GN=Qdpr PE=1 SV=2 Back     alignment and function description
>sp|Q86A17|DHPR_DICDI Dihydropteridine reductase OS=Dictyostelium discoideum GN=qdpr PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
195135535 235 GI16833 [Drosophila mojavensis] gi|19391 0.902 0.472 0.660 7e-36
312375153 234 hypothetical protein AND_14502 [Anophele 0.902 0.474 0.651 8e-36
289740315 235 reductases [Glossina morsitans morsitans 0.902 0.472 0.642 1e-35
289724616210 dihydropteridine reductase dHPR/QdPR [Gl 0.902 0.528 0.642 2e-35
195375020 235 GJ12582 [Drosophila virilis] gi|19415345 0.902 0.472 0.651 2e-35
347968029 233 AGAP002534-PB [Anopheles gambiae str. PE 0.902 0.476 0.651 3e-35
58383114 234 AGAP002534-PA [Anopheles gambiae str. PE 0.902 0.474 0.651 3e-35
383866338 237 PREDICTED: dihydropteridine reductase-li 0.910 0.472 0.616 4e-35
125980289 235 GA18340 [Drosophila pseudoobscura pseudo 0.902 0.472 0.642 4e-35
195326223 235 GM25120 [Drosophila sechellia] gi|194118 0.902 0.472 0.642 6e-35
>gi|195135535|ref|XP_002012188.1| GI16833 [Drosophila mojavensis] gi|193918452|gb|EDW17319.1| GI16833 [Drosophila mojavensis] Back     alignment and taxonomy information
 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 95/112 (84%), Gaps = 1/112 (0%)

Query: 1   WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 60
           WVGSIDL+ ND+AD +I+V +D +W EQE++V++++   LAG K+DAVICVAGGWAGGN 
Sbjct: 29  WVGSIDLSENDKADISIVVPRDSSWEEQESSVVSQVGESLAGQKLDAVICVAGGWAGGN- 87

Query: 61  AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGM 112
           A KD  K+AD+MWRQSVWSS ++AT+AA+HLK GGL++L GAKPAL GTPGM
Sbjct: 88  AKKDLAKNADLMWRQSVWSSCISATLAAHHLKTGGLLALTGAKPALAGTPGM 139

Source: Drosophila mojavensis

Species: Drosophila mojavensis

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|312375153|gb|EFR22576.1| hypothetical protein AND_14502 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|289740315|gb|ADD18905.1| reductases [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|289724616|gb|ADD18291.1| dihydropteridine reductase dHPR/QdPR [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|195375020|ref|XP_002046301.1| GJ12582 [Drosophila virilis] gi|194153459|gb|EDW68643.1| GJ12582 [Drosophila virilis] Back     alignment and taxonomy information
>gi|347968029|ref|XP_003436147.1| AGAP002534-PB [Anopheles gambiae str. PEST] gi|333468196|gb|EGK96866.1| AGAP002534-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|58383114|ref|XP_312404.2| AGAP002534-PA [Anopheles gambiae str. PEST] gi|55242231|gb|EAA07501.3| AGAP002534-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|383866338|ref|XP_003708627.1| PREDICTED: dihydropteridine reductase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|125980289|ref|XP_001354169.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|195174538|ref|XP_002028030.1| GL15041 [Drosophila persimilis] gi|54642473|gb|EAL31221.1| GA18340 [Drosophila pseudoobscura pseudoobscura] gi|194115752|gb|EDW37795.1| GL15041 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195326223|ref|XP_002029829.1| GM25120 [Drosophila sechellia] gi|194118772|gb|EDW40815.1| GM25120 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query123
FB|FBgn0035964235 Dhpr "Dihydropteridine reducta 0.902 0.472 0.553 1.6e-29
UNIPROTKB|Q3T0Z7242 QDPR "Dihydropteridine reducta 0.910 0.462 0.437 2e-24
UNIPROTKB|I3LKS6243 QDPR "Dihydropteridine reducta 0.910 0.460 0.437 2.6e-24
WB|WBGene00011398236 qdpr-1 [Caenorhabditis elegans 0.886 0.461 0.486 3.3e-24
UNIPROTKB|Q8MJ30243 QDPR "Dihydropteridine reducta 0.910 0.460 0.437 4.2e-24
UNIPROTKB|P09417244 QDPR "Dihydropteridine reducta 0.910 0.459 0.437 6.8e-24
UNIPROTKB|B7Z415152 QDPR "Quinoid dihydropteridine 0.934 0.756 0.422 8.7e-24
UNIPROTKB|H0Y8F7128 QDPR "Dihydropteridine reducta 0.934 0.898 0.422 8.7e-24
RGD|619915241 Qdpr "quinoid dihydropteridine 0.910 0.464 0.437 8.7e-24
UNIPROTKB|E2RLU9242 QDPR "Uncharacterized protein" 0.910 0.462 0.419 2.3e-23
FB|FBgn0035964 Dhpr "Dihydropteridine reductase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 327 (120.2 bits), Expect = 1.6e-29, P = 1.6e-29
 Identities = 62/112 (55%), Positives = 84/112 (75%)

Query:     1 WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVXXXXXXXXX 60
             WVGSIDL  N++AD +I+V +D +W+EQE TV++++   LAG+K+DAVICV         
Sbjct:    29 WVGSIDLTENEKADVSIVVPRDASWVEQEETVVSKVGESLAGEKLDAVICVAGGWAGGNA 88

Query:    61 XXKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGM 112
               KD  K+AD+MW+QSV +S ++A +AA HLK GGL++L GAKPALEGTPGM
Sbjct:    89 K-KDLAKNADLMWKQSVLTSAISAAVAAQHLKAGGLLALTGAKPALEGTPGM 139
GO:0004155 "6,7-dihydropteridine reductase activity" evidence=ISS;NAS
GO:0008152 "metabolic process" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|Q3T0Z7 QDPR "Dihydropteridine reductase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LKS6 QDPR "Dihydropteridine reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00011398 qdpr-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MJ30 QDPR "Dihydropteridine reductase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P09417 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B7Z415 QDPR "Quinoid dihydropteridine reductase, isoform CRA_c" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y8F7 QDPR "Dihydropteridine reductase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|619915 Qdpr "quinoid dihydropteridine reductase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLU9 QDPR "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3T0Z7DHPR_BOVIN1, ., 5, ., 1, ., 3, 40.51780.91050.4628yesN/A
P11348DHPR_RAT1, ., 5, ., 1, ., 3, 40.51780.91050.4647yesN/A
P09417DHPR_HUMAN1, ., 5, ., 1, ., 3, 40.51780.91050.4590yesN/A
Q8MJ30DHPR_PIG1, ., 5, ., 1, ., 3, 40.51780.91050.4609yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 7e-42
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information 
 Score =  137 bits (346), Expect = 7e-42
 Identities = 60/112 (53%), Positives = 82/112 (73%), Gaps = 2/112 (1%)

Query: 1   WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 60
           WV SIDL  N++ADA+IIV   D++ EQ   V+A +  +    K+DA+ICVAGGWAGG+A
Sbjct: 27  WVASIDLAENEEADASIIVLDSDSFTEQAKQVVASVARL--SGKVDALICVAGGWAGGSA 84

Query: 61  AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGM 112
            +K FVK+ D+MW+Q++W+S +A+ +A  HL  GGL+ L GAK ALE TPGM
Sbjct: 85  KSKSFVKNWDLMWKQNLWTSFIASHLATKHLLSGGLLVLTGAKAALEPTPGM 136

Dihydropteridine reductase is an NAD-binding protein related to the SDRs. It converts dihydrobiopterin into tetrahydrobiopterin, a cofactor necessary in catecholamines synthesis. Dihydropteridine reductase has the YXXXK of these tyrosine-dependent oxidoreductases, but lacks the typical upstream Asn and Ser catalytic residues. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRS are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes have a 3-glycine N-terminal NAD(P)(H)-binding pattern (typically, TGxxxGxG in classical SDRs and TGxxGxxG in extended SDRs), while substrate binding is in the C-terminal region. A critical catalytic Tyr residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering), is often found in a conserved YXXXK pattern. In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) or additional Ser, contributing to the active site. Substrates for these enzymes include sugars, steroids, alcohols, and aromatic compounds. The standard reaction mechanism is a proton relay involving the conserved Tyr and Lys, as well as Asn (or Ser). Some SDR family members, including 17 beta-hydroxysteroid dehydrogenase contain an additional helix-turn-helix motif that is not generally found among SDRs. Length = 221

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 123
KOG4022|consensus236 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.62
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.52
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 99.47
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 99.46
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.44
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.43
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.43
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.43
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.41
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 99.41
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 99.41
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 99.41
PRK06398 258 aldose dehydrogenase; Validated 99.4
PRK12747252 short chain dehydrogenase; Provisional 99.39
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.39
PRK06128300 oxidoreductase; Provisional 99.37
PRK07791 286 short chain dehydrogenase; Provisional 99.37
PRK08339263 short chain dehydrogenase; Provisional 99.36
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.35
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.35
KOG1205|consensus 282 99.35
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 99.34
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.34
PRK08589 272 short chain dehydrogenase; Validated 99.33
PRK07985294 oxidoreductase; Provisional 99.32
PRK05872 296 short chain dehydrogenase; Provisional 99.32
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.3
PRK06484520 short chain dehydrogenase; Validated 99.3
PRK07063260 short chain dehydrogenase; Provisional 99.3
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.28
PRK07062265 short chain dehydrogenase; Provisional 99.28
PRK06483236 dihydromonapterin reductase; Provisional 99.27
PRK07677252 short chain dehydrogenase; Provisional 99.26
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.26
PRK12937245 short chain dehydrogenase; Provisional 99.26
PRK06139 330 short chain dehydrogenase; Provisional 99.26
PRK06179 270 short chain dehydrogenase; Provisional 99.25
PRK07576264 short chain dehydrogenase; Provisional 99.24
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.23
PRK05876 275 short chain dehydrogenase; Provisional 99.23
PRK07825 273 short chain dehydrogenase; Provisional 99.22
PRK05855 582 short chain dehydrogenase; Validated 99.22
PRK08265 261 short chain dehydrogenase; Provisional 99.21
PRK09242257 tropinone reductase; Provisional 99.21
PRK06523260 short chain dehydrogenase; Provisional 99.21
COG0300265 DltE Short-chain dehydrogenases of various substra 99.2
PRK07856252 short chain dehydrogenase; Provisional 99.2
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.2
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.19
PRK07478254 short chain dehydrogenase; Provisional 99.18
PRK07578199 short chain dehydrogenase; Provisional 99.18
PRK06194 287 hypothetical protein; Provisional 99.18
PRK08278 273 short chain dehydrogenase; Provisional 99.18
PRK08643256 acetoin reductase; Validated 99.17
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.17
PRK12743256 oxidoreductase; Provisional 99.17
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.16
PRK05867253 short chain dehydrogenase; Provisional 99.16
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.16
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.16
PRK06500249 short chain dehydrogenase; Provisional 99.16
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.16
PRK06172253 short chain dehydrogenase; Provisional 99.15
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.15
PRK06484 520 short chain dehydrogenase; Validated 99.15
PRK06180 277 short chain dehydrogenase; Provisional 99.15
PRK07831262 short chain dehydrogenase; Provisional 99.15
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.15
PRK08263 275 short chain dehydrogenase; Provisional 99.15
PRK07109 334 short chain dehydrogenase; Provisional 99.15
PRK07814263 short chain dehydrogenase; Provisional 99.14
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.14
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.14
PRK08936261 glucose-1-dehydrogenase; Provisional 99.14
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.14
PRK06701290 short chain dehydrogenase; Provisional 99.14
PRK05650 270 short chain dehydrogenase; Provisional 99.13
PRK05693 274 short chain dehydrogenase; Provisional 99.13
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.13
PRK05717255 oxidoreductase; Validated 99.13
PRK07067257 sorbitol dehydrogenase; Provisional 99.13
PRK08303 305 short chain dehydrogenase; Provisional 99.12
PRK07832 272 short chain dehydrogenase; Provisional 99.12
PRK06182 273 short chain dehydrogenase; Validated 99.12
PRK12744257 short chain dehydrogenase; Provisional 99.12
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.12
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.11
PRK05599246 hypothetical protein; Provisional 99.11
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.1
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.1
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.1
KOG0725|consensus270 99.1
PRK07069251 short chain dehydrogenase; Validated 99.1
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.1
PRK08277278 D-mannonate oxidoreductase; Provisional 99.1
PRK06114254 short chain dehydrogenase; Provisional 99.09
PRK06841255 short chain dehydrogenase; Provisional 99.09
PRK08340259 glucose-1-dehydrogenase; Provisional 99.09
PRK09134258 short chain dehydrogenase; Provisional 99.09
PRK12746254 short chain dehydrogenase; Provisional 99.09
PRK05993 277 short chain dehydrogenase; Provisional 99.09
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.09
PLN02253 280 xanthoxin dehydrogenase 99.08
PRK07024257 short chain dehydrogenase; Provisional 99.08
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.07
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.07
PRK07890258 short chain dehydrogenase; Provisional 99.07
PRK06482 276 short chain dehydrogenase; Provisional 99.07
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.07
COG1028251 FabG Dehydrogenases with different specificities ( 99.06
PRK08628258 short chain dehydrogenase; Provisional 99.06
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.06
PRK07035252 short chain dehydrogenase; Provisional 99.06
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.06
PRK08703239 short chain dehydrogenase; Provisional 99.06
PRK06123248 short chain dehydrogenase; Provisional 99.05
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.05
PRK12742237 oxidoreductase; Provisional 99.05
PRK10538248 malonic semialdehyde reductase; Provisional 99.04
PRK08862227 short chain dehydrogenase; Provisional 99.03
PRK06125259 short chain dehydrogenase; Provisional 99.03
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.03
PRK08267 260 short chain dehydrogenase; Provisional 99.02
PLN00015 308 protochlorophyllide reductase 99.02
PRK06198260 short chain dehydrogenase; Provisional 99.01
PRK06949258 short chain dehydrogenase; Provisional 99.0
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.0
PRK07454241 short chain dehydrogenase; Provisional 99.0
PLN02780 320 ketoreductase/ oxidoreductase 98.97
PRK12939250 short chain dehydrogenase; Provisional 98.96
PRK05884223 short chain dehydrogenase; Provisional 98.96
PRK08226263 short chain dehydrogenase; Provisional 98.95
KOG1610|consensus 322 98.95
PRK05875 276 short chain dehydrogenase; Provisional 98.95
PRK06947248 glucose-1-dehydrogenase; Provisional 98.95
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 98.95
PRK06914 280 short chain dehydrogenase; Provisional 98.94
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 98.93
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 98.93
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 98.93
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 98.93
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 98.93
PRK06181 263 short chain dehydrogenase; Provisional 98.93
KOG1210|consensus 331 98.93
PRK05866293 short chain dehydrogenase; Provisional 98.92
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.92
PRK07041230 short chain dehydrogenase; Provisional 98.91
PRK06138252 short chain dehydrogenase; Provisional 98.9
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.9
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 98.9
KOG1201|consensus 300 98.9
PRK06057255 short chain dehydrogenase; Provisional 98.89
PRK07023243 short chain dehydrogenase; Provisional 98.89
PRK08324 681 short chain dehydrogenase; Validated 98.88
KOG1204|consensus253 98.87
PRK09072 263 short chain dehydrogenase; Provisional 98.87
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 98.87
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 98.87
PRK07577234 short chain dehydrogenase; Provisional 98.86
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 98.86
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.85
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.85
PRK07326237 short chain dehydrogenase; Provisional 98.84
PRK07201 657 short chain dehydrogenase; Provisional 98.84
PRK12829264 short chain dehydrogenase; Provisional 98.84
PRK07775 274 short chain dehydrogenase; Provisional 98.84
PRK12828239 short chain dehydrogenase; Provisional 98.83
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.83
PRK09135249 pteridine reductase; Provisional 98.82
PRK06940 275 short chain dehydrogenase; Provisional 98.82
PRK06101240 short chain dehydrogenase; Provisional 98.81
PRK08251248 short chain dehydrogenase; Provisional 98.81
PRK09186256 flagellin modification protein A; Provisional 98.77
PRK07774250 short chain dehydrogenase; Provisional 98.77
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 98.77
PRK08213259 gluconate 5-dehydrogenase; Provisional 98.76
PRK05854 313 short chain dehydrogenase; Provisional 98.76
PRK07102243 short chain dehydrogenase; Provisional 98.76
PRK12827249 short chain dehydrogenase; Provisional 98.76
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.76
PRK09009235 C factor cell-cell signaling protein; Provisional 98.75
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 98.74
PRK07060245 short chain dehydrogenase; Provisional 98.74
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.74
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.71
PRK07453 322 protochlorophyllide oxidoreductase; Validated 98.7
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 98.7
PRK06924251 short chain dehydrogenase; Provisional 98.7
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.67
PRK12367245 short chain dehydrogenase; Provisional 98.67
PRK07904253 short chain dehydrogenase; Provisional 98.67
PRK09291 257 short chain dehydrogenase; Provisional 98.64
KOG4169|consensus 261 98.63
PRK06196 315 oxidoreductase; Provisional 98.62
PRK08264238 short chain dehydrogenase; Validated 98.6
PRK06197 306 short chain dehydrogenase; Provisional 98.59
PRK08017 256 oxidoreductase; Provisional 98.59
PRK06953222 short chain dehydrogenase; Provisional 98.59
PRK08219227 short chain dehydrogenase; Provisional 98.58
smart00822180 PKS_KR This enzymatic domain is part of bacterial 98.56
PRK07074 257 short chain dehydrogenase; Provisional 98.49
PRK08177225 short chain dehydrogenase; Provisional 98.45
KOG1200|consensus256 98.4
KOG1209|consensus 289 98.35
PRK07424406 bifunctional sterol desaturase/short chain dehydro 98.32
PRK07806248 short chain dehydrogenase; Provisional 98.31
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 98.22
PRK06720169 hypothetical protein; Provisional 98.04
KOG1611|consensus249 97.99
KOG1014|consensus 312 97.94
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 97.93
KOG1199|consensus260 97.85
COG0623259 FabI Enoyl-[acyl-carrier-protein] 97.53
KOG1207|consensus245 97.5
KOG1208|consensus 314 97.31
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 97.13
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 96.71
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 96.09
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 95.72
PLN02653 340 GDP-mannose 4,6-dehydratase 95.63
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 95.18
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 95.16
PLN00198 338 anthocyanidin reductase; Provisional 95.05
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 94.88
PLN03209 576 translocon at the inner envelope of chloroplast su 94.5
PLN02583 297 cinnamoyl-CoA reductase 93.47
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 93.28
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 93.11
PLN02214 342 cinnamoyl-CoA reductase 92.96
PLN02572 442 UDP-sulfoquinovose synthase 92.77
PRK10675 338 UDP-galactose-4-epimerase; Provisional 92.67
PLN02240 352 UDP-glucose 4-epimerase 92.29
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 91.63
PLN02896 353 cinnamyl-alcohol dehydrogenase 91.58
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 91.09
PLN02650 351 dihydroflavonol-4-reductase 91.03
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 90.51
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 89.65
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 89.28
PF01073 280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 87.81
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 85.7
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 85.39
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 82.54
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 82.54
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 81.51
>KOG4022|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.9e-39  Score=250.77  Aligned_cols=122  Identities=57%  Similarity=0.983  Sum_probs=118.2

Q ss_pred             CEEeeeCCCCcCCCCceEEcCCCCHHHHHHHHHHHHHHHhcCCccceEeeeccCCCCCCcCccchHHHHHHHHHhhHhHH
Q psy5126           1 WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSS   80 (123)
Q Consensus         1 ~v~siD~~~N~~a~~nv~~~~~~s~~eq~~~~~~~v~~~lg~~~lDalvnvAGGfa~g~~~~~~~~~~~d~M~~~Nv~ts   80 (123)
                      ||.|||+.+||+||.||+|+.+.||+||++.+++++.+.|+++|+|+++||||||+||++++++.+++.|.||+|++||+
T Consensus        29 wV~siDl~eNe~Ad~sI~V~~~~swtEQe~~v~~~vg~sL~gekvDav~CVAGGWAGGnAksKdl~KNaDLMwKQSvwtS  108 (236)
T KOG4022|consen   29 WVLSIDLSENEQADSSILVDGNKSWTEQEQSVLEQVGSSLQGEKVDAVFCVAGGWAGGNAKSKDLVKNADLMWKQSVWTS  108 (236)
T ss_pred             EEEEEeecccccccceEEecCCcchhHHHHHHHHHHHHhhcccccceEEEeeccccCCCcchhhhhhchhhHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhhcccCCceEEeeccccccCCCCCchhhhhh-hhcc
Q psy5126          81 VLAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTI-IFSH  122 (123)
Q Consensus        81 ~~~~~~a~p~L~~~G~iv~vGA~aAl~~~~gM~aY~a~-~~~~  122 (123)
                      .+++|+|..|||+||++.++||++|+.|+|||++|+-+ --||
T Consensus       109 aIsa~lAt~HLK~GGLL~LtGAkaAl~gTPgMIGYGMAKaAVH  151 (236)
T KOG4022|consen  109 AISAKLATTHLKPGGLLQLTGAKAALGGTPGMIGYGMAKAAVH  151 (236)
T ss_pred             HHHHHHHHhccCCCceeeecccccccCCCCcccchhHHHHHHH
Confidence            99999999999999999999999999999999999876 4444

>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1ooe_A236 Structural Genomics Of Caenorhabditis Elegans : Dih 2e-25
1hdr_A244 The Crystallographic Structure Of A Human Dihydropt 3e-24
1dir_A241 Crystal Structure Of A Monoclinic Form Of Dihydropt 4e-24
3orf_A251 Crystal Structure Of Dihydropteridine Reductase Fro 8e-06
>pdb|1OOE|A Chain A, Structural Genomics Of Caenorhabditis Elegans : Dihydropteridine Reductase Length = 236 Back     alignment and structure 
Iteration: 1

 Score =  110 bits (275), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 53/109 (48%), Positives = 72/109 (66%)
Query: 4   SIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVXXXXXXXXXXXK 63
           +IDL+ NDQAD+NI+V+ +  W EQE ++L +  + L G ++D V CV           K
Sbjct: 32  NIDLSANDQADSNILVDGNKNWTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSASSK 91
Query: 64  DFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGM 112
           DFVK+AD+M +QSVWSS +AA +A  HLKPGGL+ L GA  A+  TP M
Sbjct: 92  DFVKNADLMIKQSVWSSAIAAKLATTHLKPGGLLQLTGAAAAMGPTPSM 140
>pdb|1HDR|A Chain A, The Crystallographic Structure Of A Human Dihydropteridine Reductase Nadh Binary Complex Expressed In Escherichia Coli By A Cdna Constructed From Its Rat Homologue Length = 244 Back     alignment and structure
>pdb|1DIR|A Chain A, Crystal Structure Of A Monoclinic Form Of Dihydropteridine Reductase From Rat Liver Length = 241 Back     alignment and structure
>pdb|3ORF|A Chain A, Crystal Structure Of Dihydropteridine Reductase From Dictyostelium Discoideum Length = 251 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query123
1ooe_A236 Dihydropteridine reductase; structural genomics, P 9e-22
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 6e-20
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 2e-17
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
 Score = 85.0 bits (211), Expect = 9e-22
 Identities = 62/112 (55%), Positives = 84/112 (75%)

Query: 1   WVGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNA 60
            V +IDL+ NDQAD+NI+V+ +  W EQE ++L +  + L G ++D V CVAGGWAGG+A
Sbjct: 29  TVLNIDLSANDQADSNILVDGNKNWTEQEQSILEQTASSLQGSQVDGVFCVAGGWAGGSA 88

Query: 61  AAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLVSLPGAKPALEGTPGM 112
           ++KDFVK+AD+M +QSVWSS +AA +A  HLKPGGL+ L GA  A+  TP M
Sbjct: 89  SSKDFVKNADLMIKQSVWSSAIAAKLATTHLKPGGLLQLTGAAAAMGPTPSM 140
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 99.71
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 99.69
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.68
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 99.66
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 99.66
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 99.62
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 99.57
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.55
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.54
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.53
4eso_A255 Putative oxidoreductase; NADP, structural genomics 99.52
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.52
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.52
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.52
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 99.52
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.51
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.51
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.5
4e4y_A244 Short chain dehydrogenase family protein; structur 99.5
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.5
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 99.5
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.5
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 99.5
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.49
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.49
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.49
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.49
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.49
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.48
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 99.48
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.48
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 99.48
4dqx_A277 Probable oxidoreductase protein; structural genomi 99.48
3imf_A257 Short chain dehydrogenase; structural genomics, in 99.48
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 99.48
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.47
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 99.47
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 99.47
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.47
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.47
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.47
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 99.47
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.47
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.47
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.47
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 99.46
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.46
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.46
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 99.46
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.46
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 99.46
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 99.45
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.45
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.45
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 99.44
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.44
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.44
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.44
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 99.44
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 99.44
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.44
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 99.44
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.44
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.44
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.44
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.44
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 99.43
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 99.43
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.43
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.43
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 99.43
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.43
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.43
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.43
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 99.43
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 99.43
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.42
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.42
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.42
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.41
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.41
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 99.41
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.41
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.41
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.41
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.41
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.41
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 99.41
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.4
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.4
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.4
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.4
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.4
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.4
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 99.4
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.4
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.4
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.4
3rih_A293 Short chain dehydrogenase or reductase; structural 99.4
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 99.4
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.4
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.4
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.39
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.39
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.39
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.39
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.39
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.39
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.39
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 99.39
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.39
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.38
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 99.38
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.38
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.38
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.38
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.38
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.37
1xhl_A 297 Short-chain dehydrogenase/reductase family member 99.37
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.37
1spx_A 278 Short-chain reductase family member (5L265); paral 99.37
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.37
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 99.37
3cxt_A291 Dehydrogenase with different specificities; rossma 99.37
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.37
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 99.37
1xkq_A 280 Short-chain reductase family member (5D234); parra 99.36
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.36
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.36
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.36
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.36
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.36
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.36
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 99.36
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.36
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 99.35
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.35
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.35
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.35
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.34
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.34
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.34
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.34
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.33
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.33
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.33
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.33
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.33
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.33
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 99.33
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.32
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 99.32
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.32
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 99.32
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.31
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.31
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.31
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.31
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.31
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.3
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.3
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.3
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.28
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.27
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.26
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.26
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.26
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.26
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.26
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.26
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.25
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.25
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.25
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.25
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.23
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.22
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.22
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.21
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.2
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.2
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.2
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.2
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.19
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.19
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 99.18
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.18
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.18
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.18
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.18
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.17
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.17
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.17
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.17
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.17
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.17
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.16
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.16
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.16
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.16
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.15
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.13
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.13
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.12
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.11
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.11
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.07
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.03
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.03
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 98.98
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 98.97
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 98.92
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 98.84
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 98.73
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 98.72
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 98.69
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 98.66
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 98.63
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 98.6
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 98.53
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 98.52
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 98.52
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 98.46
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 98.42
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 98.29
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 98.16
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.74
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 97.72
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 97.7
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 97.65
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 97.63
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 97.6
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 97.58
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 97.48
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 97.43
1xq6_A253 Unknown protein; structural genomics, protein stru 97.42
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 97.28
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 97.26
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 97.25
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 97.19
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 97.14
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 97.09
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 97.09
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 97.06
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 97.05
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 97.04
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 97.04
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 97.03
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 96.96
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 96.93
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 96.9
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 96.88
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 96.88
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 96.86
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 96.86
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 96.82
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 96.81
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.69
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 96.68
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 96.58
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 96.56
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 96.56
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.55
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 96.54
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 96.54
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 96.54
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 96.51
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.44
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 96.41
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 96.3
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 96.26
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 96.25
4f6c_A 427 AUSA reductase domain protein; thioester reductase 96.2
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.19
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.17
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 96.14
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 96.13
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 96.12
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 96.08
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 96.08
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 95.99
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 95.96
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 95.87
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 95.85
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 95.64
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.48
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 95.27
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 95.0
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 94.69
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 94.61
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 94.37
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 94.16
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 93.87
3gpi_A 286 NAD-dependent epimerase/dehydratase; structural ge 93.79
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.67
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 93.66
4f6l_B 508 AUSA reductase domain protein; thioester reductase 92.61
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 90.54
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 90.48
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 90.36
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 89.07
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 88.98
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 88.96
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 86.77
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 84.65
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 84.17
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 83.15
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 82.45
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 82.18
3krt_A456 Crotonyl COA reductase; structural genomics, prote 81.78
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 80.46
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 80.16
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
Probab=99.71  E-value=3.1e-17  Score=130.85  Aligned_cols=98  Identities=20%  Similarity=0.205  Sum_probs=89.3

Q ss_pred             EEcCCCCHHHHHHHHHHHHHHHhcCCccceEeeeccCCCCCCcCccchHHHHHHHHHhhHhHHHHHHHHhhhcccCCceE
Q psy5126          18 IVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSVLAATIAANHLKPGGLV   97 (123)
Q Consensus        18 ~~~~~~s~~eq~~~~~~~v~~~lg~~~lDalvnvAGGfa~g~~~~~~~~~~~d~M~~~Nv~ts~~~~~~a~p~L~~~G~i   97 (123)
                      .+.-|-+-.++.+++++.+.++||  +||.|||.||+...+++ ++...++|+++++.|+++.|.++|+++|+|+++|+|
T Consensus        79 ~~~~Dv~~~~~v~~~~~~~~~~~G--~iDiLVNNAG~~~~~~~-~~~~~e~w~~~~~vNl~g~~~~~~~~~p~m~~~G~I  155 (273)
T 4fgs_A           79 GIQADSANLAELDRLYEKVKAEAG--RIDVLFVNAGGGSMLPL-GEVTEEQYDDTFDRNVKGVLFTVQKALPLLARGSSV  155 (273)
T ss_dssp             EEECCTTCHHHHHHHHHHHHHHHS--CEEEEEECCCCCCCCCT-TSCCHHHHHHHHHHHTHHHHHHHHHHTTTEEEEEEE
T ss_pred             EEEecCCCHHHHHHHHHHHHHHcC--CCCEEEECCCCCCCCCh-hhccHHHHHHHHHHHhHHHHHHHHHHHHHHhhCCeE
Confidence            344455567788888898999999  79999999999998887 677899999999999999999999999999999999


Q ss_pred             EeeccccccCCCCCchhhhhh
Q psy5126          98 SLPGAKPALEGTPGMYLPMTI  118 (123)
Q Consensus        98 v~vGA~aAl~~~~gM~aY~a~  118 (123)
                      ||+++.++..|.|++.+|+++
T Consensus       156 InisS~~~~~~~~~~~~Y~as  176 (273)
T 4fgs_A          156 VLTGSTAGSTGTPAFSVYAAS  176 (273)
T ss_dssp             EEECCGGGGSCCTTCHHHHHH
T ss_pred             EEEeehhhccCCCCchHHHHH
Confidence            999999999999999999987
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query123
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.87
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.86
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 99.67
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 99.66
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 99.66
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 99.66
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 99.65
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 99.65
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 99.64
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 99.63
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 99.63
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 99.62
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.62
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 99.61
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 99.61
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 99.6
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 99.6
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 99.59
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 99.59
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 99.58
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 99.58
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 99.58
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 99.57
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 99.57
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 99.56
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 99.56
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 99.55
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 99.54
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 99.49
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 99.49
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 99.48
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 99.48
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.47
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 99.46
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 99.46
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.45
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 99.45
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 99.44
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 99.43
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 99.42
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 99.41
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 99.41
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.41
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.41
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 99.4
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 99.38
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 99.38
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 99.37
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 99.35
d1uh5a_ 329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.33
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.3
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 99.3
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 99.29
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 99.23
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.14
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.13
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.07
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 98.95
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 98.78
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 98.77
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 98.69
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 98.64
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 98.55
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 98.22
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 98.19
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 95.1
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 88.63
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 87.64
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 84.96
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 82.44
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 81.8
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 81.08
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Dihydropteridin reductase (pteridine reductase)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.87  E-value=3.3e-22  Score=151.63  Aligned_cols=117  Identities=49%  Similarity=0.872  Sum_probs=110.8

Q ss_pred             EEeeeCCCCcCCCCceEEcCCCCHHHHHHHHHHHHHHHhcCCccceEeeeccCCCCCCcCccchHHHHHHHHHhhHhHHH
Q psy5126           2 VGSIDLNPNDQADANIIVNKDDAWLEQETTVLAELKTILAGDKIDAVICVAGGWAGGNAAAKDFVKSADIMWRQSVWSSV   81 (123)
Q Consensus         2 v~siD~~~N~~a~~nv~~~~~~s~~eq~~~~~~~v~~~lg~~~lDalvnvAGGfa~g~~~~~~~~~~~d~M~~~Nv~ts~   81 (123)
                      |+.+|..++++++.++.++.+.+..++.+.+.+.+.+.++..++|.|||.||+|.+++..++...++||++++.|+++.+
T Consensus        29 V~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~iD~lInnAG~~~~~~~~~~~~~~~~~~~~~~n~~~~~  108 (236)
T d1dhra_          29 VASIDVVENEEASASVIVKMTDSFTEQADQVTAEVGKLLGDQKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTST  108 (236)
T ss_dssp             EEEEESSCCTTSSEEEECCCCSCHHHHHHHHHHHHHHHHTTCCEEEEEECCCCCCCBCTTCTTHHHHHHHHHHHHHHHHH
T ss_pred             EEEEeCCccccccccceeecccCcHHHHHHHHHHHHHHhCCCCceEEEECCcccccccchhcCCHHHHHHHHHHcchHHH
Confidence            67899999999999999988888999999999999999987789999999999999887788889999999999999999


Q ss_pred             HHHHHhhhcccCCceEEeeccccccCCCCCchhhhhh
Q psy5126          82 LAATIAANHLKPGGLVSLPGAKPALEGTPGMYLPMTI  118 (123)
Q Consensus        82 ~~~~~a~p~L~~~G~iv~vGA~aAl~~~~gM~aY~a~  118 (123)
                      +++|+++|+|+++|+||++|+.++..|.|+..+|+++
T Consensus       109 ~~~~~~~~~m~~~G~Iv~isS~~~~~~~~~~~~Y~as  145 (236)
T d1dhra_         109 ISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMA  145 (236)
T ss_dssp             HHHHHHHHHEEEEEEEEEECCGGGGSCCTTBHHHHHH
T ss_pred             HHHHHHHHhcccccceeEEccHHHcCCccCCcccHHH
Confidence            9999999999999999999999999999999999987
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure