Psyllid ID: psy5367
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| 121543925 | 246 | putative 14-3-3 protein [Maconellicoccus | 0.492 | 0.402 | 0.969 | 7e-47 | |
| 263173434 | 247 | multifunctional chaperone [Cimex lectula | 0.492 | 0.400 | 0.959 | 8e-47 | |
| 365266881 | 247 | 14-3-3 zeta [Atta cephalotes] | 0.562 | 0.457 | 0.831 | 2e-46 | |
| 365266882 | 247 | 14-3-3 zeta [Atta cephalotes] | 0.562 | 0.457 | 0.831 | 2e-46 | |
| 365266851 | 247 | 14-3-3 zeta [Bombus terrestris] gi|36526 | 0.492 | 0.400 | 0.959 | 2e-46 | |
| 365266859 | 247 | 14-3-3 zeta [Apis florea] | 0.492 | 0.400 | 0.959 | 2e-46 | |
| 380017736 | 247 | PREDICTED: 14-3-3 protein zeta-like isof | 0.492 | 0.400 | 0.959 | 3e-46 | |
| 365266852 | 247 | 14-3-3 zeta [Bombus terrestris] gi|36526 | 0.492 | 0.400 | 0.959 | 3e-46 | |
| 365266850 | 247 | 14-3-3 zeta [Bombus terrestris] gi|36526 | 0.492 | 0.400 | 0.959 | 3e-46 | |
| 345479702 | 262 | PREDICTED: 14-3-3 protein zeta-like [Nas | 0.492 | 0.377 | 0.949 | 3e-46 |
| >gi|121543925|gb|ABM55627.1| putative 14-3-3 protein [Maconellicoccus hirsutus] | Back alignment and taxonomy information |
|---|
Score = 192 bits (488), Expect = 7e-47, Method: Compositional matrix adjust.
Identities = 96/99 (96%), Positives = 98/99 (98%)
Query: 4 SGEKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSW 63
S +KEELVQRAKLAEQAERYDDMA+AMKAVTETGVELSNEERNLLSVAYKNVVGARRSSW
Sbjct: 2 SVDKEELVQRAKLAEQAERYDDMASAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSW 61
Query: 64 RVISSIEQKTEGSERKQQMAREYREKVEKELRDICYDVL 102
RVISSIEQKTEGSERKQQMAREYREKVEKELRDICYDVL
Sbjct: 62 RVISSIEQKTEGSERKQQMAREYREKVEKELRDICYDVL 100
|
Source: Maconellicoccus hirsutus Species: Maconellicoccus hirsutus Genus: Maconellicoccus Family: Pseudococcidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|263173434|gb|ACY69941.1| multifunctional chaperone [Cimex lectularius] | Back alignment and taxonomy information |
|---|
| >gi|365266881|gb|AEW70354.1| 14-3-3 zeta [Atta cephalotes] | Back alignment and taxonomy information |
|---|
| >gi|365266882|gb|AEW70355.1| 14-3-3 zeta [Atta cephalotes] | Back alignment and taxonomy information |
|---|
| >gi|365266851|gb|AEW70333.1| 14-3-3 zeta [Bombus terrestris] gi|365266855|gb|AEW70336.1| 14-3-3 zeta [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|365266859|gb|AEW70339.1| 14-3-3 zeta [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|380017736|ref|XP_003692803.1| PREDICTED: 14-3-3 protein zeta-like isoform 1 [Apis florea] gi|380017738|ref|XP_003692804.1| PREDICTED: 14-3-3 protein zeta-like isoform 2 [Apis florea] gi|365266858|gb|AEW70338.1| 14-3-3 zeta [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|365266852|gb|AEW70334.1| 14-3-3 zeta [Bombus terrestris] gi|365266856|gb|AEW70337.1| 14-3-3 zeta [Bombus impatiens] gi|365266860|gb|AEW70340.1| 14-3-3 zeta [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|365266850|gb|AEW70332.1| 14-3-3 zeta [Bombus terrestris] gi|365266854|gb|AEW70335.1| 14-3-3 zeta [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345479702|ref|XP_001600046.2| PREDICTED: 14-3-3 protein zeta-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 201 | ||||||
| FB|FBgn0004907 | 248 | 14-3-3zeta "14-3-3zeta" [Droso | 0.497 | 0.403 | 0.87 | 4.6e-41 | |
| WB|WBGene00001502 | 248 | ftt-2 [Caenorhabditis elegans | 0.492 | 0.399 | 0.898 | 4.6e-41 | |
| UNIPROTKB|Q20655 | 248 | ftt-2 "14-3-3-like protein 2" | 0.492 | 0.399 | 0.898 | 4.6e-41 | |
| ZFIN|ZDB-GENE-040426-2160 | 242 | ywhabb "tyrosine 3-monooxygena | 0.482 | 0.400 | 0.886 | 2e-40 | |
| UNIPROTKB|P63103 | 245 | YWHAZ "14-3-3 protein zeta/del | 0.482 | 0.395 | 0.865 | 5.3e-40 | |
| UNIPROTKB|F1PBL1 | 245 | YWHAZ "Uncharacterized protein | 0.482 | 0.395 | 0.865 | 5.3e-40 | |
| UNIPROTKB|E7ESK7 | 137 | YWHAZ "14-3-3 protein zeta/del | 0.482 | 0.708 | 0.865 | 5.3e-40 | |
| UNIPROTKB|E7EVZ2 | 98 | YWHAZ "14-3-3 protein zeta/del | 0.482 | 0.989 | 0.865 | 5.3e-40 | |
| UNIPROTKB|E7EX29 | 246 | YWHAZ "14-3-3 protein zeta/del | 0.482 | 0.394 | 0.865 | 5.3e-40 | |
| UNIPROTKB|P63104 | 245 | YWHAZ "14-3-3 protein zeta/del | 0.482 | 0.395 | 0.865 | 5.3e-40 |
| FB|FBgn0004907 14-3-3zeta "14-3-3zeta" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 436 (158.5 bits), Expect = 4.6e-41, P = 4.6e-41
Identities = 87/100 (87%), Positives = 96/100 (96%)
Query: 3 SSGEKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSS 62
S+ +KEELVQ+AKLAEQ+ERYDDMA AMK+VTETGVELSNEERNLLSVAYKNVVGARRSS
Sbjct: 2 STVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSS 61
Query: 63 WRVISSIEQKTEGSERKQQMAREYREKVEKELRDICYDVL 102
WRVISSIEQKTE S RKQQ+AREYRE+VEKELR+ICY+VL
Sbjct: 62 WRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVL 101
|
|
| WB|WBGene00001502 ftt-2 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q20655 ftt-2 "14-3-3-like protein 2" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2160 ywhabb "tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63103 YWHAZ "14-3-3 protein zeta/delta" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PBL1 YWHAZ "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7ESK7 YWHAZ "14-3-3 protein zeta/delta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EVZ2 YWHAZ "14-3-3 protein zeta/delta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EX29 YWHAZ "14-3-3 protein zeta/delta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P63104 YWHAZ "14-3-3 protein zeta/delta" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| cd11310 | 230 | cd11310, 14-3-3_1, 14-3-3 protein domain | 9e-60 | |
| pfam00244 | 236 | pfam00244, 14-3-3, 14-3-3 protein | 5e-56 | |
| cd10022 | 229 | cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta is | 1e-55 | |
| cd10023 | 234 | cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in | 2e-51 | |
| cd08774 | 225 | cd08774, 14-3-3, 14-3-3 domain | 1e-49 | |
| cd10024 | 246 | cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of | 3e-41 | |
| cd10020 | 230 | cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isofor | 8e-41 | |
| cd10025 | 239 | cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14- | 1e-40 | |
| cd10019 | 242 | cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of | 4e-39 | |
| COG5040 | 268 | COG5040, BMH1, 14-3-3 family protein [Signal trans | 3e-38 | |
| cd11309 | 231 | cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domai | 5e-37 | |
| smart00101 | 244 | smart00101, 14_3_3, 14-3-3 homologues | 3e-36 | |
| cd10026 | 237 | cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | 3e-35 | |
| smart00557 | 93 | smart00557, IG_FLMN, Filamin-type immunoglobulin d | 9e-17 | |
| pfam00630 | 93 | pfam00630, Filamin, Filamin/ABP280 repeat | 1e-12 |
| >gnl|CDD|206764 cd11310, 14-3-3_1, 14-3-3 protein domain | Back alignment and domain information |
|---|
Score = 186 bits (473), Expect = 9e-60
Identities = 93/97 (95%), Positives = 96/97 (98%)
Query: 6 EKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 65
+KEELVQRAKLAEQAERYDDMAAAMK VTETGVELSNEERNLLSVAYKNVVGARRSSWRV
Sbjct: 1 DKEELVQRAKLAEQAERYDDMAAAMKKVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 60
Query: 66 ISSIEQKTEGSERKQQMAREYREKVEKELRDICYDVL 102
ISSIEQKTEGSERKQQMA+EYREKVEKELR+ICYDVL
Sbjct: 61 ISSIEQKTEGSERKQQMAKEYREKVEKELREICYDVL 97
|
This 14-3-3 domain family includes proteins in Caenorhabditis elegans, the silkworm (Bombyx mori) as well as barley (Hordeum vulgare). In C. elegans, 14-3-3 proteins are SIR-2.1 binding partners which induce transcriptional activation of DAF-16 during stress and are required for the life-span extension conferred by extra copies of sir-2.1. In B. mori, the 14-3-3 proteins are expressed widely in larval and adult tissues, including the brain, fat body, Malpighian tube, silk gland, midgut, testis, ovary, antenna, and pheromone gland, and interact with the N-terminal fragment of Hsp60, suggesting that 14-3-3 (a molecular adaptor) and Hsp60 (a molecular chaperone) work together to achieve a wide range of cellular functions in B. mori. In barley aleurone cells, 14-3-3 proteins and members of the ABF transcription factor family have a regulatory function in the gibberellic acid (GA) pathway since the balance of GA and abscisic acid (ABA) is a determining factor during transition of embryogenesis and seed germination. 14-3-3 is an essential part of 14-3-3 proteins, a ubiquitous class of regulatory, phosphoserine/threonine-binding proteins found in all eukaryotic cells, including yeast, protozoa and mammalian cells. Length = 230 |
| >gnl|CDD|215815 pfam00244, 14-3-3, 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206758 cd10022, 14-3-3_beta_zeta, 14-3-3 beta and zeta isoforms of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206759 cd10023, 14-3-3_theta, 14-3-3 theta/tau (theta in mice, tau in human), an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206755 cd08774, 14-3-3, 14-3-3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|206760 cd10024, 14-3-3_gamma, 14-3-3 gamma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206757 cd10020, 14-3-3_epsilon, 14-3-3 epsilon, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206761 cd10025, 14-3-3_eta, 14-3-3 eta, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|206756 cd10019, 14-3-3_sigma, 14-3-3 sigma, an isoform of 14-3-3 protein | Back alignment and domain information |
|---|
| >gnl|CDD|227373 COG5040, BMH1, 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >gnl|CDD|206763 cd11309, 14-3-3_fungi, Fungal 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|128412 smart00101, 14_3_3, 14-3-3 homologues | Back alignment and domain information |
|---|
| >gnl|CDD|206762 cd10026, 14-3-3_plant, Plant 14-3-3 protein domain | Back alignment and domain information |
|---|
| >gnl|CDD|214720 smart00557, IG_FLMN, Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
| >gnl|CDD|216033 pfam00630, Filamin, Filamin/ABP280 repeat | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| COG5040 | 268 | BMH1 14-3-3 family protein [Signal transduction me | 100.0 | |
| smart00101 | 244 | 14_3_3 14-3-3 homologues. 14-3-3 homologues mediat | 100.0 | |
| KOG0841|consensus | 247 | 100.0 | ||
| PF00244 | 236 | 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 | 100.0 | |
| smart00557 | 93 | IG_FLMN Filamin-type immunoglobulin domains. These | 99.84 | |
| PF00630 | 101 | Filamin: Filamin/ABP280 repeat; InterPro: IPR01786 | 99.78 | |
| KOG0518|consensus | 1113 | 99.75 | ||
| KOG0518|consensus | 1113 | 99.33 | ||
| PF06312 | 219 | Neurexophilin: Neurexophilin | 95.96 | |
| PF01835 | 99 | A2M_N: MG2 domain; InterPro: IPR002890 The protein | 91.27 | |
| PF13620 | 82 | CarboxypepD_reg: Carboxypeptidase regulatory-like | 90.24 | |
| PF02369 | 100 | Big_1: Bacterial Ig-like domain (group 1); InterPr | 90.1 | |
| KOG3287|consensus | 236 | 89.99 | ||
| PF13473 | 104 | Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D | 89.41 | |
| smart00557 | 93 | IG_FLMN Filamin-type immunoglobulin domains. These | 89.06 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 88.52 | |
| PF13115 | 86 | YtkA: YtkA-like | 87.45 | |
| PF13860 | 81 | FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A. | 87.4 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 87.27 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 86.36 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 85.66 | |
| KOG1428|consensus | 3738 | 84.26 | ||
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 83.68 | |
| PF10670 | 215 | DUF4198: Domain of unknown function (DUF4198) | 83.55 | |
| PF06832 | 89 | BiPBP_C: Penicillin-Binding Protein C-terminus Fam | 83.19 | |
| PF07705 | 101 | CARDB: CARDB; InterPro: IPR011635 The APHP (acidic | 82.45 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 82.33 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 81.77 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 81.65 | |
| PF04151 | 70 | PPC: Bacterial pre-peptidase C-terminal domain; In | 81.01 | |
| PF05751 | 146 | FixH: FixH; InterPro: IPR008620 This family consis | 80.84 |
| >COG5040 BMH1 14-3-3 family protein [Signal transduction mechanisms] | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.6e-40 Score=264.07 Aligned_cols=131 Identities=47% Similarity=0.731 Sum_probs=119.9
Q ss_pred cHHHHHHHHHhHHHhccHHHHHHHHHHHHhcCCCCCHHhHhHHHHHhhhhcccchhhHHHHhhHhhhhc--cchHHHHHH
Q psy5367 6 EKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTE--GSERKQQMA 83 (201)
Q Consensus 6 ~r~~~~~~aklae~~ery~dm~~~mk~~~~~~~~L~~eERnLlsvayKn~i~~~R~swR~i~~~e~~~~--~~~~~~~~i 83 (201)
.||+-+|+||||||||||+||++.||.++..+++|++||||||||||||+||+||+|||++++++||++ ++..++.+|
T Consensus 4 ~rE~svylAkLaeqAERYe~MvenMk~vas~~~eLsVeeRNLlSVAYKNvigaRRaSWRivsSieQKeEsk~~~~qv~lI 83 (268)
T COG5040 4 SREDSVYLAKLAEQAERYEEMVENMKLVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKGNTHQVELI 83 (268)
T ss_pred hHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccchhhHHHHHHHHHHHHHHhhhhhhhhhhhhhHHHHHhcCCChhHHHHH
Confidence 599999999999999999999999999999999999999999999999999999999999999999986 557788999
Q ss_pred HHHHHHHHHHHHHhhhhhhhcccccccceEEEecccCCCccceeeCCCCCcceeCCceeEEeecc
Q psy5367 84 REYREKVEKELRDICYDVLKRSQVKGCPLKVLVSAVCDATQVLCSGSGLSVGTLGQDIRSFIDTR 148 (201)
Q Consensus 84 ~~yr~kIe~EL~~iC~eil~l~~i~gSPf~v~v~~~~Daskv~~~G~GL~~~~vg~~~~f~Vdt~ 148 (201)
++||++||.||..||++||+.+.. ++.+....-.+||+.+. |++++++++..-
T Consensus 84 ~eyrkkiE~EL~~icddiL~vl~~-----hlipaa~~~EskvFyyK-------MKGDYyRYlAEf 136 (268)
T COG5040 84 KEYRKKIETELTKICDDILSVLEK-----HLIPAATTGESKVFYYK-------MKGDYYRYLAEF 136 (268)
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHH-----hcccccccccceEEEEe-------ecchHHHHHHHh
Confidence 999999999999999999999876 45566667789999998 888887776554
|
|
| >smart00101 14_3_3 14-3-3 homologues | Back alignment and domain information |
|---|
| >KOG0841|consensus | Back alignment and domain information |
|---|
| >PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] | Back alignment and domain information |
|---|
| >smart00557 IG_FLMN Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
| >PF00630 Filamin: Filamin/ABP280 repeat; InterPro: IPR017868 The many different actin cross-linking proteins share a common architecture, consisting of a globular actin-binding domain and an extended rod | Back alignment and domain information |
|---|
| >KOG0518|consensus | Back alignment and domain information |
|---|
| >KOG0518|consensus | Back alignment and domain information |
|---|
| >PF06312 Neurexophilin: Neurexophilin | Back alignment and domain information |
|---|
| >PF01835 A2M_N: MG2 domain; InterPro: IPR002890 The proteinase-binding alpha-macroglobulins (A2M) [] are large glycoproteins found in the plasma of vertebrates, in the hemolymph of some invertebrates and in reptilian and avian egg white | Back alignment and domain information |
|---|
| >PF13620 CarboxypepD_reg: Carboxypeptidase regulatory-like domain; PDB: 3MN8_D 3P0D_I 3KCP_A 2B59_B 1UWY_A 1H8L_A 1QMU_A 2NSM_A | Back alignment and domain information |
|---|
| >PF02369 Big_1: Bacterial Ig-like domain (group 1); InterPro: IPR003344 Proteins that contain this domain are found in a variety of bacterial and phage surface proteins such as intimins | Back alignment and domain information |
|---|
| >KOG3287|consensus | Back alignment and domain information |
|---|
| >PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D | Back alignment and domain information |
|---|
| >smart00557 IG_FLMN Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13115 YtkA: YtkA-like | Back alignment and domain information |
|---|
| >PF13860 FlgD_ig: FlgD Ig-like domain; PDB: 3C12_A 3OSV_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >KOG1428|consensus | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >PF10670 DUF4198: Domain of unknown function (DUF4198) | Back alignment and domain information |
|---|
| >PF06832 BiPBP_C: Penicillin-Binding Protein C-terminus Family; InterPro: IPR009647 This conserved region of approximately 90 residues is found in a sub-group of bacterial Penicillin-Binding Proteins (PBPs) | Back alignment and domain information |
|---|
| >PF07705 CARDB: CARDB; InterPro: IPR011635 The APHP (acidic peptide-dependent hydrolases/peptidase) domain is found in a variety of different proteins | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >PF04151 PPC: Bacterial pre-peptidase C-terminal domain; InterPro: IPR007280 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF05751 FixH: FixH; InterPro: IPR008620 This family consists of several Rhizobium FixH like proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 201 | ||||
| 4fj3_A | 235 | 14-3-3 Isoform Zeta In Complex With A Diphoyphoryla | 6e-44 | ||
| 2v7d_A | 247 | 14-3-3 Protein Zeta In Complex With Thr758 Phosphor | 7e-44 | ||
| 2o02_A | 230 | Phosphorylation Independent Interactions Between 14 | 9e-44 | ||
| 3rdh_A | 248 | X-Ray Induced Covalent Inhibition Of 14-3-3 Length | 9e-44 | ||
| 2c1j_A | 258 | Molecular Basis For The Recognition Of Phosphorylat | 1e-43 | ||
| 1a38_A | 245 | 14-3-3 Protein Zeta Bound To R18 Peptide Length = 2 | 1e-43 | ||
| 4gnt_A | 245 | Complex Of Chrebp And 14-3-3beta Length = 245 | 2e-42 | ||
| 2bq0_A | 245 | 14-3-3 Protein Beta (Human) Length = 245 | 2e-42 | ||
| 2btp_A | 256 | 14-3-3 Protein Theta (Human) Complexed To Peptide L | 5e-38 | ||
| 4dnk_A | 247 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 8e-37 | ||
| 3uzd_A | 248 | Crystal Structure Of 14-3-3 Gamma Length = 248 | 3e-36 | ||
| 2c63_A | 247 | 14-3-3 Protein Eta (Human) Complexed To Peptide Len | 3e-36 | ||
| 2b05_A | 246 | Crystal Structure Of 14-3-3 Gamma In Complex With A | 3e-36 | ||
| 4e2e_A | 248 | Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYP | 1e-33 | ||
| 3p1p_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38nN166H I | 3e-31 | ||
| 3ubw_A | 261 | Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphope | 1e-30 | ||
| 3lw1_A | 253 | Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptid | 2e-30 | ||
| 3u9x_A | 235 | Covalent Attachment Of Pyridoxal-Phosphate Derivati | 2e-30 | ||
| 3iqj_A | 236 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 2e-30 | ||
| 3p1n_A | 235 | Crystal Structure Of Human 14-3-3 Sigma In Complex | 2e-30 | ||
| 3smo_A | 235 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 4e-30 | ||
| 3p1r_A | 236 | Crystal Structure Of Human 14-3-3 Sigma C38vN166H I | 4e-30 | ||
| 4hqw_A | 236 | Molecular Tweezers Modulate 14-3-3 Protein-protein | 6e-30 | ||
| 3o8i_A | 239 | Structure Of 14-3-3 Isoform Sigma In Complex With A | 6e-30 | ||
| 4dat_A | 234 | Structure Of 14-3-3 Sigma In Complex With Padi6 14- | 7e-30 | ||
| 3t0l_A | 235 | Small-Molecule Inhibitors Of 14-3-3 Protein-Protein | 8e-30 | ||
| 2br9_A | 234 | 14-3-3 Protein Epsilon (Human) Complexed To Peptide | 9e-30 | ||
| 1ywt_A | 248 | Crystal Structure Of The Human Sigma Isoform Of 14- | 1e-29 | ||
| 3ual_A | 232 | Crystal Structure Of 14-3-3 Epsilon With Mlf1 Pepti | 2e-29 | ||
| 2o98_A | 242 | Structure Of The 14-3-3 H+-Atpase Plant Complex Len | 5e-25 | ||
| 3m50_A | 240 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY E | 6e-25 | ||
| 1o9c_A | 260 | Structural View Of A Fungal Toxin Acting On A 14-3- | 7e-25 | ||
| 2npm_A | 260 | Crystal Structure Of Cryptosporidium Parvum 14-3-3 | 9e-25 | ||
| 3axy_C | 240 | Structure Of Florigen Activation Complex Consisting | 1e-23 | ||
| 4dx0_A | 243 | Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A | 6e-23 | ||
| 2k7q_A | 191 | Filamin A Ig-Like Domains 18-19 Length = 191 | 2e-07 | ||
| 2dj4_A | 108 | Solution Structure Of The 13th Filamin Domain From | 7e-07 | ||
| 2d7m_A | 115 | Solution Structure Of The 14th Filamin Domain From | 1e-06 | ||
| 2j3s_A | 288 | Crystal Structure Of The Human Filamin A Ig Domains | 3e-06 | ||
| 2e9j_A | 119 | Solution Structure Of The 14th Filamin Domain From | 2e-05 | ||
| 2dia_A | 113 | Solution Structure Of The 10th Filamin Domain From | 4e-05 | ||
| 3rgh_A | 100 | Structure Of Filamin A Immunoglobulin-Like Repeat 1 | 5e-05 | ||
| 2k7p_A | 188 | Filamin A Ig-Like Domains 16-17 Length = 188 | 2e-04 |
| >pdb|4FJ3|A Chain A, 14-3-3 Isoform Zeta In Complex With A Diphoyphorylated C-Raf Peptide Length = 235 | Back alignment and structure |
|
| >pdb|2V7D|A Chain A, 14-3-3 Protein Zeta In Complex With Thr758 Phosphorylated Integrin Beta2 Peptide Length = 247 | Back alignment and structure |
| >pdb|2O02|A Chain A, Phosphorylation Independent Interactions Between 14-3-3 And Exoenzyme S: From Structure To Pathogenesis Length = 230 | Back alignment and structure |
| >pdb|3RDH|A Chain A, X-Ray Induced Covalent Inhibition Of 14-3-3 Length = 248 | Back alignment and structure |
| >pdb|2C1J|A Chain A, Molecular Basis For The Recognition Of Phosphorylated And Phosphoacetylated Histone H3 By 14-3-3 Length = 258 | Back alignment and structure |
| >pdb|1A38|A Chain A, 14-3-3 Protein Zeta Bound To R18 Peptide Length = 245 | Back alignment and structure |
| >pdb|4GNT|A Chain A, Complex Of Chrebp And 14-3-3beta Length = 245 | Back alignment and structure |
| >pdb|2BQ0|A Chain A, 14-3-3 Protein Beta (Human) Length = 245 | Back alignment and structure |
| >pdb|2BTP|A Chain A, 14-3-3 Protein Theta (Human) Complexed To Peptide Length = 256 | Back alignment and structure |
| >pdb|4DNK|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Beta Polypeptide (Ywhab) From Homo Sapiens At 2.20 A Resolution. Length = 247 | Back alignment and structure |
| >pdb|3UZD|A Chain A, Crystal Structure Of 14-3-3 Gamma Length = 248 | Back alignment and structure |
| >pdb|2C63|A Chain A, 14-3-3 Protein Eta (Human) Complexed To Peptide Length = 247 | Back alignment and structure |
| >pdb|2B05|A Chain A, Crystal Structure Of 14-3-3 Gamma In Complex With A Phosphoserine Peptide Length = 246 | Back alignment and structure |
| >pdb|4E2E|A Chain A, Crystal Structure Of A Tyrosine 3-MonooxygenaseTRYPTOPHAN 5- Monooxygenase Activation Protein, Gamma Polypeptide (Ywhag) From Homo Sapiens At 2.25 A Resolution Length = 248 | Back alignment and structure |
| >pdb|3P1P|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38nN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|3UBW|A Chain A, Complex Of 14-3-3 Isoform Epsilon, A Mlf1 Phosphopeptide And A Small Fragment Hit From A Fbdd Screen Length = 261 | Back alignment and structure |
| >pdb|3LW1|A Chain A, Binary Complex Of 14-3-3 Sigma And P53 Pt387-Peptide Length = 253 | Back alignment and structure |
| >pdb|3U9X|A Chain A, Covalent Attachment Of Pyridoxal-Phosphate Derivatives To 14-3-3 Proteins Length = 235 | Back alignment and structure |
| >pdb|3IQJ|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Raf1 Peptide (10mer) Length = 236 | Back alignment and structure |
| >pdb|3P1N|A Chain A, Crystal Structure Of Human 14-3-3 Sigma In Complex With Task-3 Peptide Length = 235 | Back alignment and structure |
| >pdb|3SMO|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide And Stabilizer Fusicoccin J Aglycone Length = 235 | Back alignment and structure |
| >pdb|3P1R|A Chain A, Crystal Structure Of Human 14-3-3 Sigma C38vN166H IN COMPLEX WITH Task-3 Peptide Length = 236 | Back alignment and structure |
| >pdb|4HQW|A Chain A, Molecular Tweezers Modulate 14-3-3 Protein-protein Interactions Length = 236 | Back alignment and structure |
| >pdb|3O8I|A Chain A, Structure Of 14-3-3 Isoform Sigma In Complex With A C-Raf1 Peptide And A Stabilizing Small Molecule Fragment Length = 239 | Back alignment and structure |
| >pdb|4DAT|A Chain A, Structure Of 14-3-3 Sigma In Complex With Padi6 14-3-3 Binding Motif Ii Length = 234 | Back alignment and structure |
| >pdb|3T0L|A Chain A, Small-Molecule Inhibitors Of 14-3-3 Protein-Protein Interactions From Virtual Screening Length = 235 | Back alignment and structure |
| >pdb|2BR9|A Chain A, 14-3-3 Protein Epsilon (Human) Complexed To Peptide Length = 234 | Back alignment and structure |
| >pdb|1YWT|A Chain A, Crystal Structure Of The Human Sigma Isoform Of 14-3-3 In Complex With A Mode-1 Phosphopeptide Length = 248 | Back alignment and structure |
| >pdb|3UAL|A Chain A, Crystal Structure Of 14-3-3 Epsilon With Mlf1 Peptide Length = 232 | Back alignment and structure |
| >pdb|2O98|A Chain A, Structure Of The 14-3-3 H+-Atpase Plant Complex Length = 242 | Back alignment and structure |
| >pdb|3M50|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY EPIBESTAT Length = 240 | Back alignment and structure |
| >pdb|1O9C|A Chain A, Structural View Of A Fungal Toxin Acting On A 14-3-3 Regulatory Complex Length = 260 | Back alignment and structure |
| >pdb|2NPM|A Chain A, Crystal Structure Of Cryptosporidium Parvum 14-3-3 Protein In Complex With Peptide Length = 260 | Back alignment and structure |
| >pdb|3AXY|C Chain C, Structure Of Florigen Activation Complex Consisting Of Rice Florigen Hd3a, 14-3-3 Protein Gf14 And Rice Fd Homolog Osfd1 Length = 240 | Back alignment and structure |
| >pdb|4DX0|A Chain A, Structure Of The 14-3-3PMA2 COMPLEX STABILIZED BY A PYRAZOLE Derivative Length = 243 | Back alignment and structure |
| >pdb|2K7Q|A Chain A, Filamin A Ig-Like Domains 18-19 Length = 191 | Back alignment and structure |
| >pdb|2DJ4|A Chain A, Solution Structure Of The 13th Filamin Domain From Human Filamin-B Length = 108 | Back alignment and structure |
| >pdb|2D7M|A Chain A, Solution Structure Of The 14th Filamin Domain From Human Filamin C Length = 115 | Back alignment and structure |
| >pdb|2J3S|A Chain A, Crystal Structure Of The Human Filamin A Ig Domains 19 To 21 Length = 288 | Back alignment and structure |
| >pdb|2E9J|A Chain A, Solution Structure Of The 14th Filamin Domain From Human Filamin-B Length = 119 | Back alignment and structure |
| >pdb|2DIA|A Chain A, Solution Structure Of The 10th Filamin Domain From Human Filamin-B Length = 113 | Back alignment and structure |
| >pdb|3RGH|A Chain A, Structure Of Filamin A Immunoglobulin-Like Repeat 10 From Homo Sapiens Length = 100 | Back alignment and structure |
| >pdb|2K7P|A Chain A, Filamin A Ig-Like Domains 16-17 Length = 188 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 201 | |||
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 2e-43 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 1e-40 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 3e-40 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 2e-39 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 8e-39 | |
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 9e-39 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 2e-37 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 5e-36 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-22 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 2e-22 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 2e-19 | |
| 2eec_A | 125 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-18 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 4e-18 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 8e-18 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-17 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 5e-17 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 7e-10 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 1e-06 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 5e-17 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 9e-17 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 1e-16 | |
| 2k7p_A | 188 | Filamin-A; IG-like, ABP-280, actin binding protein | 1e-16 | |
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-16 | |
| 2d7n_A | 93 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 3e-16 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 4e-16 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 6e-16 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 7e-16 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 1e-15 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-15 | |
| 2nqc_A | 138 | Filamin-C; immunoglobulin, metal binding, immune s | 3e-15 | |
| 2dib_A | 128 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 5e-15 | |
| 2ee9_A | 95 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 7e-15 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 1e-14 | |
| 2dlg_A | 102 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-14 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 2e-14 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 2e-13 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 4e-09 | |
| 2dmc_A | 116 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 1e-12 | |
| 1qfh_A | 212 | Protein (gelation factor); actin binding protein, | 3e-12 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 7e-12 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 8e-12 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 9e-09 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 7e-08 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 1e-05 | |
| 2di7_A | 124 | BK158_1; beta-sandwich, immunoglobulin-like fold, | 2e-05 | |
| 1qzv_F | 154 | Plant photosystem I: subunit PSAF; photosynthesis, | 4e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 6e-04 |
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* Length = 248 | Back alignment and structure |
|---|
Score = 144 bits (364), Expect = 2e-43
Identities = 75/100 (75%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
Query: 6 EKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 65
++E+LVQ+A+LAEQAERYDDMAAAMK VTE LSNEERNLLSVAYKNVVGARRSSWRV
Sbjct: 3 DREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSWRV 62
Query: 66 ISSIEQKTE--GSERKQQMAREYREKVEKELRDICYDVLK 103
ISSIEQKT G+E+K +M R YREK+EKEL +C DVL
Sbjct: 63 ISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLS 102
|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} Length = 260 | Back alignment and structure |
|---|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3p1s_A* 3p1r_A* 3p1q_A* 3p1p_A* 1ywt_A* 1yz5_A 2v7d_A* 2o02_A 1qja_A* 1a37_A 1a38_A 1a4o_A* 1ib1_A* ... Length = 236 | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 Length = 227 | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Length = 234 | Back alignment and structure |
|---|
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} Length = 261 | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* Length = 268 | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* Length = 260 | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 113 | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A Length = 97 | Back alignment and structure |
|---|
| >2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 108 | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 131 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A Length = 288 | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A Length = 94 | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 105 | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
| >2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 188 | Back alignment and structure |
|---|
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 115 | Back alignment and structure |
|---|
| >2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 93 | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 115 | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 111 | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A Length = 96 | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A Length = 138 | Back alignment and structure |
|---|
| >2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 128 | Back alignment and structure |
|---|
| >2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 95 | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 102 | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 124 | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} Length = 191 | Back alignment and structure |
|---|
| >2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 Length = 116 | Back alignment and structure |
|---|
| >1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 Length = 212 | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 113 | Back alignment and structure |
|---|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A Length = 112 | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A Length = 311 | Back alignment and structure |
|---|
| >2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| 3ubw_A | 261 | 14-3-3E, 14-3-3 protein epsilon; adapter protein, | 100.0 | |
| 3iqu_A | 236 | 14-3-3 protein sigma; signal transuction, nucleus, | 100.0 | |
| 3uzd_A | 248 | 14-3-3 protein gamma; structural genomics, SGC, st | 100.0 | |
| 2o8p_A | 227 | 14-3-3 domain containing protein; signaling protei | 100.0 | |
| 2br9_A | 234 | 14-3-3E, 14-3-3 protein epsilon; cell regulator pr | 100.0 | |
| 1o9d_A | 260 | 14-3-3-like protein C; protein-binding, fusicoccin | 100.0 | |
| 2npm_A | 260 | 14-3-3 domain containing protein; cell regulator p | 100.0 | |
| 3efz_A | 268 | 14-3-3 protein; 14-3-3, cell regulation, structura | 100.0 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.94 | |
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.93 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.93 | |
| 2eec_A | 125 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.92 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 99.91 | |
| 2dib_A | 128 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.91 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.9 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.9 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 99.89 | |
| 2k7p_A | 188 | Filamin-A; IG-like, ABP-280, actin binding protein | 99.88 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 99.88 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.87 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 99.87 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.87 | |
| 2nqc_A | 138 | Filamin-C; immunoglobulin, metal binding, immune s | 99.87 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 99.86 | |
| 2dmc_A | 116 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.86 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.86 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 99.86 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 99.86 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 99.85 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.85 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.85 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 99.84 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.83 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.83 | |
| 4b7l_A | 347 | Filamin-B; structural protein, FR 1 filamin hinge | 99.81 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 99.8 | |
| 1qfh_A | 212 | Protein (gelation factor); actin binding protein, | 99.74 | |
| 2j3s_A | 288 | Filamin-A; cytoskeleton, phosphorylation, structur | 99.72 | |
| 1qfh_A | 212 | Protein (gelation factor); actin binding protein, | 99.71 | |
| 1wlh_A | 311 | Gelation factor; ABP-120, filamin, immunoglobulin | 99.67 | |
| 2dlg_A | 102 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.63 | |
| 2di7_A | 124 | BK158_1; beta-sandwich, immunoglobulin-like fold, | 99.58 | |
| 2d7n_A | 93 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 99.5 | |
| 2ee9_A | 95 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 99.44 | |
| 2k7q_A | 191 | Filamin-A; IG-like, ABP-280, actin binding protein | 99.2 | |
| 2k7p_A | 188 | Filamin-A; IG-like, ABP-280, actin binding protein | 98.94 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 97.58 | |
| 2dib_A | 128 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 97.49 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 97.47 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 97.46 | |
| 2dlg_A | 102 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 97.23 | |
| 2dmc_A | 116 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 96.92 | |
| 2d7n_A | 93 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 96.37 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 96.08 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 95.42 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 95.31 | |
| 3tkv_A | 414 | FDEC fragment B, attaching and effacing protein, p | 94.39 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 94.15 | |
| 3tkv_A | 414 | FDEC fragment B, attaching and effacing protein, p | 94.06 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 93.3 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 91.68 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 91.66 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 91.45 | |
| 2ee9_A | 95 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 91.38 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 91.13 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 90.94 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 90.74 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 89.75 | |
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 89.46 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 89.38 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 87.32 | |
| 2eec_A | 125 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 87.12 | |
| 2p9r_A | 102 | Alpha-2-M, alpha-2-macroglobulin; human alpha2-mac | 86.94 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 84.87 | |
| 3idu_A | 127 | Uncharacterized protein; all beta-protein, structu | 83.11 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 83.04 | |
| 3c12_A | 138 | FLGD, flagellar protein; HOOK capping, IG-like dom | 81.94 | |
| 2nqc_A | 138 | Filamin-C; immunoglobulin, metal binding, immune s | 81.86 | |
| 4b7l_A | 347 | Filamin-B; structural protein, FR 1 filamin hinge | 81.04 | |
| 3isy_A | 120 | Bsupi, intracellular proteinase inhibitor; intrace | 80.19 |
| >3ubw_A 14-3-3E, 14-3-3 protein epsilon; adapter protein, signaling protein, signaling protein-protei complex; HET: SEP; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=2e-43 Score=296.58 Aligned_cols=136 Identities=51% Similarity=0.757 Sum_probs=117.2
Q ss_pred CCCcccHHHHHHHHHhHHHhccHHHHHHHHHHHHhcCCCCCHHhHhHHHHHhhhhcccchhhHHHHhhHhhhhc--cchH
Q psy5367 1 MSSSGEKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTE--GSER 78 (201)
Q Consensus 1 ~~~~~~r~~~~~~aklae~~ery~dm~~~mk~~~~~~~~L~~eERnLlsvayKn~i~~~R~swR~i~~~e~~~~--~~~~ 78 (201)
|+++.+|++++|+|||||||||||||+++||++++.+++||.||||||||||||+||+||+|||+|+++|||++ +++.
T Consensus 25 ~~~m~~re~lv~~AKLaeqaeRYddMv~~MK~v~~~~~eLt~EERNLLSvAYKNvIgarR~swRiissieqkee~~g~~~ 104 (261)
T 3ubw_A 25 MGSMDDREDLVYQAKLAEQAERYDEMVESMKKVAGMDVELTVEERNLLSVAYKNVIGARRASWRIISSIEQKEENKGGED 104 (261)
T ss_dssp -----CHHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTCHH
T ss_pred hhhhhhHHHHHHHHHHHHHhccHHHHHHHHHHHHhcCCcCCHHHHHHHHHHHHhccCCchhHHHHHhHHHHhhhccccHH
Confidence 44445899999999999999999999999999999999999999999999999999999999999999999974 6788
Q ss_pred HHHHHHHHHHHHHHHHHHhhhhhhhcccccccceEEEecccCCCccceeeCCCCCcceeCCceeEEeecc
Q psy5367 79 KQQMAREYREKVEKELRDICYDVLKRSQVKGCPLKVLVSAVCDATQVLCSGSGLSVGTLGQDIRSFIDTR 148 (201)
Q Consensus 79 ~~~~i~~yr~kIe~EL~~iC~eil~l~~i~gSPf~v~v~~~~Daskv~~~G~GL~~~~vg~~~~f~Vdt~ 148 (201)
+++++++||++||+||..+|++||++++- .+.+......+||++.. +++++++++..-
T Consensus 105 ~~~~i~~yr~kIe~EL~~iC~dil~lld~-----~Lip~a~~~EskVFY~K-------MKGDYyRYlAE~ 162 (261)
T 3ubw_A 105 KLKMIREYRQMVETELKLICCDILDVLDK-----HLIPAANTGESKVFYYK-------MKGDYHRYLAEF 162 (261)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----THHHHCCSHHHHHHHHH-------HHHHHHHHHHHH
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----hccccCCcHHHHHHHHH-------hhccHHHHHHhh
Confidence 99999999999999999999999999985 23333345568898886 777877766543
|
| >3iqu_A 14-3-3 protein sigma; signal transuction, nucleus, phosphoprotein, secreted, prote binding, signaling protein; HET: SEP; 1.05A {Homo sapiens} SCOP: a.118.7.1 PDB: 3iqj_A* 3iqv_A* 3mhr_A* 3lw1_A* 3o8i_A* 3p1n_A* 3p1o_A* 3t0l_A* 3t0m_A* 3u9x_A* 3ux0_A* 4dat_A* 4dau_A* 3p1s_A* 3p1r_A* 3smk_A* 3spr_A* 3p1q_A* 3p1p_A* 3sml_A* ... | Back alignment and structure |
|---|
| >3uzd_A 14-3-3 protein gamma; structural genomics, SGC, structural genomics consortium, MA alpha, phosphoserine, phosphothreonine; HET: SEP; 1.86A {Homo sapiens} PDB: 4e2e_A 2b05_A* 2c63_A* 2c74_A* 4dnk_A 4gnt_A 2bq0_A 2c23_A 2c1n_A* 2c1j_A* 2btp_A* | Back alignment and structure |
|---|
| >2o8p_A 14-3-3 domain containing protein; signaling protein, 14-3-3, cell regulator protein, cryptospo parvum, structural genomics; HET: MSE; 1.82A {Cryptosporidium parvum} SCOP: a.118.7.1 | Back alignment and structure |
|---|
| >2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* | Back alignment and structure |
|---|
| >1o9d_A 14-3-3-like protein C; protein-binding, fusicoccin, 14-3-3 family, activating drug; HET: TPO; 2.3A {Nicotiana tabacum} SCOP: a.118.7.1 PDB: 1o9c_A* 1o9e_A* 1o9f_A* 3e6y_A* | Back alignment and structure |
|---|
| >2npm_A 14-3-3 domain containing protein; cell regulator protein 14-3-3, struc genomics, structural genomics consortium, SGC, protein BIND; HET: SEP; 2.52A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3efz_A 14-3-3 protein; 14-3-3, cell regulation, structural genom structural genomics consortium, SGC; HET: SEP; 2.08A {Cryptosporidium parvum} SCOP: a.118.7.1 PDB: 2ijp_A* | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 | Back alignment and structure |
|---|
| >2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A | Back alignment and structure |
|---|
| >2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A | Back alignment and structure |
|---|
| >1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 | Back alignment and structure |
|---|
| >2j3s_A Filamin-A; cytoskeleton, phosphorylation, structural protein; 2.5A {Homo sapiens} SCOP: b.1.18.10 b.1.18.10 PDB: 2e9i_A | Back alignment and structure |
|---|
| >1qfh_A Protein (gelation factor); actin binding protein, immunoglobulin, ABP- 120; 2.20A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 | Back alignment and structure |
|---|
| >1wlh_A Gelation factor; ABP-120, filamin, immunoglobulin fold, ROD domain, structural protein; 2.80A {Dictyostelium discoideum} SCOP: b.1.18.10 b.1.18.10 b.1.18.10 PDB: 1ksr_A | Back alignment and structure |
|---|
| >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k7q_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2k7p_A Filamin-A; IG-like, ABP-280, actin binding protein, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dmc_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A | Back alignment and structure |
|---|
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2eec_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2p9r_A Alpha-2-M, alpha-2-macroglobulin; human alpha2-macroglobulin, Mg2 domain, X-RAY, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >3idu_A Uncharacterized protein; all beta-protein, structural genomics, PSI-2, protein structure initiative; 1.70A {Pyrococcus furiosus} PDB: 2kl6_A | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >3c12_A FLGD, flagellar protein; HOOK capping, IG-like domain, FN-III domain, tudor-like domain, flagellar biogenesis, flagellum; 2.51A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2nqc_A Filamin-C; immunoglobulin, metal binding, immune system; 2.05A {Homo sapiens} SCOP: b.1.18.10 PDB: 2d7q_A 2k3t_A | Back alignment and structure |
|---|
| >4b7l_A Filamin-B; structural protein, FR 1 filamin hinge ABD-1; 2.05A {Homo sapiens} PDB: 2wfn_A | Back alignment and structure |
|---|
| >3isy_A Bsupi, intracellular proteinase inhibitor; intracellular proteinase inhibitor bsupi, beta sandwich, GRE structural genomics; HET: PG4; 2.61A {Bacillus subtilis} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 201 | ||||
| d2o02a1 | 230 | a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) | 6e-54 | |
| d1o9da_ | 236 | a.118.7.1 (A:) 14-3-3-like protein C {Common tobac | 4e-49 | |
| d2o8pa1 | 220 | a.118.7.1 (A:8-227) 14-3-3 domain containing prote | 8e-45 | |
| d3efza1 | 223 | a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cry | 3e-38 | |
| d2di9a1 | 118 | b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens | 6e-22 | |
| d2diba1 | 115 | b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens | 3e-18 | |
| d2dj4a1 | 101 | b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens | 1e-17 | |
| d2dica1 | 98 | b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens | 3e-17 | |
| d2diaa1 | 100 | b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens | 5e-17 | |
| d2d7ma1 | 102 | b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens | 3e-16 | |
| d2dmca1 | 103 | b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens | 8e-16 | |
| d2w0pa1 | 92 | b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sap | 5e-15 | |
| d1v05a_ | 96 | b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [Ta | 8e-15 | |
| d2dmba1 | 111 | b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens | 1e-14 | |
| d2di8a1 | 98 | b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens | 2e-14 | |
| d2nqca1 | 97 | b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sap | 6e-14 | |
| d2bp3a1 | 92 | b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sap | 6e-14 | |
| d1wlha1 | 101 | b.1.18.10 (A:547-647) F-actin cross-linking gelati | 1e-13 | |
| d2j3sa2 | 88 | b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sap | 2e-13 | |
| d1qfha1 | 104 | b.1.18.10 (A:646-749) F-actin cross-linking gelati | 1e-11 | |
| d2d7na1 | 80 | b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) | 2e-11 | |
| d2d7pa1 | 99 | b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens | 1e-10 | |
| d1qfha2 | 108 | b.1.18.10 (A:750-857) F-actin cross-linking gelati | 4e-08 | |
| d1kpta_ | 105 | d.70.1.1 (A:) Virally encoded KP4 toxin {Ustilago | 4e-04 |
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Length = 230 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: 14-3-3 protein family: 14-3-3 protein domain: zeta isoform species: Cow (Bos taurus) [TaxId: 9913]
Score = 169 bits (430), Expect = 6e-54
Identities = 84/98 (85%), Positives = 91/98 (92%)
Query: 6 EKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSWRV 65
+K ELVQ+AKLAEQAERYDDMAA MK+VTE G ELSNEERNLLSVAYKNVVGARRSSWRV
Sbjct: 2 DKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRV 61
Query: 66 ISSIEQKTEGSERKQQMAREYREKVEKELRDICYDVLK 103
+SSIEQKTEG+E+KQQMAREYREK+E ELRDIC DVL
Sbjct: 62 VSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLS 99
|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 236 | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} Length = 220 | Back information, alignment and structure |
|---|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} Length = 223 | Back information, alignment and structure |
|---|
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 118 | Back information, alignment and structure |
|---|
| >d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 101 | Back information, alignment and structure |
|---|
| >d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 104 | Back information, alignment and structure |
|---|
| >d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} Length = 108 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 201 | |||
| d2o02a1 | 230 | zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | 100.0 | |
| d1o9da_ | 236 | 14-3-3-like protein C {Common tobacco (Nicotiana t | 100.0 | |
| d2o8pa1 | 220 | 14-3-3 domain containing protein cgd7_2470 {Crypto | 100.0 | |
| d2di9a1 | 118 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.93 | |
| d3efza1 | 223 | 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [ | 99.89 | |
| d2d7ma1 | 102 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d2dj4a1 | 101 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2bp3a1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2diba1 | 115 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.87 | |
| d2w0pa1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2di8a1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1v05a_ | 96 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2diaa1 | 100 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d2dmca1 | 103 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d2dica1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.85 | |
| d2nqca1 | 97 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.83 | |
| d2dmba1 | 111 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.82 | |
| d1qfha1 | 104 | F-actin cross-linking gelation factor (ABP-120) re | 99.81 | |
| d2d7pa1 | 99 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.79 | |
| d1wlha1 | 101 | F-actin cross-linking gelation factor (ABP-120) re | 99.78 | |
| d2j3sa2 | 88 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 99.58 | |
| d2d7na1 | 80 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 99.51 | |
| d1qfha2 | 108 | F-actin cross-linking gelation factor (ABP-120) re | 99.48 | |
| d2dica1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 96.11 | |
| d2dj4a1 | 101 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 95.79 | |
| d2di8a1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 95.6 | |
| d2diba1 | 115 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 95.54 | |
| d2di9a1 | 118 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 95.51 | |
| d2diaa1 | 100 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 95.22 | |
| d2d7ma1 | 102 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 95.1 | |
| d2d7pa1 | 99 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 93.68 | |
| d2w0pa1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 93.64 | |
| d1qfha2 | 108 | F-actin cross-linking gelation factor (ABP-120) re | 92.39 | |
| d2j3sa2 | 88 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 92.37 | |
| d1cwva2 | 96 | Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | 91.9 | |
| d2dmba1 | 111 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 91.86 | |
| d2bp3a1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 91.22 | |
| d1wlha1 | 101 | F-actin cross-linking gelation factor (ABP-120) re | 91.2 | |
| d2nqca1 | 97 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 90.55 | |
| d2d7na1 | 80 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 89.63 | |
| d1v05a_ | 96 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 89.51 | |
| d2dmca1 | 103 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 89.49 | |
| d1qfha1 | 104 | F-actin cross-linking gelation factor (ABP-120) re | 88.85 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 88.21 | |
| d2q3za3 | 98 | Transglutaminase, two C-terminal domains {Human (H | 87.8 | |
| d1vlfn1 | 79 | Transhydroxylase beta subunit, BthL, C-terminal do | 87.72 | |
| d1cwva3 | 103 | Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | 86.87 | |
| d1cwva1 | 94 | Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | 86.2 | |
| d1ex0a3 | 100 | Transglutaminase, two C-terminal domains {Human (H | 85.71 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 85.32 | |
| d1vjja3 | 99 | Transglutaminase, two C-terminal domains {Human (H | 85.24 | |
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 85.16 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 84.75 | |
| d1g0da3 | 101 | Transglutaminase, two C-terminal domains {Red sea | 84.3 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 84.08 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 83.72 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 83.71 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 83.53 | |
| d1nkga1 | 87 | Rhamnogalacturonase B, RhgB, middle domain {Asperg | 83.36 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 81.84 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 80.29 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 80.17 |
| >d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: alpha-alpha superhelix superfamily: 14-3-3 protein family: 14-3-3 protein domain: zeta isoform species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=5.2e-39 Score=265.54 Aligned_cols=132 Identities=66% Similarity=0.894 Sum_probs=112.8
Q ss_pred ccHHHHHHHHHhHHHhccHHHHHHHHHHHHhcCCCCCHHhHhHHHHHhhhhcccchhhHHHHhhHhhhhccchHHHHHHH
Q psy5367 5 GEKEELVQRAKLAEQAERYDDMAAAMKAVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSERKQQMAR 84 (201)
Q Consensus 5 ~~r~~~~~~aklae~~ery~dm~~~mk~~~~~~~~L~~eERnLlsvayKn~i~~~R~swR~i~~~e~~~~~~~~~~~~i~ 84 (201)
|+|+++||+|||||||||||||+++||++++.+++||.||||||||||||+||++|+|||+|+++++++.+++.+.+.++
T Consensus 1 ~~re~~v~~Aklaeq~eRy~dm~~~mk~~~~~~~eLt~eERnLlsvayKn~i~~rR~s~R~l~~ie~k~~~~~~~~~~i~ 80 (230)
T d2o02a1 1 MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAR 80 (230)
T ss_dssp CCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC------CHHHHH
T ss_pred CCHHHHHHHHHHHHHHcCHHHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHcCcchhhHHHH
Confidence 68999999999999999999999999999999999999999999999999999999999999999999888888889999
Q ss_pred HHHHHHHHHHHHhhhhhhhcccccccceEEEecccCCCccceeeCCCCCcceeCCceeEEeecc
Q psy5367 85 EYREKVEKELRDICYDVLKRSQVKGCPLKVLVSAVCDATQVLCSGSGLSVGTLGQDIRSFIDTR 148 (201)
Q Consensus 85 ~yr~kIe~EL~~iC~eil~l~~i~gSPf~v~v~~~~Daskv~~~G~GL~~~~vg~~~~f~Vdt~ 148 (201)
+||++|+.||..+|++++++++- .+.+....+.++|++.. +.+++++++..-
T Consensus 81 ~yk~kie~EL~~~C~dil~lid~-----~Lip~~~~~eskvFy~K-------mkgDy~RY~aE~ 132 (230)
T d2o02a1 81 EYREKIETELRDICNDVLSLLEK-----FLIPNASQAESKVFYLK-------MKGDYYRYLAEV 132 (230)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHH-----THHHHCCSHHHHHHHHH-------HHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHcchHHHHHh-----hcCccCCCchhhhhHHH-------hcccHHHHHHHh
Confidence 99999999999999999999974 23333345668888876 777777666543
|
| >d1o9da_ a.118.7.1 (A:) 14-3-3-like protein C {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d2o8pa1 a.118.7.1 (A:8-227) 14-3-3 domain containing protein cgd7_2470 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3efza1 a.118.7.1 (A:46-268) 14-3-3 protein cgd1_2980 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha2 b.1.18.10 (A:750-857) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2j3sa2 b.1.18.10 (A:2149-2236) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cwva2 b.1.14.1 (A:597-692) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d2dmba1 b.1.18.10 (A:8-118) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bp3a1 b.1.18.10 (A:1863-1954) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2nqca1 b.1.18.10 (A:2482-2578) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2q3za3 b.1.5.1 (A:586-683) Transglutaminase, two C-terminal domains {Human (Homo sapiens), tissue isozyme [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]} | Back information, alignment and structure |
|---|
| >d1cwva3 b.1.14.1 (A:693-795) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1cwva1 b.1.14.1 (A:503-596) Invasin {Yersinia pseudotuberculosis [TaxId: 633]} | Back information, alignment and structure |
|---|
| >d1ex0a3 b.1.5.1 (A:628-727) Transglutaminase, two C-terminal domains {Human (Homo sapiens), blood isozyme [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vjja3 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g0da3 b.1.5.1 (A:584-684) Transglutaminase, two C-terminal domains {Red sea bream (Chrysophrys major) [TaxId: 143350]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkga1 b.3.1.2 (A:251-337) Rhamnogalacturonase B, RhgB, middle domain {Aspergillus aculeatus [TaxId: 5053]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|