Psyllid ID: psy5508


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MFPITGWVLLGSCFLVVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKTALQKHITAVFCIVIKADV
cccEEEEEEEcEEEEEEccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccEEEEEcccc
cccEEEEEEEccHEEEEEccccccccccccHEEcccccEEcccccccccccccccccccccccccccEcccccEEEEEEEEEEcc
MFPITGWVLLGSCFLVVSLQQLQHHQCRiseyacengrcisldrfcneyddcgdksdeprycsrsktALQKHITAVFCIVIKADV
mfpitgwvLLGSCFLVVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRsktalqkhiTAVFCIVIKADV
MFPITGWVLLGSCFLVVSlqqlqhhqCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKTALQKHITAVFCIVIKADV
**PITGWVLLGSCFLVVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDK****RYCSRSKTALQKHITAVFCIVIK***
*FPITGWVLLGSCFLVVSLQQL****CRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKTALQKHITAVFCIVIKAD*
MFPITGWVLLGSCFLVVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKTALQKHITAVFCIVIKADV
MFPITGWVLLGSCFLVVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKTALQKHITAVFCIVIKADV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
SSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPITGWVLLGSCFLVVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKTALQKHITAVFCIVIKADV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query85 2.2.26 [Sep-21-2011]
O75096 1905 Low-density lipoprotein r yes N/A 0.541 0.024 0.425 0.0004
P98164 4655 Low-density lipoprotein r no N/A 0.482 0.008 0.452 0.0009
P98158 4660 Low-density lipoprotein r no N/A 0.352 0.006 0.5 0.0009
Q9QYP1 1905 Low-density lipoprotein r no N/A 0.541 0.024 0.425 0.0009
>sp|O75096|LRP4_HUMAN Low-density lipoprotein receptor-related protein 4 OS=Homo sapiens GN=LRP4 PE=1 SV=4 Back     alignment and function desciption
 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 20/47 (42%), Positives = 28/47 (59%), Gaps = 1/47 (2%)

Query: 26  QCRISEYACENGRCISLDRFCNEYDDCGDKSDE-PRYCSRSKTALQK 71
           QC + ++ C NGRCI   + CN  +DCGD SDE P+   R +T  + 
Sbjct: 311 QCALDQFLCWNGRCIGQRKLCNGVNDCGDNSDESPQQNCRPRTGEEN 357




Mediates SOST-dependent inhibition of bone formation. Functions as a specific facilitator of SOST-mediated inhibition of Wnt signaling. Plays a key role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between motor neuron and skeletal muscle. Directly binds AGRIN and recruits it to the MUSK signaling complex. Mediates the AGRIN-induced phosphorylation of MUSK, the kinase of the complex. The activation of MUSK in myotubes induces the formation of NMJ by regulating different processes including the transcription of specific genes and the clustering of AChR in the postsynaptic membrane. Alternatively, may be involved in the negative regulation of the canonical Wnt signaling pathway, being able to antagonize the LRP6-mediated activation of this pathway. More generally, has been proposed to function as a cell surface endocytic receptor binding and internalizing extracellular ligands for degradation by lysosomes.
Homo sapiens (taxid: 9606)
>sp|P98164|LRP2_HUMAN Low-density lipoprotein receptor-related protein 2 OS=Homo sapiens GN=LRP2 PE=1 SV=3 Back     alignment and function description
>sp|P98158|LRP2_RAT Low-density lipoprotein receptor-related protein 2 OS=Rattus norvegicus GN=Lrp2 PE=1 SV=1 Back     alignment and function description
>sp|Q9QYP1|LRP4_RAT Low-density lipoprotein receptor-related protein 4 OS=Rattus norvegicus GN=Lrp4 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
157127777 1318 hypothetical protein AaeL_AAEL002265 [Ae 0.576 0.037 0.510 1e-09
189240361 976 PREDICTED: similar to AGAP006059-PA [Tri 0.670 0.058 0.474 4e-09
242023213 1031 hypothetical protein Phum_PHUM565670 [Pe 0.623 0.051 0.456 5e-09
270013212 730 hypothetical protein TcasGA2_TC011786 [T 0.458 0.053 0.615 7e-09
158295850 1208 AGAP006444-PA [Anopheles gambiae str. PE 0.494 0.034 0.595 8e-09
27001243696 hypothetical protein TcasGA2_TC006585 [T 0.682 0.604 0.466 1e-08
24201206376 hypothetical protein Phum_PHUM274240 [Pe 0.447 0.5 0.657 1e-08
241836589 1203 conserved hypothetical protein [Ixodes s 0.505 0.035 0.581 2e-08
195012087 1132 GH15565 [Drosophila grimshawi] gi|193896 0.447 0.033 0.605 4e-08
198464439 1330 GA23669 [Drosophila pseudoobscura pseudo 0.447 0.028 0.578 5e-08
>gi|157127777|ref|XP_001661176.1| hypothetical protein AaeL_AAEL002265 [Aedes aegypti] gi|108882350|gb|EAT46575.1| AAEL002265-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score = 67.4 bits (163), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 37/49 (75%)

Query: 16  VVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSR 64
           V + Q+    QC +SE++C NGRC+ L+++CN  +DCGD SDEPR+C+R
Sbjct: 220 VAAAQKQSRRQCAMSEHSCNNGRCVPLNKYCNNVNDCGDGSDEPRFCTR 268




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|189240361|ref|XP_973209.2| PREDICTED: similar to AGAP006059-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242023213|ref|XP_002432030.1| hypothetical protein Phum_PHUM565670 [Pediculus humanus corporis] gi|212517388|gb|EEB19292.1| hypothetical protein Phum_PHUM565670 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270013212|gb|EFA09660.1| hypothetical protein TcasGA2_TC011786 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158295850|ref|XP_316483.4| AGAP006444-PA [Anopheles gambiae str. PEST] gi|157016230|gb|EAA11118.5| AGAP006444-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|270012436|gb|EFA08884.1| hypothetical protein TcasGA2_TC006585 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242012063|ref|XP_002426760.1| hypothetical protein Phum_PHUM274240 [Pediculus humanus corporis] gi|212510942|gb|EEB14022.1| hypothetical protein Phum_PHUM274240 [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|241836589|ref|XP_002415108.1| conserved hypothetical protein [Ixodes scapularis] gi|215509320|gb|EEC18773.1| conserved hypothetical protein [Ixodes scapularis] Back     alignment and taxonomy information
>gi|195012087|ref|XP_001983468.1| GH15565 [Drosophila grimshawi] gi|193896950|gb|EDV95816.1| GH15565 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|198464439|ref|XP_002134778.1| GA23669 [Drosophila pseudoobscura pseudoobscura] gi|198149718|gb|EDY73405.1| GA23669 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
ZFIN|ZDB-GENE-061103-613 864 st14b "suppression of tumorige 0.447 0.043 0.538 1.8e-06
FB|FBgn0052206 1260 CG32206 [Drosophila melanogast 0.647 0.043 0.4 2.9e-06
FB|FBgn0261260 4769 mgl "Megalin" [Drosophila mela 0.494 0.008 0.452 1.2e-05
ZFIN|ZDB-GENE-040426-1358 855 c6 "complement component 6" [D 0.458 0.045 0.487 1.6e-05
ZFIN|ZDB-GENE-100513-4 907 si:ch211-22d5.4 "si:ch211-22d5 0.458 0.042 0.487 3.7e-05
UNIPROTKB|F1N9Z9 939 C6 "Uncharacterized protein" [ 0.564 0.051 0.423 3.9e-05
ZFIN|ZDB-GENE-050208-608 4616 lrp1ba "low density lipoprotei 0.529 0.009 0.478 3.9e-05
UNIPROTKB|F1MM86 932 C6 "Complement component C6" [ 0.505 0.046 0.444 6.2e-05
UNIPROTKB|Q29RU4 932 C6 "Complement component C6" [ 0.505 0.046 0.444 6.2e-05
FB|FBgn0051092 1064 LpR2 "Lipophorin receptor 2" [ 0.458 0.036 0.512 7.3e-05
ZFIN|ZDB-GENE-061103-613 st14b "suppression of tumorigenicity 14 (colon carcinoma) b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 122 (48.0 bits), Expect = 1.8e-06, P = 1.8e-06
 Identities = 21/39 (53%), Positives = 28/39 (71%)

Query:    27 CRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRS 65
             C+  E+ C +GRCIS  + CN Y+DCGD SDE R C++S
Sbjct:   536 CKTWEFRCRSGRCISAQKQCNGYNDCGDGSDESR-CAKS 573


GO:0004252 "serine-type endopeptidase activity" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
FB|FBgn0052206 CG32206 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1358 c6 "complement component 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-100513-4 si:ch211-22d5.4 "si:ch211-22d5.4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1N9Z9 C6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-608 lrp1ba "low density lipoprotein receptor-related protein 1Ba" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM86 C6 "Complement component C6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q29RU4 C6 "Complement component C6" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
FB|FBgn0051092 LpR2 "Lipophorin receptor 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
cd0011235 cd00112, LDLa, Low Density Lipoprotein Receptor Cl 1e-07
pfam0005737 pfam00057, Ldl_recept_a, Low-density lipoprotein r 3e-07
smart0019233 smart00192, LDLa, Low-density lipoprotein receptor 6e-07
>gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
 Score = 43.0 bits (102), Expect = 1e-07
 Identities = 17/32 (53%), Positives = 20/32 (62%)

Query: 27 CRISEYACENGRCISLDRFCNEYDDCGDKSDE 58
          C  +E+ C NGRCI     C+  DDCGD SDE
Sbjct: 1  CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32


Length = 35

>gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A Back     alignment and domain information
>gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 85
PF0005737 Ldl_recept_a: Low-density lipoprotein receptor dom 99.5
cd0011235 LDLa Low Density Lipoprotein Receptor Class A doma 99.46
smart0019233 LDLa Low-density lipoprotein receptor domain class 99.28
KOG1215|consensus 877 96.61
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 96.5
PF12999176 PRKCSH-like: Glucosidase II beta subunit-like 96.35
KOG1215|consensus 877 94.18
KOG2397|consensus 480 87.11
>PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells Back     alignment and domain information
Probab=99.50  E-value=2.2e-14  Score=76.59  Aligned_cols=37  Identities=41%  Similarity=0.924  Sum_probs=34.3

Q ss_pred             CCCCCCeEeecCCceeccCcccCCcCCCCCCCCCCCCC
Q psy5508          25 HQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYC   62 (85)
Q Consensus        25 ~~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgSDE~~~C   62 (85)
                      +.|+..+|+|.++.||+..++|||+.||.|||||.+ |
T Consensus         1 ~~C~~~~f~C~~~~CI~~~~~CDg~~DC~dgsDE~~-C   37 (37)
T PF00057_consen    1 PTCPPGEFRCGNGQCIPKSWVCDGIPDCPDGSDEQN-C   37 (37)
T ss_dssp             SSSSTTEEEETTSSEEEGGGTTSSSCSSSSSTTTSS-H
T ss_pred             CcCcCCeeEcCCCCEEChHHcCCCCCCCCCCccccc-C
Confidence            368999999999999999999999999999999975 5



The LDL receptor binds LDL and transports it into cells by acidic endocytosis. In order to be internalized, the receptor-ligand complex must first cluster into clathrin-coated pits. Once inside the cell, the LDLR separates from its ligand, which is degraded in the lysosomes, while the receptor returns to the cell surface []. The internal dissociation of the LDLR with its ligand is mediated by proton pumps within the walls of the endosome that lower the pH. The LDLR is a multi-domain protein, containing: The ligand-binding domain contains seven or eight 40-amino acid LDLR class A (cysteine-rich) repeats, each of which contains a coordinated calcium ion and six cysteine residues involved in disulphide bond formation []. Similar domains have been found in other extracellular and membrane proteins []. The second conserved region contains two EGF repeats, followed by six LDLR class B (YWTD) repeats, and another EGF repeat. The LDLR class B repeats each contain a conserved YWTD motif, and is predicted to form a beta-propeller structure []. This region is critical for ligand release and recycling of the receptor []. The third domain is rich in serine and threonine residues and contains clustered O-linked carbohydrate chains. The fourth domain is the hydrophobic transmembrane region. The fifth domain is the cytoplasmic tail that directs the receptor to clathrin-coated pits. LDLR is closely related in structure to several other receptors, including LRP1, LRP1b, megalin/LRP2, VLDL receptor, lipoprotein receptor, MEGF7/LRP4, and LRP8/apolipoprotein E receptor2); these proteins participate in a wide range of physiological processes, including the regulation of lipid metabolism, protection against atherosclerosis, neurodevelopment, and transport of nutrients and vitamins []. This entry represents the LDLR class A (cyateine-rich) repeat, which contains 6 disulphide-bound cysteines and a highly conserved cluster of negatively charged amino acids, of which many are clustered on one face of the module []. In LDL receptors, the class A domains form the binding site for LDL and calcium. The acidic residues between the fourth and sixth cysteines are important for high-affinity binding of positively charged sequences in LDLR's ligands. The repeat consists of a beta-hairpin structure followed by a series of beta turns. In the absence of calcium, LDL-A domains are unstructured; the bound calcium ion imparts structural integrity. Following these repeats is a 350 residue domain that resembles part of the epidermal growth factor (EGF) precursor. Numerous familial hypercholestorolemia mutations of the LDL receptor alter the calcium coordinating residue of LDL-A domains or other crucial scaffolding residues. ; GO: 0005515 protein binding; PDB: 2I1P_A 3OJY_A 4E0S_B 3T5O_A 4A5W_B 1JRF_A 1K7B_A 1V9U_5 3DPR_E 2KNY_A ....

>cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure Back     alignment and domain information
>smart00192 LDLa Low-density lipoprotein receptor domain class A Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>PF12999 PRKCSH-like: Glucosidase II beta subunit-like Back     alignment and domain information
>KOG1215|consensus Back     alignment and domain information
>KOG2397|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
2fyj_A82 Low-density lipoprotein receptor-related protein 1 2e-08
2fyj_A82 Low-density lipoprotein receptor-related protein 1 3e-07
1j8e_A44 Low-density lipoprotein receptor-related protein 1 3e-08
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 3e-08
3a7q_B44 Low-density lipoprotein receptor-related protein; 5e-08
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 6e-08
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 4e-07
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 2e-07
2xrc_A 565 Human complement factor I; immune system, hydrolas 4e-06
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-06
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 3e-05
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 4e-05
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 9e-05
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-04
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 1e-04
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 7e-04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 2e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 2e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 6e-05
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 1e-04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 3e-04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 6e-04
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 9e-04
1cr8_A42 Protein (LOW density lipoprotein receptor related 4e-05
2i1p_A48 Low-density lipoprotein receptor-related protein 2 4e-05
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 5e-05
2knx_A50 Prolow-density lipoprotein receptor-related prote; 2e-04
2gtl_M 217 Hemoglobin linker chain L1; annelid erythrocruorin 2e-04
2gtl_O215 Extracellular hemoglobin linker L3 subunit; anneli 2e-04
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 3e-04
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 8e-04
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
 Score = 45.7 bits (109), Expect = 2e-08
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 25 HQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKT 67
            C  ++++C +GRCI +   C+  DDCGD+SDE   C+    
Sbjct: 3  RTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTC 45


>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 Back     alignment and structure
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 Back     alignment and structure
>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
1ajj_A37 LR5, low-density lipoprotein receptor; LDL recepto 99.55
2jm4_A43 Relaxin receptor 1; LDL-A module, RXFP1 receptor, 99.54
3a7q_B44 Low-density lipoprotein receptor-related protein; 99.54
1d2l_A45 Lipoprotein receptor related protein; ligand bindi 99.54
1cr8_A42 Protein (LOW density lipoprotein receptor related 99.52
2m0p_A52 Low-density lipoprotein receptor-related protein; 99.52
1k7b_A47 Subgroup A ROUS sarcoma virus receptor PG800 and P 99.49
3dpr_E39 LDL-receptor class A 3; human rhinovirus, VLDL-rec 99.46
2i1p_A48 Low-density lipoprotein receptor-related protein 2 99.45
2knx_A50 Prolow-density lipoprotein receptor-related prote; 99.45
1j8e_A44 Low-density lipoprotein receptor-related protein 1 99.43
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.41
1jrf_A47 TVA LDL-A module, subgroup A ROUS sarcoma virus re 99.4
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.33
2kny_A80 LRP-1, linker, APO-E; lipoprotein receptor, ligand 99.3
2fyj_A82 Low-density lipoprotein receptor-related protein 1 99.23
2fcw_B80 LDL receptor, low-density lipoprotein receptor; pr 99.16
2gtl_M 217 Hemoglobin linker chain L1; annelid erythrocruorin 99.13
2gtl_O 215 Extracellular hemoglobin linker L3 subunit; anneli 99.1
2gtl_N 220 Extracellular hemoglobin linker L2 subunit; anneli 99.08
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.88
3ojy_B 537 Complement component C8 beta chain; macpf, lipocal 98.86
3ojy_A 554 Complement component C8 alpha chain; macpf, lipoca 98.82
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.63
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 98.63
2xrc_A 565 Human complement factor I; immune system, hydrolas 98.61
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 98.51
3t5o_A 913 Complement component C6; macpf, MAC, membrane atta 98.47
2xrc_A 565 Human complement factor I; immune system, hydrolas 98.0
>1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
Probab=99.55  E-value=2.7e-15  Score=79.14  Aligned_cols=37  Identities=41%  Similarity=0.856  Sum_probs=34.3

Q ss_pred             CCCCCeEeecCCceeccCcccCCcCCCCCCCCCCCCCC
Q psy5508          26 QCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCS   63 (85)
Q Consensus        26 ~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgSDE~~~C~   63 (85)
                      .|+..+|+|.+|+||+..|+|||+.||.|||||.+ |+
T Consensus         1 ~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgsDE~~-C~   37 (37)
T 1ajj_A            1 PCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEEN-CA   37 (37)
T ss_dssp             CCCTTCEECTTSCEECGGGTTSSSCCSTTCGGGTT-CC
T ss_pred             CCCCCceEcCCCCeechhhccCCCCCCCCCccccC-CC
Confidence            47889999999999999999999999999999986 74



>2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Back     alignment and structure
>1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Back     alignment and structure
>3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* Back     alignment and structure
>2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Back     alignment and structure
>2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} Back     alignment and structure
>2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Back     alignment and structure
>2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Back     alignment and structure
>2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* Back     alignment and structure
>2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 85
d1j8ea_44 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-08
d1d2la_45 g.12.1.1 (A:) Ligand-binding domain of low-density 3e-08
d1f8za_39 g.12.1.1 (A:) Ligand-binding domain of low-density 1e-07
d2fcwb139 g.12.1.1 (B:86-124) Ligand-binding domain of low-d 2e-07
d2fcwb239 g.12.1.1 (B:125-163) Ligand-binding domain of low- 2e-07
d1ajja_37 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-07
d1f5ya144 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 2e-07
d1xfea244 g.12.1.1 (A:1-44) Ligand-binding domain of low-den 5e-07
d2gtlm242 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co 3e-06
d1cr8a_42 g.12.1.1 (A:) Ligand-binding domain of low-density 2e-05
d2gtlo241 g.12.1.1 (O:60-100) Extracellular hemoglobin linke 3e-05
d2gtln241 g.12.1.1 (N:61-101) Extracellular hemoglobin linke 4e-05
d1v9u5_39 g.12.1.1 (5:) Very low-density lipoprotein recepto 7e-05
d1f5ya241 g.12.1.1 (A:45-85) Ligand-binding domain of low-de 7e-05
d1k7ba_42 g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai 2e-04
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure

class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 43.6 bits (103), Expect = 2e-08
 Identities = 15/36 (41%), Positives = 21/36 (58%)

Query: 24 HHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEP 59
           H C  +++ C +GRCI     C+  +DCGD SDE 
Sbjct: 2  SHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDET 37


>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
d2fcwb139 Ligand-binding domain of low-density lipoprotein r 99.59
d1ajja_37 Ligand-binding domain of low-density lipoprotein r 99.58
d1f8za_39 Ligand-binding domain of low-density lipoprotein r 99.56
d1f5ya241 Ligand-binding domain of low-density lipoprotein r 99.53
d1cr8a_42 Ligand-binding domain of low-density lipoprotein r 99.52
d1f5ya144 Ligand-binding domain of low-density lipoprotein r 99.52
d1d2la_45 Ligand-binding domain of low-density lipoprotein r 99.5
d2gtlo241 Extracellular hemoglobin linker l3 subunit {Common 99.47
d2fcwb239 Ligand-binding domain of low-density lipoprotein r 99.46
d1j8ea_44 Ligand-binding domain of low-density lipoprotein r 99.45
d1v9u5_39 Very low-density lipoprotein receptor {Human (Homo 99.44
d1k7ba_42 soluble Tva ectodomain, sTva47 {Quail (Coturnix co 99.4
d1xfea244 Ligand-binding domain of low-density lipoprotein r 99.39
d2gtlm242 Hemoglobin linker chain l1 {Common earthworm (Lumb 99.36
d2gtln241 Extracellular hemoglobin linker l2 subunit {Common 99.34
>d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: LDL receptor-like module
superfamily: LDL receptor-like module
family: LDL receptor-like module
domain: Ligand-binding domain of low-density lipoprotein receptor
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59  E-value=2.3e-16  Score=83.21  Aligned_cols=38  Identities=39%  Similarity=0.917  Sum_probs=35.4

Q ss_pred             CCCCCCeEeecCCceeccCcccCCcCCCCCCCCCCCCCC
Q psy5508          25 HQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCS   63 (85)
Q Consensus        25 ~~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgSDE~~~C~   63 (85)
                      +.|++++|+|.+|+||+.+++|||..||.|||||.+ |+
T Consensus         1 rtC~~~~f~C~~g~CI~~~~~CDg~~DC~DgsDE~~-Cp   38 (39)
T d2fcwb1           1 KTCSQAEFRCHDGKCISRQFVCDSDRDCLDGSDEAS-CP   38 (39)
T ss_dssp             CCCCTTEEECTTSCEEEGGGTTSSSCCSTTCTTTTT-HH
T ss_pred             CcCCCCCEEcCCCCEEcchhcCcCcCcCcCCchhcC-CC
Confidence            368999999999999999999999999999999986 74



>d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Back     information, alignment and structure
>d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure
>d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Back     information, alignment and structure