Psyllid ID: psy5508
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| 157127777 | 1318 | hypothetical protein AaeL_AAEL002265 [Ae | 0.576 | 0.037 | 0.510 | 1e-09 | |
| 189240361 | 976 | PREDICTED: similar to AGAP006059-PA [Tri | 0.670 | 0.058 | 0.474 | 4e-09 | |
| 242023213 | 1031 | hypothetical protein Phum_PHUM565670 [Pe | 0.623 | 0.051 | 0.456 | 5e-09 | |
| 270013212 | 730 | hypothetical protein TcasGA2_TC011786 [T | 0.458 | 0.053 | 0.615 | 7e-09 | |
| 158295850 | 1208 | AGAP006444-PA [Anopheles gambiae str. PE | 0.494 | 0.034 | 0.595 | 8e-09 | |
| 270012436 | 96 | hypothetical protein TcasGA2_TC006585 [T | 0.682 | 0.604 | 0.466 | 1e-08 | |
| 242012063 | 76 | hypothetical protein Phum_PHUM274240 [Pe | 0.447 | 0.5 | 0.657 | 1e-08 | |
| 241836589 | 1203 | conserved hypothetical protein [Ixodes s | 0.505 | 0.035 | 0.581 | 2e-08 | |
| 195012087 | 1132 | GH15565 [Drosophila grimshawi] gi|193896 | 0.447 | 0.033 | 0.605 | 4e-08 | |
| 198464439 | 1330 | GA23669 [Drosophila pseudoobscura pseudo | 0.447 | 0.028 | 0.578 | 5e-08 |
| >gi|157127777|ref|XP_001661176.1| hypothetical protein AaeL_AAEL002265 [Aedes aegypti] gi|108882350|gb|EAT46575.1| AAEL002265-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 67.4 bits (163), Expect = 1e-09, Method: Compositional matrix adjust.
Identities = 25/49 (51%), Positives = 37/49 (75%)
Query: 16 VVSLQQLQHHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSR 64
V + Q+ QC +SE++C NGRC+ L+++CN +DCGD SDEPR+C+R
Sbjct: 220 VAAAQKQSRRQCAMSEHSCNNGRCVPLNKYCNNVNDCGDGSDEPRFCTR 268
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|189240361|ref|XP_973209.2| PREDICTED: similar to AGAP006059-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242023213|ref|XP_002432030.1| hypothetical protein Phum_PHUM565670 [Pediculus humanus corporis] gi|212517388|gb|EEB19292.1| hypothetical protein Phum_PHUM565670 [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|270013212|gb|EFA09660.1| hypothetical protein TcasGA2_TC011786 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|158295850|ref|XP_316483.4| AGAP006444-PA [Anopheles gambiae str. PEST] gi|157016230|gb|EAA11118.5| AGAP006444-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|270012436|gb|EFA08884.1| hypothetical protein TcasGA2_TC006585 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242012063|ref|XP_002426760.1| hypothetical protein Phum_PHUM274240 [Pediculus humanus corporis] gi|212510942|gb|EEB14022.1| hypothetical protein Phum_PHUM274240 [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|241836589|ref|XP_002415108.1| conserved hypothetical protein [Ixodes scapularis] gi|215509320|gb|EEC18773.1| conserved hypothetical protein [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|195012087|ref|XP_001983468.1| GH15565 [Drosophila grimshawi] gi|193896950|gb|EDV95816.1| GH15565 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|198464439|ref|XP_002134778.1| GA23669 [Drosophila pseudoobscura pseudoobscura] gi|198149718|gb|EDY73405.1| GA23669 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| ZFIN|ZDB-GENE-061103-613 | 864 | st14b "suppression of tumorige | 0.447 | 0.043 | 0.538 | 1.8e-06 | |
| FB|FBgn0052206 | 1260 | CG32206 [Drosophila melanogast | 0.647 | 0.043 | 0.4 | 2.9e-06 | |
| FB|FBgn0261260 | 4769 | mgl "Megalin" [Drosophila mela | 0.494 | 0.008 | 0.452 | 1.2e-05 | |
| ZFIN|ZDB-GENE-040426-1358 | 855 | c6 "complement component 6" [D | 0.458 | 0.045 | 0.487 | 1.6e-05 | |
| ZFIN|ZDB-GENE-100513-4 | 907 | si:ch211-22d5.4 "si:ch211-22d5 | 0.458 | 0.042 | 0.487 | 3.7e-05 | |
| UNIPROTKB|F1N9Z9 | 939 | C6 "Uncharacterized protein" [ | 0.564 | 0.051 | 0.423 | 3.9e-05 | |
| ZFIN|ZDB-GENE-050208-608 | 4616 | lrp1ba "low density lipoprotei | 0.529 | 0.009 | 0.478 | 3.9e-05 | |
| UNIPROTKB|F1MM86 | 932 | C6 "Complement component C6" [ | 0.505 | 0.046 | 0.444 | 6.2e-05 | |
| UNIPROTKB|Q29RU4 | 932 | C6 "Complement component C6" [ | 0.505 | 0.046 | 0.444 | 6.2e-05 | |
| FB|FBgn0051092 | 1064 | LpR2 "Lipophorin receptor 2" [ | 0.458 | 0.036 | 0.512 | 7.3e-05 |
| ZFIN|ZDB-GENE-061103-613 st14b "suppression of tumorigenicity 14 (colon carcinoma) b" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 122 (48.0 bits), Expect = 1.8e-06, P = 1.8e-06
Identities = 21/39 (53%), Positives = 28/39 (71%)
Query: 27 CRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRS 65
C+ E+ C +GRCIS + CN Y+DCGD SDE R C++S
Sbjct: 536 CKTWEFRCRSGRCISAQKQCNGYNDCGDGSDESR-CAKS 573
|
|
| FB|FBgn0052206 CG32206 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0261260 mgl "Megalin" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-1358 c6 "complement component 6" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-100513-4 si:ch211-22d5.4 "si:ch211-22d5.4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N9Z9 C6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-608 lrp1ba "low density lipoprotein receptor-related protein 1Ba" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MM86 C6 "Complement component C6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q29RU4 C6 "Complement component C6" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0051092 LpR2 "Lipophorin receptor 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| cd00112 | 35 | cd00112, LDLa, Low Density Lipoprotein Receptor Cl | 1e-07 | |
| pfam00057 | 37 | pfam00057, Ldl_recept_a, Low-density lipoprotein r | 3e-07 | |
| smart00192 | 33 | smart00192, LDLa, Low-density lipoprotein receptor | 6e-07 |
| >gnl|CDD|238060 cd00112, LDLa, Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
Score = 43.0 bits (102), Expect = 1e-07
Identities = 17/32 (53%), Positives = 20/32 (62%)
Query: 27 CRISEYACENGRCISLDRFCNEYDDCGDKSDE 58
C +E+ C NGRCI C+ DDCGD SDE
Sbjct: 1 CPPNEFRCANGRCIPSSWVCDGEDDCGDGSDE 32
|
Length = 35 |
| >gnl|CDD|200964 pfam00057, Ldl_recept_a, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >gnl|CDD|197566 smart00192, LDLa, Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| PF00057 | 37 | Ldl_recept_a: Low-density lipoprotein receptor dom | 99.5 | |
| cd00112 | 35 | LDLa Low Density Lipoprotein Receptor Class A doma | 99.46 | |
| smart00192 | 33 | LDLa Low-density lipoprotein receptor domain class | 99.28 | |
| KOG1215|consensus | 877 | 96.61 | ||
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 96.5 | |
| PF12999 | 176 | PRKCSH-like: Glucosidase II beta subunit-like | 96.35 | |
| KOG1215|consensus | 877 | 94.18 | ||
| KOG2397|consensus | 480 | 87.11 |
| >PF00057 Ldl_recept_a: Low-density lipoprotein receptor domain class A This prints entry is specific to LDL receptor; InterPro: IPR002172 The low-density lipoprotein receptor (LDLR) is the major cholesterol-carrying lipoprotein of plasma, acting to regulate cholesterol homeostasis in mammalian cells | Back alignment and domain information |
|---|
Probab=99.50 E-value=2.2e-14 Score=76.59 Aligned_cols=37 Identities=41% Similarity=0.924 Sum_probs=34.3
Q ss_pred CCCCCCeEeecCCceeccCcccCCcCCCCCCCCCCCCC
Q psy5508 25 HQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYC 62 (85)
Q Consensus 25 ~~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgSDE~~~C 62 (85)
+.|+..+|+|.++.||+..++|||+.||.|||||.+ |
T Consensus 1 ~~C~~~~f~C~~~~CI~~~~~CDg~~DC~dgsDE~~-C 37 (37)
T PF00057_consen 1 PTCPPGEFRCGNGQCIPKSWVCDGIPDCPDGSDEQN-C 37 (37)
T ss_dssp SSSSTTEEEETTSSEEEGGGTTSSSCSSSSSTTTSS-H
T ss_pred CcCcCCeeEcCCCCEEChHHcCCCCCCCCCCccccc-C
Confidence 368999999999999999999999999999999975 5
|
The LDL receptor binds LDL and transports it into cells by acidic endocytosis. In order to be internalized, the receptor-ligand complex must first cluster into clathrin-coated pits. Once inside the cell, the LDLR separates from its ligand, which is degraded in the lysosomes, while the receptor returns to the cell surface []. The internal dissociation of the LDLR with its ligand is mediated by proton pumps within the walls of the endosome that lower the pH. The LDLR is a multi-domain protein, containing: The ligand-binding domain contains seven or eight 40-amino acid LDLR class A (cysteine-rich) repeats, each of which contains a coordinated calcium ion and six cysteine residues involved in disulphide bond formation []. Similar domains have been found in other extracellular and membrane proteins []. The second conserved region contains two EGF repeats, followed by six LDLR class B (YWTD) repeats, and another EGF repeat. The LDLR class B repeats each contain a conserved YWTD motif, and is predicted to form a beta-propeller structure []. This region is critical for ligand release and recycling of the receptor []. The third domain is rich in serine and threonine residues and contains clustered O-linked carbohydrate chains. The fourth domain is the hydrophobic transmembrane region. The fifth domain is the cytoplasmic tail that directs the receptor to clathrin-coated pits. LDLR is closely related in structure to several other receptors, including LRP1, LRP1b, megalin/LRP2, VLDL receptor, lipoprotein receptor, MEGF7/LRP4, and LRP8/apolipoprotein E receptor2); these proteins participate in a wide range of physiological processes, including the regulation of lipid metabolism, protection against atherosclerosis, neurodevelopment, and transport of nutrients and vitamins []. This entry represents the LDLR class A (cyateine-rich) repeat, which contains 6 disulphide-bound cysteines and a highly conserved cluster of negatively charged amino acids, of which many are clustered on one face of the module []. In LDL receptors, the class A domains form the binding site for LDL and calcium. The acidic residues between the fourth and sixth cysteines are important for high-affinity binding of positively charged sequences in LDLR's ligands. The repeat consists of a beta-hairpin structure followed by a series of beta turns. In the absence of calcium, LDL-A domains are unstructured; the bound calcium ion imparts structural integrity. Following these repeats is a 350 residue domain that resembles part of the epidermal growth factor (EGF) precursor. Numerous familial hypercholestorolemia mutations of the LDL receptor alter the calcium coordinating residue of LDL-A domains or other crucial scaffolding residues. ; GO: 0005515 protein binding; PDB: 2I1P_A 3OJY_A 4E0S_B 3T5O_A 4A5W_B 1JRF_A 1K7B_A 1V9U_5 3DPR_E 2KNY_A .... |
| >cd00112 LDLa Low Density Lipoprotein Receptor Class A domain, a cysteine-rich repeat that plays a central role in mammalian cholesterol metabolism; the receptor protein binds LDL and transports it into cells by endocytosis; 7 successive cysteine-rich repeats of about 40 amino acids are present in the N-terminal of this multidomain membrane protein; other homologous domains occur in related receptors, including the very low-density lipoprotein receptor and the LDL receptor-related protein/alpha 2-macroglobulin receptor, and in proteins which are functionally unrelated, such as the C9 component of complement; the binding of calcium is required for in vitro formation of the native disulfide isomer and is necessary in establishing and maintaining the modular structure | Back alignment and domain information |
|---|
| >smart00192 LDLa Low-density lipoprotein receptor domain class A | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >PF12999 PRKCSH-like: Glucosidase II beta subunit-like | Back alignment and domain information |
|---|
| >KOG1215|consensus | Back alignment and domain information |
|---|
| >KOG2397|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 2e-08 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 3e-07 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 3e-08 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 3e-08 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 5e-08 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 6e-08 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 4e-07 | |
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 2e-07 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 4e-06 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 4e-06 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 3e-05 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 4e-05 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 9e-05 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 1e-04 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 1e-04 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 7e-04 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 2e-05 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 2e-05 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 6e-05 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 1e-04 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 3e-04 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 6e-04 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 9e-04 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 4e-05 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 4e-05 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 5e-05 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 2e-04 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 2e-04 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 2e-04 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 3e-04 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 8e-04 |
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
Score = 45.7 bits (109), Expect = 2e-08
Identities = 16/43 (37%), Positives = 25/43 (58%)
Query: 25 HQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCSRSKT 67
C ++++C +GRCI + C+ DDCGD+SDE C+
Sbjct: 3 RTCPPNQFSCASGRCIPISWTCDLDDDCGDRSDESASCAYPTC 45
|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B Length = 82 | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 Length = 44 | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 45 | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} Length = 44 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B Length = 80 | Back alignment and structure |
|---|
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 Length = 37 | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} Length = 565 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Length = 791 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Length = 699 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 Length = 42 | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} Length = 48 | Back alignment and structure |
|---|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} Length = 43 | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} Length = 50 | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 217 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 Length = 215 | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 Length = 47 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| 1ajj_A | 37 | LR5, low-density lipoprotein receptor; LDL recepto | 99.55 | |
| 2jm4_A | 43 | Relaxin receptor 1; LDL-A module, RXFP1 receptor, | 99.54 | |
| 3a7q_B | 44 | Low-density lipoprotein receptor-related protein; | 99.54 | |
| 1d2l_A | 45 | Lipoprotein receptor related protein; ligand bindi | 99.54 | |
| 1cr8_A | 42 | Protein (LOW density lipoprotein receptor related | 99.52 | |
| 2m0p_A | 52 | Low-density lipoprotein receptor-related protein; | 99.52 | |
| 1k7b_A | 47 | Subgroup A ROUS sarcoma virus receptor PG800 and P | 99.49 | |
| 3dpr_E | 39 | LDL-receptor class A 3; human rhinovirus, VLDL-rec | 99.46 | |
| 2i1p_A | 48 | Low-density lipoprotein receptor-related protein 2 | 99.45 | |
| 2knx_A | 50 | Prolow-density lipoprotein receptor-related prote; | 99.45 | |
| 1j8e_A | 44 | Low-density lipoprotein receptor-related protein 1 | 99.43 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.41 | |
| 1jrf_A | 47 | TVA LDL-A module, subgroup A ROUS sarcoma virus re | 99.4 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.33 | |
| 2kny_A | 80 | LRP-1, linker, APO-E; lipoprotein receptor, ligand | 99.3 | |
| 2fyj_A | 82 | Low-density lipoprotein receptor-related protein 1 | 99.23 | |
| 2fcw_B | 80 | LDL receptor, low-density lipoprotein receptor; pr | 99.16 | |
| 2gtl_M | 217 | Hemoglobin linker chain L1; annelid erythrocruorin | 99.13 | |
| 2gtl_O | 215 | Extracellular hemoglobin linker L3 subunit; anneli | 99.1 | |
| 2gtl_N | 220 | Extracellular hemoglobin linker L2 subunit; anneli | 99.08 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.88 | |
| 3ojy_B | 537 | Complement component C8 beta chain; macpf, lipocal | 98.86 | |
| 3ojy_A | 554 | Complement component C8 alpha chain; macpf, lipoca | 98.82 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.63 | |
| 1n7d_A | 699 | LDL receptor, low-density lipoprotein receptor; fa | 98.63 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.61 | |
| 3m0c_C | 791 | LDL receptor, low-density lipoprotein receptor; pr | 98.51 | |
| 3t5o_A | 913 | Complement component C6; macpf, MAC, membrane atta | 98.47 | |
| 2xrc_A | 565 | Human complement factor I; immune system, hydrolas | 98.0 |
| >1ajj_A LR5, low-density lipoprotein receptor; LDL receptor, cysteine-rich module, calcium; 1.70A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
Probab=99.55 E-value=2.7e-15 Score=79.14 Aligned_cols=37 Identities=41% Similarity=0.856 Sum_probs=34.3
Q ss_pred CCCCCeEeecCCceeccCcccCCcCCCCCCCCCCCCCC
Q psy5508 26 QCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCS 63 (85)
Q Consensus 26 ~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgSDE~~~C~ 63 (85)
.|+..+|+|.+|+||+..|+|||+.||.|||||.+ |+
T Consensus 1 ~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgsDE~~-C~ 37 (37)
T 1ajj_A 1 PCSAFEFHCLSGECIHSSWRCDGGPDCKDKSDEEN-CA 37 (37)
T ss_dssp CCCTTCEECTTSCEECGGGTTSSSCCSTTCGGGTT-CC
T ss_pred CCCCCceEcCCCCeechhhccCCCCCCCCCccccC-CC
Confidence 47889999999999999999999999999999986 74
|
| >2jm4_A Relaxin receptor 1; LDL-A module, RXFP1 receptor, LGR7, signaling protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3a7q_B Low-density lipoprotein receptor-related protein; signaling protein; HET: NAG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1d2l_A Lipoprotein receptor related protein; ligand binding, calcium binding, complement-like repeat, signaling protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >1cr8_A Protein (LOW density lipoprotein receptor related protein); ligand binding, calcium binding, LDLR, LRP, lipid binding protein; NMR {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2m0p_A Low-density lipoprotein receptor-related protein; complement type repeat, megalin, LDL receptor FAMI lipid binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1k7b_A Subgroup A ROUS sarcoma virus receptor PG800 and PG950; beta hairpin, 3-10 helix, calcium binding, membrane protein; NMR {Coturnix coturnix} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >3dpr_E LDL-receptor class A 3; human rhinovirus, VLDL-receptor, virus-protein complex, icosahedral virus, ATP-binding, capsid protein; HET: DAO; 3.50A {Homo sapiens} PDB: 1v9u_5* | Back alignment and structure |
|---|
| >2i1p_A Low-density lipoprotein receptor-related protein 2; cysteine-rich repeat, ligand binding domain, calcium CAGE, ligand binding protein; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2knx_A Prolow-density lipoprotein receptor-related prote; LDLR, ligand binding module, ligand binding repeat, compleme repeat, protein binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j8e_A Low-density lipoprotein receptor-related protein 1; ligand binding, calcium binding, complement-like repeat, LRP receptor, signaling protein; 1.85A {Homo sapiens} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >1jrf_A TVA LDL-A module, subgroup A ROUS sarcoma virus receptors PG800 and PG950; disulfide bond, alpha helix, calcium CAGE, signaling protein; NMR {Coturnix japonica} SCOP: g.12.1.1 | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >2kny_A LRP-1, linker, APO-E; lipoprotein receptor, ligand binding module, COMP repeat, calcium, cell membrane, coated PIT, cytoplasm, DEVE protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2fyj_A Low-density lipoprotein receptor-related protein 1; double module, complement type repeat, calcium, beta-2 hairpin, loop-structures; NMR {Homo sapiens} PDB: 2fyl_B | Back alignment and structure |
|---|
| >2fcw_B LDL receptor, low-density lipoprotein receptor; protein-protein complex, RAP, escort protein, calcium- binding; 1.26A {Homo sapiens} SCOP: g.12.1.1 g.12.1.1 PDB: 2kri_B | Back alignment and structure |
|---|
| >2gtl_M Hemoglobin linker chain L1; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_O Extracellular hemoglobin linker L3 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >2gtl_N Extracellular hemoglobin linker L2 subunit; annelid erythrocruorins, respiratory protein, hexagonal bilayer, dihedral D6 symmetry; HET: HEM; 3.50A {Lumbricus terrestris} SCOP: b.61.7.1 g.12.1.1 h.1.32.1 | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_B Complement component C8 beta chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >3ojy_A Complement component C8 alpha chain; macpf, lipocalin, immune system; HET: TPO BMA; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
| >3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3t5o_A Complement component C6; macpf, MAC, membrane attack complex, innate IMMU system, blood, membrane, cytolysin, immune SYST; HET: NAG FUL FUC BGC MAN; 2.87A {Homo sapiens} PDB: 4a5w_B* 4e0s_B* | Back alignment and structure |
|---|
| >2xrc_A Human complement factor I; immune system, hydrolase, conglutinogen activating factor, S protease, complement system; HET: NAG; 2.69A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 85 | ||||
| d1j8ea_ | 44 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-08 | |
| d1d2la_ | 45 | g.12.1.1 (A:) Ligand-binding domain of low-density | 3e-08 | |
| d1f8za_ | 39 | g.12.1.1 (A:) Ligand-binding domain of low-density | 1e-07 | |
| d2fcwb1 | 39 | g.12.1.1 (B:86-124) Ligand-binding domain of low-d | 2e-07 | |
| d2fcwb2 | 39 | g.12.1.1 (B:125-163) Ligand-binding domain of low- | 2e-07 | |
| d1ajja_ | 37 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-07 | |
| d1f5ya1 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 2e-07 | |
| d1xfea2 | 44 | g.12.1.1 (A:1-44) Ligand-binding domain of low-den | 5e-07 | |
| d2gtlm2 | 42 | g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Co | 3e-06 | |
| d1cr8a_ | 42 | g.12.1.1 (A:) Ligand-binding domain of low-density | 2e-05 | |
| d2gtlo2 | 41 | g.12.1.1 (O:60-100) Extracellular hemoglobin linke | 3e-05 | |
| d2gtln2 | 41 | g.12.1.1 (N:61-101) Extracellular hemoglobin linke | 4e-05 | |
| d1v9u5_ | 39 | g.12.1.1 (5:) Very low-density lipoprotein recepto | 7e-05 | |
| d1f5ya2 | 41 | g.12.1.1 (A:45-85) Ligand-binding domain of low-de | 7e-05 | |
| d1k7ba_ | 42 | g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quai | 2e-04 |
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Score = 43.6 bits (103), Expect = 2e-08
Identities = 15/36 (41%), Positives = 21/36 (58%)
Query: 24 HHQCRISEYACENGRCISLDRFCNEYDDCGDKSDEP 59
H C +++ C +GRCI C+ +DCGD SDE
Sbjct: 2 SHSCSSTQFKCNSGRCIPEHWTCDGDNDCGDYSDET 37
|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 37 | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 44 | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 42 | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 42 | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} Length = 41 | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 39 | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} Length = 42 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| d2fcwb1 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.59 | |
| d1ajja_ | 37 | Ligand-binding domain of low-density lipoprotein r | 99.58 | |
| d1f8za_ | 39 | Ligand-binding domain of low-density lipoprotein r | 99.56 | |
| d1f5ya2 | 41 | Ligand-binding domain of low-density lipoprotein r | 99.53 | |
| d1cr8a_ | 42 | Ligand-binding domain of low-density lipoprotein r | 99.52 | |
| d1f5ya1 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.52 | |
| d1d2la_ | 45 | Ligand-binding domain of low-density lipoprotein r | 99.5 | |
| d2gtlo2 | 41 | Extracellular hemoglobin linker l3 subunit {Common | 99.47 | |
| d2fcwb2 | 39 | Ligand-binding domain of low-density lipoprotein r | 99.46 | |
| d1j8ea_ | 44 | Ligand-binding domain of low-density lipoprotein r | 99.45 | |
| d1v9u5_ | 39 | Very low-density lipoprotein receptor {Human (Homo | 99.44 | |
| d1k7ba_ | 42 | soluble Tva ectodomain, sTva47 {Quail (Coturnix co | 99.4 | |
| d1xfea2 | 44 | Ligand-binding domain of low-density lipoprotein r | 99.39 | |
| d2gtlm2 | 42 | Hemoglobin linker chain l1 {Common earthworm (Lumb | 99.36 | |
| d2gtln2 | 41 | Extracellular hemoglobin linker l2 subunit {Common | 99.34 |
| >d2fcwb1 g.12.1.1 (B:86-124) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: LDL receptor-like module superfamily: LDL receptor-like module family: LDL receptor-like module domain: Ligand-binding domain of low-density lipoprotein receptor species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59 E-value=2.3e-16 Score=83.21 Aligned_cols=38 Identities=39% Similarity=0.917 Sum_probs=35.4
Q ss_pred CCCCCCeEeecCCceeccCcccCCcCCCCCCCCCCCCCC
Q psy5508 25 HQCRISEYACENGRCISLDRFCNEYDDCGDKSDEPRYCS 63 (85)
Q Consensus 25 ~~C~~~~f~C~~g~Ci~~~~~CDg~~DC~DgSDE~~~C~ 63 (85)
+.|++++|+|.+|+||+.+++|||..||.|||||.+ |+
T Consensus 1 rtC~~~~f~C~~g~CI~~~~~CDg~~DC~DgsDE~~-Cp 38 (39)
T d2fcwb1 1 KTCSQAEFRCHDGKCISRQFVCDSDRDCLDGSDEAS-CP 38 (39)
T ss_dssp CCCCTTEEECTTSCEEEGGGTTSSSCCSTTCTTTTT-HH
T ss_pred CcCCCCCEEcCCCCEEcchhcCcCcCcCcCCchhcC-CC
Confidence 368999999999999999999999999999999986 74
|
| >d1ajja_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f8za_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya2 g.12.1.1 (A:45-85) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cr8a_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f5ya1 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2la_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlo2 g.12.1.1 (O:60-100) Extracellular hemoglobin linker l3 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2fcwb2 g.12.1.1 (B:125-163) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v9u5_ g.12.1.1 (5:) Very low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k7ba_ g.12.1.1 (A:) soluble Tva ectodomain, sTva47 {Quail (Coturnix coturnix) [TaxId: 9091]} | Back information, alignment and structure |
|---|
| >d1xfea2 g.12.1.1 (A:1-44) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gtlm2 g.12.1.1 (M:60-101) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|
| >d2gtln2 g.12.1.1 (N:61-101) Extracellular hemoglobin linker l2 subunit {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} | Back information, alignment and structure |
|---|