Psyllid ID: psy5598


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MSISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKDCCSDL
ccccHHHHHHHHHHHHHHHccccccEEEcEEEEEEccEEEEEEcccccccEEEEEEEccccEEEEEEEEEEccEEEEEEccccccccccccEEEEcccEEEEEccccHHHcccccccccccccccccc
ccccHHHHHHHHHHHHHccccccccEEEEEEEcccccEEEEEccccccHcEEEEEEcccccEEccEEEEEcccEEEEEEEEccccccccccEEEEEcccEEccccHHHHccEEccccccccccccccc
MSISSKQALRENVLAVTRdyisqprityktvsgvngplvildevkfpkYAEIVQLRLndgsyragqVLEVSGSKAVVQVFEgtsgidakntvceftgdilrtpvsedmlgrvfngsgkpidkdccsdl
msisskqalRENVLAVtrdyisqprityktvsgvngPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEgtsgidakntvCEFTGDIlrtpvsedmlgrvfngsgkpidkdccsdl
MSISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKDCCSDL
***********NVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVF***************
*************LAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID***CS**
********LRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKDCCSDL
*SISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKDCCS*L
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKDCCSDL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query128 2.2.26 [Sep-21-2011]
P31409 490 V-type proton ATPase subu yes N/A 0.937 0.244 0.875 3e-57
P31401 494 V-type proton ATPase subu N/A N/A 0.945 0.244 0.851 7e-57
P31410 494 V-type proton ATPase subu N/A N/A 0.945 0.244 0.826 2e-55
P31408 511 V-type proton ATPase subu yes N/A 0.882 0.221 0.849 1e-51
Q5R5V5 511 V-type proton ATPase subu yes N/A 0.882 0.221 0.849 1e-51
P62815 511 V-type proton ATPase subu yes N/A 0.882 0.221 0.849 1e-51
P62814 511 V-type proton ATPase subu yes N/A 0.882 0.221 0.849 1e-51
P21281 511 V-type proton ATPase subu yes N/A 0.882 0.221 0.849 1e-51
P31407 513 V-type proton ATPase subu no N/A 0.929 0.231 0.756 9e-48
P15313 513 V-type proton ATPase subu no N/A 0.898 0.224 0.756 2e-47
>sp|P31409|VATB_DROME V-type proton ATPase subunit B OS=Drosophila melanogaster GN=Vha55 PE=2 SV=1 Back     alignment and function desciption
 Score =  220 bits (560), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 105/120 (87%), Positives = 117/120 (97%)

Query: 3   ISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSY 62
           ++++QA RE+VLAV+RD+ISQPR+TYKTVSGVNGPLVILDEVKFPK+AEIVQLRL DG+ 
Sbjct: 1   MNAQQAQREHVLAVSRDFISQPRLTYKTVSGVNGPLVILDEVKFPKFAEIVQLRLADGTV 60

Query: 63  RAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 122
           R+GQVLEVSGSKAVVQVFEGTSGIDAKNT+CEFTGDILRTPVSEDMLGRVFNGSGKPIDK
Sbjct: 61  RSGQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 120




Non-catalytic subunit of the peripheral V1 complex of vacuolar ATPase. V-ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells.
Drosophila melanogaster (taxid: 7227)
>sp|P31401|VATB_MANSE V-type proton ATPase subunit B OS=Manduca sexta GN=VHA55 PE=2 SV=1 Back     alignment and function description
>sp|P31410|VATB_HELVI V-type proton ATPase subunit B OS=Heliothis virescens GN=VHA55 PE=2 SV=1 Back     alignment and function description
>sp|P31408|VATB2_BOVIN V-type proton ATPase subunit B, brain isoform OS=Bos taurus GN=ATP6V1B2 PE=1 SV=3 Back     alignment and function description
>sp|Q5R5V5|VATB2_PONAB V-type proton ATPase subunit B, brain isoform OS=Pongo abelii GN=ATP6V1B2 PE=2 SV=1 Back     alignment and function description
>sp|P62815|VATB2_RAT V-type proton ATPase subunit B, brain isoform OS=Rattus norvegicus GN=Atp6v1b2 PE=1 SV=1 Back     alignment and function description
>sp|P62814|VATB2_MOUSE V-type proton ATPase subunit B, brain isoform OS=Mus musculus GN=Atp6v1b2 PE=1 SV=1 Back     alignment and function description
>sp|P21281|VATB2_HUMAN V-type proton ATPase subunit B, brain isoform OS=Homo sapiens GN=ATP6V1B2 PE=1 SV=3 Back     alignment and function description
>sp|P31407|VATB1_BOVIN V-type proton ATPase subunit B, kidney isoform OS=Bos taurus GN=ATP6V1B1 PE=1 SV=1 Back     alignment and function description
>sp|P15313|VATB1_HUMAN V-type proton ATPase subunit B, kidney isoform OS=Homo sapiens GN=ATP6V1B1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
157111261 496 ATP synthase subunit beta vacuolar [Aede 0.945 0.243 0.892 3e-57
242011359 496 vacuolar ATP synthase subunit B, putativ 0.953 0.245 0.893 9e-57
170034654 492 V-type ATP synthase beta chain [Culex qu 0.953 0.247 0.877 3e-56
91090031 496 PREDICTED: similar to H(+)-transporting 0.945 0.243 0.876 9e-56
312373433 498 hypothetical protein AND_17443 [Anophele 0.945 0.242 0.867 1e-55
347968745 498 AGAP002884-PA [Anopheles gambiae str. PE 0.945 0.242 0.867 1e-55
17136796 490 vacuolar H[+]-ATPase 55kD B subunit, iso 0.937 0.244 0.875 2e-55
307203836 495 Vacuolar ATP synthase subunit B [Harpegn 0.945 0.244 0.876 2e-55
383847947 495 PREDICTED: V-type proton ATPase subunit 0.945 0.244 0.867 3e-55
195329486 490 GM25995 [Drosophila sechellia] gi|195571 0.937 0.244 0.866 3e-55
>gi|157111261|ref|XP_001651458.1| ATP synthase subunit beta vacuolar [Aedes aegypti] gi|4680480|gb|AAD27666.1|AF092934_1 vacuolar ATPase B subunit [Aedes aegypti] gi|108878452|gb|EAT42677.1| AAEL005798-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  226 bits (575), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 108/121 (89%), Positives = 118/121 (97%)

Query: 2   SISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGS 61
           +IS+ QA +E+VLAV+RD+ISQPR+TYKTVSGVNGPLVILDEVKFPK+AEIVQLRLNDG+
Sbjct: 6   TISAHQAAKEHVLAVSRDFISQPRLTYKTVSGVNGPLVILDEVKFPKFAEIVQLRLNDGT 65

Query: 62  YRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID 121
            R+GQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID
Sbjct: 66  VRSGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID 125

Query: 122 K 122
           K
Sbjct: 126 K 126




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242011359|ref|XP_002426420.1| vacuolar ATP synthase subunit B, putative [Pediculus humanus corporis] gi|212510519|gb|EEB13682.1| vacuolar ATP synthase subunit B, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170034654|ref|XP_001845188.1| V-type ATP synthase beta chain [Culex quinquefasciatus] gi|2921502|gb|AAC04806.1| B subunit V-ATPase [Culex quinquefasciatus] gi|167876059|gb|EDS39442.1| V-type ATP synthase beta chain [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|91090031|ref|XP_967844.1| PREDICTED: similar to H(+)-transporting ATPase [Tribolium castaneum] gi|270014269|gb|EFA10717.1| hypothetical protein TcasGA2_TC012133 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312373433|gb|EFR21178.1| hypothetical protein AND_17443 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|347968745|ref|XP_312029.3| AGAP002884-PA [Anopheles gambiae str. PEST] gi|333467862|gb|EAA08175.4| AGAP002884-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|17136796|ref|NP_476908.1| vacuolar H[+]-ATPase 55kD B subunit, isoform B [Drosophila melanogaster] gi|24646341|ref|NP_731726.1| vacuolar H[+]-ATPase 55kD B subunit, isoform A [Drosophila melanogaster] gi|281361666|ref|NP_001163597.1| vacuolar H[+]-ATPase 55kD B subunit, isoform C [Drosophila melanogaster] gi|194764831|ref|XP_001964531.1| GF23001 [Drosophila ananassae] gi|194901678|ref|XP_001980379.1| GG17111 [Drosophila erecta] gi|195110565|ref|XP_001999850.1| GI24752 [Drosophila mojavensis] gi|195450853|ref|XP_002072660.1| GK13566 [Drosophila willistoni] gi|195500542|ref|XP_002097416.1| GE24501 [Drosophila yakuba] gi|401325|sp|P31409.1|VATB_DROME RecName: Full=V-type proton ATPase subunit B; Short=V-ATPase subunit B; AltName: Full=V-ATPase 55 kDa subunit; AltName: Full=Vacuolar proton pump subunit B gi|8810|emb|CAA48034.1| vacuolar ATPase B subunit [Drosophila melanogaster] gi|7299652|gb|AAF54836.1| vacuolar H[+]-ATPase 55kD B subunit, isoform A [Drosophila melanogaster] gi|7299653|gb|AAF54837.1| vacuolar H[+]-ATPase 55kD B subunit, isoform B [Drosophila melanogaster] gi|15291557|gb|AAK93047.1| GH27148p [Drosophila melanogaster] gi|25009768|gb|AAN71057.1| AT12604p [Drosophila melanogaster] gi|190614803|gb|EDV30327.1| GF23001 [Drosophila ananassae] gi|190652082|gb|EDV49337.1| GG17111 [Drosophila erecta] gi|193916444|gb|EDW15311.1| GI24752 [Drosophila mojavensis] gi|194168745|gb|EDW83646.1| GK13566 [Drosophila willistoni] gi|194183517|gb|EDW97128.1| GE24501 [Drosophila yakuba] gi|220945750|gb|ACL85418.1| Vha55-PA [synthetic construct] gi|220955454|gb|ACL90270.1| Vha55-PA [synthetic construct] gi|272476951|gb|ACZ94894.1| vacuolar H[+]-ATPase 55kD B subunit, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|307203836|gb|EFN82772.1| Vacuolar ATP synthase subunit B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383847947|ref|XP_003699614.1| PREDICTED: V-type proton ATPase subunit B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195329486|ref|XP_002031442.1| GM25995 [Drosophila sechellia] gi|195571381|ref|XP_002103682.1| GD20555 [Drosophila simulans] gi|194120385|gb|EDW42428.1| GM25995 [Drosophila sechellia] gi|194199609|gb|EDX13185.1| GD20555 [Drosophila simulans] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query128
FB|FBgn0005671 490 Vha55 "Vacuolar H[+]-ATPase 55 0.937 0.244 0.875 7.2e-52
ZFIN|ZDB-GENE-030711-4 509 atp6v1b2 "ATPase, H+ transport 0.921 0.231 0.857 1.2e-49
UNIPROTKB|P31408 511 ATP6V1B2 "V-type proton ATPase 0.882 0.221 0.849 6.9e-47
UNIPROTKB|E2RAC6 511 ATP6V1B2 "Uncharacterized prot 0.882 0.221 0.849 6.9e-47
UNIPROTKB|H0YC04199 ATP6V1B2 "V-type proton ATPase 0.882 0.567 0.849 6.9e-47
UNIPROTKB|P21281 511 ATP6V1B2 "V-type proton ATPase 0.882 0.221 0.849 6.9e-47
UNIPROTKB|F1RMZ8 511 LOC100739134 "Uncharacterized 0.882 0.221 0.849 6.9e-47
UNIPROTKB|Q5R5V5 511 ATP6V1B2 "V-type proton ATPase 0.882 0.221 0.849 6.9e-47
MGI|MGI:109618 511 Atp6v1b2 "ATPase, H+ transport 0.882 0.221 0.849 6.9e-47
RGD|620284 511 Atp6v1b2 "ATPase, H transporti 0.882 0.221 0.849 6.9e-47
FB|FBgn0005671 Vha55 "Vacuolar H[+]-ATPase 55kD subunit" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 538 (194.4 bits), Expect = 7.2e-52, P = 7.2e-52
 Identities = 105/120 (87%), Positives = 117/120 (97%)

Query:     3 ISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSY 62
             ++++QA RE+VLAV+RD+ISQPR+TYKTVSGVNGPLVILDEVKFPK+AEIVQLRL DG+ 
Sbjct:     1 MNAQQAQREHVLAVSRDFISQPRLTYKTVSGVNGPLVILDEVKFPKFAEIVQLRLADGTV 60

Query:    63 RAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 122
             R+GQVLEVSGSKAVVQVFEGTSGIDAKNT+CEFTGDILRTPVSEDMLGRVFNGSGKPIDK
Sbjct:    61 RSGQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 120




GO:0000221 "vacuolar proton-transporting V-type ATPase, V1 domain" evidence=ISS;NAS
GO:0015992 "proton transport" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0046034 "ATP metabolic process" evidence=IEA
GO:0033181 "plasma membrane proton-transporting V-type ATPase complex" evidence=IMP
GO:0005769 "early endosome" evidence=IDA
GO:0046961 "proton-transporting ATPase activity, rotational mechanism" evidence=IGI;IDA
GO:0048471 "perinuclear region of cytoplasm" evidence=IDA
GO:0005903 "brush border" evidence=IDA
GO:0007035 "vacuolar acidification" evidence=IDA
GO:0015991 "ATP hydrolysis coupled proton transport" evidence=IGI
GO:0005886 "plasma membrane" evidence=IDA
ZFIN|ZDB-GENE-030711-4 atp6v1b2 "ATPase, H+ transporting, lysosomal V1 subunit B2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P31408 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RAC6 ATP6V1B2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|H0YC04 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P21281 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMZ8 LOC100739134 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R5V5 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
MGI|MGI:109618 Atp6v1b2 "ATPase, H+ transporting, lysosomal V1 subunit B2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620284 Atp6v1b2 "ATPase, H transporting, lysosomal V1 subunit B2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
B6YV15VATB_THEONNo assigned EC number0.54080.76560.2107yesN/A
B5XJH4VATB_STRPZNo assigned EC number0.54250.73430.1995yesN/A
Q8SR34VATB_ENCCUNo assigned EC number0.61610.77340.2075yesN/A
P31408VATB2_BOVINNo assigned EC number0.84950.88280.2211yesN/A
P31409VATB_DROMENo assigned EC number0.8750.93750.2448yesN/A
P62815VATB2_RATNo assigned EC number0.84950.88280.2211yesN/A
P62814VATB2_MOUSENo assigned EC number0.84950.88280.2211yesN/A
Q9SZN1VATB2_ARATHNo assigned EC number0.72910.750.1971yesN/A
Q5R5V5VATB2_PONABNo assigned EC number0.84950.88280.2211yesN/A
Q5JIR2VATB_PYRKONo assigned EC number0.53060.76560.2107yesN/A
Q1JIX4VATB_STRPDNo assigned EC number0.54250.73430.1995yesN/A
P11574VATB1_ARATHNo assigned EC number0.750.750.1975yesN/A
Q25691VATB_PLAFANo assigned EC number0.63020.92960.2408yesN/A
P0DA09VATB_STRPQNo assigned EC number0.54250.73430.1995yesN/A
P21281VATB2_HUMANNo assigned EC number0.84950.88280.2211yesN/A
Q8TUT0VATB_METKANo assigned EC number0.53190.73430.0949yesN/A
A3CK49VATB_STRSVNo assigned EC number0.57440.73430.2025yesN/A
Q19626VATB_CAEELNo assigned EC number0.75920.84370.2199yesN/A
P16140VATB_YEASTNo assigned EC number0.62800.94530.2340yesN/A
C5A337VATB_THEGJNo assigned EC number0.53060.76560.2116yesN/A
A2RC98VATB_STRPGNo assigned EC number0.54250.73430.1995yesN/A
P31411VATB_SCHPONo assigned EC number0.63060.86710.2206yesN/A
Q1JDW9VATB_STRPBNo assigned EC number0.54250.73430.1995yesN/A
Q8W4E2VATB3_ARATHNo assigned EC number0.750.750.1971yesN/A
O57729VATB_PYRHONo assigned EC number0.52120.73430.2021yesN/A
Q1J8S4VATB_STRPFNo assigned EC number0.54250.73430.1995yesN/A
Q76NU1VATB_DICDINo assigned EC number0.63470.89840.2332yesN/A
Q1JNS7VATB_STRPCNo assigned EC number0.54250.73430.1995yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
TIGR01040 466 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B 2e-63
COG1156 463 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su 1e-42
PRK04196 460 PRK04196, PRK04196, V-type ATP synthase subunit B; 6e-41
TIGR01041 458 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, 1e-33
PRK02118 436 PRK02118, PRK02118, V-type ATP synthase subunit B; 2e-14
COG1157 441 COG1157, FliI, Flagellar biosynthesis/type III sec 2e-10
PRK04192 586 PRK04192, PRK04192, V-type ATP synthase subunit A; 4e-10
cd01135 276 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- 5e-09
TIGR03496 411 TIGR03496, FliI_clade1, flagellar protein export A 2e-08
pfam0287469 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta 5e-08
TIGR01043 578 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, 1e-07
TIGR01026 440 TIGR01026, fliI_yscN, ATPase FliI/YscN family 1e-07
TIGR03498 418 TIGR03498, FliI_clade3, flagellar protein export A 2e-07
COG1155 588 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su 2e-07
TIGR02546 422 TIGR02546, III_secr_ATP, type III secretion appara 5e-07
PRK14698 1017 PRK14698, PRK14698, V-type ATP synthase subunit A; 1e-06
COG0056 504 COG0056, AtpA, F0F1-type ATP synthase, alpha subun 1e-05
PRK12597 461 PRK12597, PRK12597, F0F1 ATP synthase subunit beta 3e-05
PRK09281 502 PRK09281, PRK09281, F0F1 ATP synthase subunit alph 3e-05
PRK13343 502 PRK13343, PRK13343, F0F1 ATP synthase subunit alph 2e-04
TIGR01042 591 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A 2e-04
TIGR00962 501 TIGR00962, atpA, proton translocating ATP synthase 3e-04
CHL00059 485 CHL00059, atpA, ATP synthase CF1 alpha subunit 3e-04
TIGR03497 413 TIGR03497, FliI_clade2, flagellar protein export A 6e-04
COG0055 468 COG0055, AtpD, F0F1-type ATP synthase, beta subuni 0.001
PRK06820 440 PRK06820, PRK06820, type III secretion system ATPa 0.002
PRK06936 439 PRK06936, PRK06936, type III secretion system ATPa 0.002
TIGR01039 461 TIGR01039, atpD, ATP synthase, F1 beta subunit 0.002
PRK09280 463 PRK09280, PRK09280, F0F1 ATP synthase subunit beta 0.003
PRK08472 434 PRK08472, fliI, flagellum-specific ATP synthase; V 0.004
PRK08927 442 PRK08927, fliI, flagellum-specific ATP synthase; V 0.004
PRK07594 433 PRK07594, PRK07594, type III secretion system ATPa 0.004
>gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
 Score =  199 bits (509), Expect = 2e-63
 Identities = 82/96 (85%), Positives = 88/96 (91%)

Query: 27  TYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGI 86
            Y+TVSGVNGPLVILD VKFP++AEIV L L DG+ R+GQVLEVSG+KAVVQVFEGTSGI
Sbjct: 1   EYRTVSGVNGPLVILDNVKFPRFAEIVNLTLPDGTVRSGQVLEVSGNKAVVQVFEGTSGI 60

Query: 87  DAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 122
           DAK T CEFTGDILRTPVSEDMLGRVFNGSGKPIDK
Sbjct: 61  DAKKTTCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 96


This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase [Transport and binding proteins, Cations and iron carrying compounds]. Length = 466

>gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit Back     alignment and domain information
>gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B Back     alignment and domain information
>gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain Back     alignment and domain information
>gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit Back     alignment and domain information
>gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family Back     alignment and domain information
>gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit Back     alignment and domain information
>gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI Back     alignment and domain information
>gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated Back     alignment and domain information
>gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional Back     alignment and domain information
>gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit Back     alignment and domain information
>gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated Back     alignment and domain information
>gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 128
PRK09099 441 type III secretion system ATPase; Provisional 99.91
COG1157 441 FliI Flagellar biosynthesis/type III secretory pat 99.91
PRK07196 434 fliI flagellum-specific ATP synthase; Validated 99.91
PRK06936 439 type III secretion system ATPase; Provisional 99.91
PRK08972 444 fliI flagellum-specific ATP synthase; Validated 99.91
PRK08472 434 fliI flagellum-specific ATP synthase; Validated 99.91
PRK04196 460 V-type ATP synthase subunit B; Provisional 99.9
PRK07721 438 fliI flagellum-specific ATP synthase; Validated 99.9
PRK08927 442 fliI flagellum-specific ATP synthase; Validated 99.9
PRK09281 502 F0F1 ATP synthase subunit alpha; Validated 99.9
PRK05688 451 fliI flagellum-specific ATP synthase; Validated 99.9
PRK06002 450 fliI flagellum-specific ATP synthase; Validated 99.9
TIGR03324 497 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a 99.9
PRK05922 434 type III secretion system ATPase; Validated 99.9
PRK13343 502 F0F1 ATP synthase subunit alpha; Provisional 99.9
PRK07960 455 fliI flagellum-specific ATP synthase; Validated 99.9
TIGR02546 422 III_secr_ATP type III secretion apparatus H+-trans 99.9
TIGR01040 466 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th 99.89
PRK06820 440 type III secretion system ATPase; Validated 99.89
TIGR00962 501 atpA proton translocating ATP synthase, F1 alpha s 99.89
PRK06315 442 type III secretion system ATPase; Provisional 99.89
TIGR01041 458 ATP_syn_B_arch ATP synthase archaeal, B subunit. A 99.89
PRK02118 436 V-type ATP synthase subunit B; Provisional 99.89
TIGR03498 418 FliI_clade3 flagellar protein export ATPase FliI. 99.88
TIGR03496 411 FliI_clade1 flagellar protein export ATPase FliI. 99.88
TIGR03497 413 FliI_clade2 flagellar protein export ATPase FliI. 99.88
TIGR01026 440 fliI_yscN ATPase FliI/YscN family. This family of 99.88
PRK07594 433 type III secretion system ATPase SsaN; Validated 99.87
PRK06793 432 fliI flagellum-specific ATP synthase; Validated 99.87
PRK12597 461 F0F1 ATP synthase subunit beta; Provisional 99.86
PRK07165 507 F0F1 ATP synthase subunit alpha; Validated 99.86
CHL00059 485 atpA ATP synthase CF1 alpha subunit 99.86
PRK09280 463 F0F1 ATP synthase subunit beta; Validated 99.86
PRK08149 428 ATP synthase SpaL; Validated 99.86
TIGR01043 578 ATP_syn_A_arch ATP synthase archaeal, A subunit. A 99.86
PRK04192 586 V-type ATP synthase subunit A; Provisional 99.85
TIGR01042 591 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th 99.85
CHL00060 494 atpB ATP synthase CF1 beta subunit 99.85
TIGR01039 461 atpD ATP synthase, F1 beta subunit. The sequences 99.84
COG1156 463 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E 99.83
PRK14698 1017 V-type ATP synthase subunit A; Provisional 99.82
PTZ00185 574 ATPase alpha subunit; Provisional 99.81
TIGR03305 449 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit 99.8
COG0056 504 AtpA F0F1-type ATP synthase, alpha subunit [Energy 99.78
KOG1351|consensus 489 99.72
COG1155 588 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E 99.7
KOG1352|consensus 618 99.52
COG0055 468 AtpD F0F1-type ATP synthase, beta subunit [Energy 99.48
PF0287469 ATP-synt_ab_N: ATP synthase alpha/beta family, bet 99.32
KOG1353|consensus 340 99.28
KOG1350|consensus 521 99.23
PRK12608 380 transcription termination factor Rho; Provisional 97.04
PF0937891 HAS-barrel: HAS barrel domain; InterPro: IPR018538 92.82
>PRK09099 type III secretion system ATPase; Provisional Back     alignment and domain information
Probab=99.91  E-value=7.5e-24  Score=178.28  Aligned_cols=111  Identities=25%  Similarity=0.322  Sum_probs=97.3

Q ss_pred             hHHHHhcccCCCCceeeeEEEEEECCEEEEEcCCCCCcCcEEEEEeCCCce-EEEEEEEEeCCEEEEEEccCCCCcccCC
Q psy5598          12 NVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSY-RAGQVLEVSGSKAVVQVFEGTSGIDAKN   90 (128)
Q Consensus        12 ~~~~~~~~~~~~~~~~~G~V~~I~G~~i~v~g~~~~~iGe~~~i~~~~~~~-~~geVv~~~~~~v~l~~~~~~~Gi~~G~   90 (128)
                      .+.++++.  ..+.+.+|+|++|.|++++++|+. +++||+|.|...++.. ..|||++|+++.+.+|||+++.||+.| 
T Consensus        11 ~~~~~~~~--~~~~~~~G~V~~v~g~~i~~~g~~-~~~ge~~~i~~~~g~~~~~~eVv~~~~~~~~l~~~~~t~gi~~g-   86 (441)
T PRK09099         11 ALERELAA--LPAVRRTGKVVEVIGTLLRVSGLD-VTLGELCELRQRDGTLLQRAEVVGFSRDVALLSPFGELGGLSRG-   86 (441)
T ss_pred             HHHHHHhc--CCcceEeeEEEEEECCEEEEeccC-CCCCCEEEEecCCCCeeeEEEEEEEECCEEEEEEccCCcCCCCC-
Confidence            34444443  367778999999999999999985 9999999995434443 789999999999999999999999999 


Q ss_pred             cEEEEcCCeeeEeCCCCCccceecCCcccccCCCCC
Q psy5598          91 TVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKDCCS  126 (128)
Q Consensus        91 ~~V~~tg~~~~Vpvg~~lLGRViD~lG~PlDg~~~~  126 (128)
                      ++|.++|++++||+|++|||||+|++|+|||+++++
T Consensus        87 ~~V~~tg~~~~v~vg~~lLGrV~d~~G~piD~~~~~  122 (441)
T PRK09099         87 TRVIGLGRPLSVPVGPALLGRVIDGLGEPIDGGGPL  122 (441)
T ss_pred             CEEEeCCCccEEEeccccccCEEcccCCccCCCCCC
Confidence            599999999999999999999999999999998764



>COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK07196 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06936 type III secretion system ATPase; Provisional Back     alignment and domain information
>PRK08972 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08472 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK04196 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>PRK07721 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK08927 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK09281 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>PRK05688 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK06002 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha Back     alignment and domain information
>PRK05922 type III secretion system ATPase; Validated Back     alignment and domain information
>PRK13343 F0F1 ATP synthase subunit alpha; Provisional Back     alignment and domain information
>PRK07960 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase Back     alignment and domain information
>TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit Back     alignment and domain information
>PRK06820 type III secretion system ATPase; Validated Back     alignment and domain information
>TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit Back     alignment and domain information
>PRK06315 type III secretion system ATPase; Provisional Back     alignment and domain information
>TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit Back     alignment and domain information
>PRK02118 V-type ATP synthase subunit B; Provisional Back     alignment and domain information
>TIGR03498 FliI_clade3 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03496 FliI_clade1 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR03497 FliI_clade2 flagellar protein export ATPase FliI Back     alignment and domain information
>TIGR01026 fliI_yscN ATPase FliI/YscN family Back     alignment and domain information
>PRK07594 type III secretion system ATPase SsaN; Validated Back     alignment and domain information
>PRK06793 fliI flagellum-specific ATP synthase; Validated Back     alignment and domain information
>PRK12597 F0F1 ATP synthase subunit beta; Provisional Back     alignment and domain information
>PRK07165 F0F1 ATP synthase subunit alpha; Validated Back     alignment and domain information
>CHL00059 atpA ATP synthase CF1 alpha subunit Back     alignment and domain information
>PRK09280 F0F1 ATP synthase subunit beta; Validated Back     alignment and domain information
>PRK08149 ATP synthase SpaL; Validated Back     alignment and domain information
>TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit Back     alignment and domain information
>PRK04192 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit Back     alignment and domain information
>CHL00060 atpB ATP synthase CF1 beta subunit Back     alignment and domain information
>TIGR01039 atpD ATP synthase, F1 beta subunit Back     alignment and domain information
>COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] Back     alignment and domain information
>PRK14698 V-type ATP synthase subunit A; Provisional Back     alignment and domain information
>PTZ00185 ATPase alpha subunit; Provisional Back     alignment and domain information
>TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta Back     alignment and domain information
>COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>KOG1351|consensus Back     alignment and domain information
>COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] Back     alignment and domain information
>KOG1352|consensus Back     alignment and domain information
>COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] Back     alignment and domain information
>PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane Back     alignment and domain information
>KOG1353|consensus Back     alignment and domain information
>KOG1350|consensus Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PF09378 HAS-barrel: HAS barrel domain; InterPro: IPR018538 The HAS barrel is named after HerA-ATP Synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
3vr6_D 465 Crystal Structure Of Amp-pnp Bound Enterococcus Hir 2e-22
3vr2_D 465 Crystal Structure Of Nucleotide-free A3b3 Complex F 8e-21
2rkw_A 469 Intermediate Position Of Atp On Its Trail To The Bi 1e-19
3tiv_A 460 Crystal Structure Of Subunit B Mutant N157a Of The 2e-19
3ssa_A 460 Crystal Structure Of Subunit B Mutant N157t Of The 2e-19
2c61_A 469 Crystal Structure Of The Non-Catalytic B Subunit Of 2e-19
3tgw_A 460 Crystal Structure Of Subunit B Mutant H156a Of The 2e-19
3a5c_D 478 Inter-Subunit Interaction And Quaternary Rearrangem 2e-17
3gqb_B 464 Crystal Structure Of The A3b3 Complex From V-atpase 3e-17
3se0_A 588 Structural Characterization Of The Subunit A Mutant 3e-05
3sdz_A 588 Structural Characterization Of The Subunit A Mutant 3e-05
1vdz_A 588 Crystal Structure Of A-Type Atpase Catalytic Subuni 3e-05
3m4y_A 588 Structural Characterization Of The Subunit A Mutant 3e-05
3qjy_A 588 Crystal Structure Of P-Loop G234a Mutant Of Subunit 3e-05
3qia_A 588 Crystal Structure Of P-Loop G237a Mutant Of Subunit 3e-05
3mfy_A 588 Structural Characterization Of The Subunit A Mutant 3e-05
3i4l_A 588 Structural Characterization For The Nucleotide Bind 3e-05
3nd8_A 588 Structural Characterization For The Nucleotide Bind 3e-05
3qg1_A 588 Crystal Structure Of P-Loop G239a Mutant Of Subunit 3e-05
3nd9_A 588 Structural Characterization For The Nucleotide Bind 3e-05
3ikj_A 588 Structural Characterization For The Nucleotide Bind 3e-05
>pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 Back     alignment and structure

Iteration: 1

Score = 100 bits (250), Expect = 2e-22, Method: Composition-based stats. Identities = 48/94 (51%), Positives = 68/94 (72%) Query: 28 YKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGID 87 Y+T+ V GPL+ +++V KY E++++R+ +G R GQVLEV KA+VQ+FEGTSGI+ Sbjct: 12 YRTIKEVVGPLMAVEKVSGVKYEELIEVRMQNGEIRRGQVLEVQEDKAMVQIFEGTSGIN 71 Query: 88 AKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID 121 KN+ F G L+ VSEDM+GRVF+G G+P D Sbjct: 72 LKNSSVRFLGHPLQLGVSEDMIGRVFDGLGRPKD 105
>pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 Back     alignment and structure
>pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 Back     alignment and structure
>pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 Back     alignment and structure
>pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 Back     alignment and structure
>pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 Back     alignment and structure
>pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 Back     alignment and structure
>pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 Back     alignment and structure
>pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 Back     alignment and structure
>pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 Back     alignment and structure
>pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query128
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 3e-43
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 1e-41
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 1e-10
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 4e-08
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 4e-07
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 3e-05
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 4e-05
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 4e-05
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 4e-05
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 5e-05
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 Back     alignment and structure
 Score =  146 bits (370), Expect = 3e-43
 Identities = 42/102 (41%), Positives = 60/102 (58%)

Query: 21  ISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVF 80
           +   +  Y  ++ ++GPL+ ++  K   Y  IV ++   G  R GQV+EVS   AV+QVF
Sbjct: 1   MDLLKKEYTGITYISGPLLFVENAKDLAYGAIVDIKDGTGRVRGGQVIEVSEEYAVIQVF 60

Query: 81  EGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 122
           E T+G+D   T      D+ R  VS++MLGR FNG GKPID 
Sbjct: 61  EETTGLDLATTSVSLVEDVARLGVSKEMLGRRFNGIGKPIDG 102


>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 99.91
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 99.91
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 99.91
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 99.9
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 99.9
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 99.9
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 99.9
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 99.9
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 99.86
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 99.86
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 99.85
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 99.85
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 99.85
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 99.83
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 99.82
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
Probab=99.91  E-value=2.8e-24  Score=180.51  Aligned_cols=101  Identities=43%  Similarity=0.653  Sum_probs=94.5

Q ss_pred             ceeeeEEEEEECCEEEEEcCCCCCcCcEEEEEeCCCceEEEEEEEEeCCEEEEEEccCCCCcc-cCCcEEEEcCCeeeEe
Q psy5598          25 RITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGID-AKNTVCEFTGDILRTP  103 (128)
Q Consensus        25 ~~~~G~V~~I~G~~i~v~g~~~~~iGe~~~i~~~~~~~~~geVv~~~~~~v~l~~~~~~~Gi~-~G~~~V~~tg~~~~Vp  103 (128)
                      .++||+|++|.|+++++.|++++++||+|+|..+++..+.|||++|+++.+.++||+++.||+ .| ++|++||++++||
T Consensus         5 ~~~~g~V~~v~g~~v~v~gl~~~~~ge~v~i~~~~g~~~~geVv~~~~~~~~~~~~~~~~gl~~~g-~~V~~tg~~~~vp   83 (464)
T 3gqb_B            5 KKEYTGITYISGPLLFVENAKDLAYGAIVDIKDGTGRVRGGQVIEVSEEYAVIQVFEETTGLDLAT-TSVSLVEDVARLG   83 (464)
T ss_dssp             CCCBCCEEEEETTEEEEESCTTSCTTCEEEEECTTSCEEEEEEEEEESSEEEEEESSCCTTCCSSS-CEEEEEESSCEEE
T ss_pred             cceeeEEEEEECCEEEEecCCCCCcCCEEEEEcCCCCEEEEEEEEEeCCeEEEEEecCccccccCC-CEEEECCCCcEEE
Confidence            356999999999999999998899999999986556568999999999999999999999999 89 5999999999999


Q ss_pred             CCCCCccceecCCcccccCCCCC
Q psy5598         104 VSEDMLGRVFNGSGKPIDKDCCS  126 (128)
Q Consensus       104 vg~~lLGRViD~lG~PlDg~~~~  126 (128)
                      ||++|||||||++|+|||+++++
T Consensus        84 vg~~lLGRV~d~lG~PiD~~~~i  106 (464)
T 3gqb_B           84 VSKEMLGRRFNGIGKPIDGLPPI  106 (464)
T ss_dssp             ECSTTTTEEEETTCCBCSSSCCC
T ss_pred             eChHhcCCEeccCCcccCCCccc
Confidence            99999999999999999999875



>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 128
d1fx0a3 276 c.37.1.11 (A:97-372) Central domain of alpha subun 2e-06
d2jdid3 276 c.37.1.11 (D:82-357) Central domain of beta subuni 2e-06
d2jdia3 285 c.37.1.11 (A:95-379) Central domain of alpha subun 7e-06
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: RecA protein-like (ATPase-domain)
domain: Central domain of alpha subunit of F1 ATP synthase
species: Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]
 Score = 43.0 bits (101), Expect = 2e-06
 Identities = 13/19 (68%), Positives = 13/19 (68%)

Query: 103 PVSEDMLGRVFNGSGKPID 121
           PVSE  LGRV N   KPID
Sbjct: 3   PVSEAYLGRVINALAKPID 21


>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query128
d1skyb275 F1 ATP synthase alpha subunit, domain 1 {Bacillus 99.17
d2jdia271 F1 ATP synthase alpha subunit, domain 1 {Cow (Bos 99.13
d1fx0a272 F1 ATP synthase alpha subunit, domain 1 {Spinach ( 99.04
d2jdid272 F1 ATP synthase beta subunit, domain 1 {Rat (Rattu 98.94
d1skye282 F1 ATP synthase beta subunit, domain 1 {Bacillus s 98.93
d1fx0b279 F1 ATP synthase beta subunit, domain 1 {Spinach (S 98.88
>d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
class: All beta proteins
fold: Domain of alpha and beta subunits of F1 ATP synthase-like
superfamily: N-terminal domain of alpha and beta subunits of F1 ATP synthase
family: N-terminal domain of alpha and beta subunits of F1 ATP synthase
domain: F1 ATP synthase alpha subunit, domain 1
species: Bacillus sp., strain ps3 [TaxId: 1409]
Probab=99.17  E-value=1e-10  Score=74.66  Aligned_cols=69  Identities=17%  Similarity=0.189  Sum_probs=63.9

Q ss_pred             eeeeEEEEEECCEEEEEcCCCCCcCcEEEEEeCCCceEEEEEEEEeCCEEEEEEccCCCCcccCCcEEEEcCCe
Q psy5598          26 ITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDI   99 (128)
Q Consensus        26 ~~~G~V~~I~G~~i~v~g~~~~~iGe~~~i~~~~~~~~~geVv~~~~~~v~l~~~~~~~Gi~~G~~~V~~tg~~   99 (128)
                      .+.|+|.+|.+++..+.|++++++||++++.  ++  ..|.|.+++++.+.+..|+++..|+.|| +|+.||+.
T Consensus         6 ~e~G~V~~V~DGIA~v~GL~~a~~gElv~F~--~g--~~GlvlnLe~d~VgvVllg~~~~i~~G~-~V~rTg~v   74 (75)
T d1skyb2           6 SDVGTVIQVGDGIARAHGLDNVMSGEAVEFA--NA--VMGMALNLEENNVGIVILGPYTGIKEGD-EVRRTGRI   74 (75)
T ss_dssp             GGEEEEEEEETTEEEEEECTTCCTTEEEEET--TS--CEEEEEEEETTEEEEEESSCCSSCCTTC-EEEEEEEE
T ss_pred             EEeEEEEEEcCcEEEEECCcccccCCeEEeC--CC--CEEEEEeccCcEEEEEEECCCCcccCCC-EEEecccc
Confidence            4689999999999999999999999999995  34  7999999999999999999999999995 99999864



>d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} Back     information, alignment and structure
>d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure