Psyllid ID: psy5598
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| 157111261 | 496 | ATP synthase subunit beta vacuolar [Aede | 0.945 | 0.243 | 0.892 | 3e-57 | |
| 242011359 | 496 | vacuolar ATP synthase subunit B, putativ | 0.953 | 0.245 | 0.893 | 9e-57 | |
| 170034654 | 492 | V-type ATP synthase beta chain [Culex qu | 0.953 | 0.247 | 0.877 | 3e-56 | |
| 91090031 | 496 | PREDICTED: similar to H(+)-transporting | 0.945 | 0.243 | 0.876 | 9e-56 | |
| 312373433 | 498 | hypothetical protein AND_17443 [Anophele | 0.945 | 0.242 | 0.867 | 1e-55 | |
| 347968745 | 498 | AGAP002884-PA [Anopheles gambiae str. PE | 0.945 | 0.242 | 0.867 | 1e-55 | |
| 17136796 | 490 | vacuolar H[+]-ATPase 55kD B subunit, iso | 0.937 | 0.244 | 0.875 | 2e-55 | |
| 307203836 | 495 | Vacuolar ATP synthase subunit B [Harpegn | 0.945 | 0.244 | 0.876 | 2e-55 | |
| 383847947 | 495 | PREDICTED: V-type proton ATPase subunit | 0.945 | 0.244 | 0.867 | 3e-55 | |
| 195329486 | 490 | GM25995 [Drosophila sechellia] gi|195571 | 0.937 | 0.244 | 0.866 | 3e-55 |
| >gi|157111261|ref|XP_001651458.1| ATP synthase subunit beta vacuolar [Aedes aegypti] gi|4680480|gb|AAD27666.1|AF092934_1 vacuolar ATPase B subunit [Aedes aegypti] gi|108878452|gb|EAT42677.1| AAEL005798-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Score = 226 bits (575), Expect = 3e-57, Method: Compositional matrix adjust.
Identities = 108/121 (89%), Positives = 118/121 (97%)
Query: 2 SISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGS 61
+IS+ QA +E+VLAV+RD+ISQPR+TYKTVSGVNGPLVILDEVKFPK+AEIVQLRLNDG+
Sbjct: 6 TISAHQAAKEHVLAVSRDFISQPRLTYKTVSGVNGPLVILDEVKFPKFAEIVQLRLNDGT 65
Query: 62 YRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID 121
R+GQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID
Sbjct: 66 VRSGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPID 125
Query: 122 K 122
K
Sbjct: 126 K 126
|
Source: Aedes aegypti Species: Aedes aegypti Genus: Aedes Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242011359|ref|XP_002426420.1| vacuolar ATP synthase subunit B, putative [Pediculus humanus corporis] gi|212510519|gb|EEB13682.1| vacuolar ATP synthase subunit B, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|170034654|ref|XP_001845188.1| V-type ATP synthase beta chain [Culex quinquefasciatus] gi|2921502|gb|AAC04806.1| B subunit V-ATPase [Culex quinquefasciatus] gi|167876059|gb|EDS39442.1| V-type ATP synthase beta chain [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|91090031|ref|XP_967844.1| PREDICTED: similar to H(+)-transporting ATPase [Tribolium castaneum] gi|270014269|gb|EFA10717.1| hypothetical protein TcasGA2_TC012133 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|312373433|gb|EFR21178.1| hypothetical protein AND_17443 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|347968745|ref|XP_312029.3| AGAP002884-PA [Anopheles gambiae str. PEST] gi|333467862|gb|EAA08175.4| AGAP002884-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|17136796|ref|NP_476908.1| vacuolar H[+]-ATPase 55kD B subunit, isoform B [Drosophila melanogaster] gi|24646341|ref|NP_731726.1| vacuolar H[+]-ATPase 55kD B subunit, isoform A [Drosophila melanogaster] gi|281361666|ref|NP_001163597.1| vacuolar H[+]-ATPase 55kD B subunit, isoform C [Drosophila melanogaster] gi|194764831|ref|XP_001964531.1| GF23001 [Drosophila ananassae] gi|194901678|ref|XP_001980379.1| GG17111 [Drosophila erecta] gi|195110565|ref|XP_001999850.1| GI24752 [Drosophila mojavensis] gi|195450853|ref|XP_002072660.1| GK13566 [Drosophila willistoni] gi|195500542|ref|XP_002097416.1| GE24501 [Drosophila yakuba] gi|401325|sp|P31409.1|VATB_DROME RecName: Full=V-type proton ATPase subunit B; Short=V-ATPase subunit B; AltName: Full=V-ATPase 55 kDa subunit; AltName: Full=Vacuolar proton pump subunit B gi|8810|emb|CAA48034.1| vacuolar ATPase B subunit [Drosophila melanogaster] gi|7299652|gb|AAF54836.1| vacuolar H[+]-ATPase 55kD B subunit, isoform A [Drosophila melanogaster] gi|7299653|gb|AAF54837.1| vacuolar H[+]-ATPase 55kD B subunit, isoform B [Drosophila melanogaster] gi|15291557|gb|AAK93047.1| GH27148p [Drosophila melanogaster] gi|25009768|gb|AAN71057.1| AT12604p [Drosophila melanogaster] gi|190614803|gb|EDV30327.1| GF23001 [Drosophila ananassae] gi|190652082|gb|EDV49337.1| GG17111 [Drosophila erecta] gi|193916444|gb|EDW15311.1| GI24752 [Drosophila mojavensis] gi|194168745|gb|EDW83646.1| GK13566 [Drosophila willistoni] gi|194183517|gb|EDW97128.1| GE24501 [Drosophila yakuba] gi|220945750|gb|ACL85418.1| Vha55-PA [synthetic construct] gi|220955454|gb|ACL90270.1| Vha55-PA [synthetic construct] gi|272476951|gb|ACZ94894.1| vacuolar H[+]-ATPase 55kD B subunit, isoform C [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|307203836|gb|EFN82772.1| Vacuolar ATP synthase subunit B [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383847947|ref|XP_003699614.1| PREDICTED: V-type proton ATPase subunit B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|195329486|ref|XP_002031442.1| GM25995 [Drosophila sechellia] gi|195571381|ref|XP_002103682.1| GD20555 [Drosophila simulans] gi|194120385|gb|EDW42428.1| GM25995 [Drosophila sechellia] gi|194199609|gb|EDX13185.1| GD20555 [Drosophila simulans] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 128 | ||||||
| FB|FBgn0005671 | 490 | Vha55 "Vacuolar H[+]-ATPase 55 | 0.937 | 0.244 | 0.875 | 7.2e-52 | |
| ZFIN|ZDB-GENE-030711-4 | 509 | atp6v1b2 "ATPase, H+ transport | 0.921 | 0.231 | 0.857 | 1.2e-49 | |
| UNIPROTKB|P31408 | 511 | ATP6V1B2 "V-type proton ATPase | 0.882 | 0.221 | 0.849 | 6.9e-47 | |
| UNIPROTKB|E2RAC6 | 511 | ATP6V1B2 "Uncharacterized prot | 0.882 | 0.221 | 0.849 | 6.9e-47 | |
| UNIPROTKB|H0YC04 | 199 | ATP6V1B2 "V-type proton ATPase | 0.882 | 0.567 | 0.849 | 6.9e-47 | |
| UNIPROTKB|P21281 | 511 | ATP6V1B2 "V-type proton ATPase | 0.882 | 0.221 | 0.849 | 6.9e-47 | |
| UNIPROTKB|F1RMZ8 | 511 | LOC100739134 "Uncharacterized | 0.882 | 0.221 | 0.849 | 6.9e-47 | |
| UNIPROTKB|Q5R5V5 | 511 | ATP6V1B2 "V-type proton ATPase | 0.882 | 0.221 | 0.849 | 6.9e-47 | |
| MGI|MGI:109618 | 511 | Atp6v1b2 "ATPase, H+ transport | 0.882 | 0.221 | 0.849 | 6.9e-47 | |
| RGD|620284 | 511 | Atp6v1b2 "ATPase, H transporti | 0.882 | 0.221 | 0.849 | 6.9e-47 |
| FB|FBgn0005671 Vha55 "Vacuolar H[+]-ATPase 55kD subunit" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 538 (194.4 bits), Expect = 7.2e-52, P = 7.2e-52
Identities = 105/120 (87%), Positives = 117/120 (97%)
Query: 3 ISSKQALRENVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSY 62
++++QA RE+VLAV+RD+ISQPR+TYKTVSGVNGPLVILDEVKFPK+AEIVQLRL DG+
Sbjct: 1 MNAQQAQREHVLAVSRDFISQPRLTYKTVSGVNGPLVILDEVKFPKFAEIVQLRLADGTV 60
Query: 63 RAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 122
R+GQVLEVSGSKAVVQVFEGTSGIDAKNT+CEFTGDILRTPVSEDMLGRVFNGSGKPIDK
Sbjct: 61 RSGQVLEVSGSKAVVQVFEGTSGIDAKNTLCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 120
|
|
| ZFIN|ZDB-GENE-030711-4 atp6v1b2 "ATPase, H+ transporting, lysosomal V1 subunit B2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P31408 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RAC6 ATP6V1B2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YC04 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P21281 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RMZ8 LOC100739134 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R5V5 ATP6V1B2 "V-type proton ATPase subunit B, brain isoform" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:109618 Atp6v1b2 "ATPase, H+ transporting, lysosomal V1 subunit B2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620284 Atp6v1b2 "ATPase, H transporting, lysosomal V1 subunit B2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 128 | |||
| TIGR01040 | 466 | TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B | 2e-63 | |
| COG1156 | 463 | COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase su | 1e-42 | |
| PRK04196 | 460 | PRK04196, PRK04196, V-type ATP synthase subunit B; | 6e-41 | |
| TIGR01041 | 458 | TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, | 1e-33 | |
| PRK02118 | 436 | PRK02118, PRK02118, V-type ATP synthase subunit B; | 2e-14 | |
| COG1157 | 441 | COG1157, FliI, Flagellar biosynthesis/type III sec | 2e-10 | |
| PRK04192 | 586 | PRK04192, PRK04192, V-type ATP synthase subunit A; | 4e-10 | |
| cd01135 | 276 | cd01135, V_A-ATPase_B, V/A-type ATP synthase (non- | 5e-09 | |
| TIGR03496 | 411 | TIGR03496, FliI_clade1, flagellar protein export A | 2e-08 | |
| pfam02874 | 69 | pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta | 5e-08 | |
| TIGR01043 | 578 | TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, | 1e-07 | |
| TIGR01026 | 440 | TIGR01026, fliI_yscN, ATPase FliI/YscN family | 1e-07 | |
| TIGR03498 | 418 | TIGR03498, FliI_clade3, flagellar protein export A | 2e-07 | |
| COG1155 | 588 | COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase su | 2e-07 | |
| TIGR02546 | 422 | TIGR02546, III_secr_ATP, type III secretion appara | 5e-07 | |
| PRK14698 | 1017 | PRK14698, PRK14698, V-type ATP synthase subunit A; | 1e-06 | |
| COG0056 | 504 | COG0056, AtpA, F0F1-type ATP synthase, alpha subun | 1e-05 | |
| PRK12597 | 461 | PRK12597, PRK12597, F0F1 ATP synthase subunit beta | 3e-05 | |
| PRK09281 | 502 | PRK09281, PRK09281, F0F1 ATP synthase subunit alph | 3e-05 | |
| PRK13343 | 502 | PRK13343, PRK13343, F0F1 ATP synthase subunit alph | 2e-04 | |
| TIGR01042 | 591 | TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A | 2e-04 | |
| TIGR00962 | 501 | TIGR00962, atpA, proton translocating ATP synthase | 3e-04 | |
| CHL00059 | 485 | CHL00059, atpA, ATP synthase CF1 alpha subunit | 3e-04 | |
| TIGR03497 | 413 | TIGR03497, FliI_clade2, flagellar protein export A | 6e-04 | |
| COG0055 | 468 | COG0055, AtpD, F0F1-type ATP synthase, beta subuni | 0.001 | |
| PRK06820 | 440 | PRK06820, PRK06820, type III secretion system ATPa | 0.002 | |
| PRK06936 | 439 | PRK06936, PRK06936, type III secretion system ATPa | 0.002 | |
| TIGR01039 | 461 | TIGR01039, atpD, ATP synthase, F1 beta subunit | 0.002 | |
| PRK09280 | 463 | PRK09280, PRK09280, F0F1 ATP synthase subunit beta | 0.003 | |
| PRK08472 | 434 | PRK08472, fliI, flagellum-specific ATP synthase; V | 0.004 | |
| PRK08927 | 442 | PRK08927, fliI, flagellum-specific ATP synthase; V | 0.004 | |
| PRK07594 | 433 | PRK07594, PRK07594, type III secretion system ATPa | 0.004 |
| >gnl|CDD|233244 TIGR01040, V-ATPase_V1_B, V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
Score = 199 bits (509), Expect = 2e-63
Identities = 82/96 (85%), Positives = 88/96 (91%)
Query: 27 TYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGI 86
Y+TVSGVNGPLVILD VKFP++AEIV L L DG+ R+GQVLEVSG+KAVVQVFEGTSGI
Sbjct: 1 EYRTVSGVNGPLVILDNVKFPRFAEIVNLTLPDGTVRSGQVLEVSGNKAVVQVFEGTSGI 60
Query: 87 DAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 122
DAK T CEFTGDILRTPVSEDMLGRVFNGSGKPIDK
Sbjct: 61 DAKKTTCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 96
|
This models eukaryotic vacuolar (H+)-ATPase that is responsible for acidifying cellular compartments. This enzyme shares extensive sequence similarity with archaeal ATP synthase [Transport and binding proteins, Cations and iron carrying compounds]. Length = 466 |
| >gnl|CDD|224078 COG1156, NtpB, Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|235251 PRK04196, PRK04196, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200071 TIGR01041, ATP_syn_B_arch, ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >gnl|CDD|179373 PRK02118, PRK02118, V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224079 COG1157, FliI, Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|235248 PRK04192, PRK04192, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238555 cd01135, V_A-ATPase_B, V/A-type ATP synthase (non-catalytic) subunit B | Back alignment and domain information |
|---|
| >gnl|CDD|213817 TIGR03496, FliI_clade1, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|217261 pfam02874, ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain | Back alignment and domain information |
|---|
| >gnl|CDD|130115 TIGR01043, ATP_syn_A_arch, ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233237 TIGR01026, fliI_yscN, ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >gnl|CDD|163293 TIGR03498, FliI_clade3, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|224077 COG1155, NtpA, Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|233918 TIGR02546, III_secr_ATP, type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >gnl|CDD|184795 PRK14698, PRK14698, V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223134 COG0056, AtpA, F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|183615 PRK12597, PRK12597, F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236448 PRK09281, PRK09281, F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|183987 PRK13343, PRK13343, F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233245 TIGR01042, V-ATPase_V1_A, V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >gnl|CDD|233211 TIGR00962, atpA, proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|176999 CHL00059, atpA, ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >gnl|CDD|211826 TIGR03497, FliI_clade2, flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >gnl|CDD|223133 COG0055, AtpD, F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|180712 PRK06820, PRK06820, type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|180762 PRK06936, PRK06936, type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|211621 TIGR01039, atpD, ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|236447 PRK09280, PRK09280, F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|181439 PRK08472, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236351 PRK08927, fliI, flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|136438 PRK07594, PRK07594, type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| PRK09099 | 441 | type III secretion system ATPase; Provisional | 99.91 | |
| COG1157 | 441 | FliI Flagellar biosynthesis/type III secretory pat | 99.91 | |
| PRK07196 | 434 | fliI flagellum-specific ATP synthase; Validated | 99.91 | |
| PRK06936 | 439 | type III secretion system ATPase; Provisional | 99.91 | |
| PRK08972 | 444 | fliI flagellum-specific ATP synthase; Validated | 99.91 | |
| PRK08472 | 434 | fliI flagellum-specific ATP synthase; Validated | 99.91 | |
| PRK04196 | 460 | V-type ATP synthase subunit B; Provisional | 99.9 | |
| PRK07721 | 438 | fliI flagellum-specific ATP synthase; Validated | 99.9 | |
| PRK08927 | 442 | fliI flagellum-specific ATP synthase; Validated | 99.9 | |
| PRK09281 | 502 | F0F1 ATP synthase subunit alpha; Validated | 99.9 | |
| PRK05688 | 451 | fliI flagellum-specific ATP synthase; Validated | 99.9 | |
| PRK06002 | 450 | fliI flagellum-specific ATP synthase; Validated | 99.9 | |
| TIGR03324 | 497 | alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit a | 99.9 | |
| PRK05922 | 434 | type III secretion system ATPase; Validated | 99.9 | |
| PRK13343 | 502 | F0F1 ATP synthase subunit alpha; Provisional | 99.9 | |
| PRK07960 | 455 | fliI flagellum-specific ATP synthase; Validated | 99.9 | |
| TIGR02546 | 422 | III_secr_ATP type III secretion apparatus H+-trans | 99.9 | |
| TIGR01040 | 466 | V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit. Th | 99.89 | |
| PRK06820 | 440 | type III secretion system ATPase; Validated | 99.89 | |
| TIGR00962 | 501 | atpA proton translocating ATP synthase, F1 alpha s | 99.89 | |
| PRK06315 | 442 | type III secretion system ATPase; Provisional | 99.89 | |
| TIGR01041 | 458 | ATP_syn_B_arch ATP synthase archaeal, B subunit. A | 99.89 | |
| PRK02118 | 436 | V-type ATP synthase subunit B; Provisional | 99.89 | |
| TIGR03498 | 418 | FliI_clade3 flagellar protein export ATPase FliI. | 99.88 | |
| TIGR03496 | 411 | FliI_clade1 flagellar protein export ATPase FliI. | 99.88 | |
| TIGR03497 | 413 | FliI_clade2 flagellar protein export ATPase FliI. | 99.88 | |
| TIGR01026 | 440 | fliI_yscN ATPase FliI/YscN family. This family of | 99.88 | |
| PRK07594 | 433 | type III secretion system ATPase SsaN; Validated | 99.87 | |
| PRK06793 | 432 | fliI flagellum-specific ATP synthase; Validated | 99.87 | |
| PRK12597 | 461 | F0F1 ATP synthase subunit beta; Provisional | 99.86 | |
| PRK07165 | 507 | F0F1 ATP synthase subunit alpha; Validated | 99.86 | |
| CHL00059 | 485 | atpA ATP synthase CF1 alpha subunit | 99.86 | |
| PRK09280 | 463 | F0F1 ATP synthase subunit beta; Validated | 99.86 | |
| PRK08149 | 428 | ATP synthase SpaL; Validated | 99.86 | |
| TIGR01043 | 578 | ATP_syn_A_arch ATP synthase archaeal, A subunit. A | 99.86 | |
| PRK04192 | 586 | V-type ATP synthase subunit A; Provisional | 99.85 | |
| TIGR01042 | 591 | V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit. Th | 99.85 | |
| CHL00060 | 494 | atpB ATP synthase CF1 beta subunit | 99.85 | |
| TIGR01039 | 461 | atpD ATP synthase, F1 beta subunit. The sequences | 99.84 | |
| COG1156 | 463 | NtpB Archaeal/vacuolar-type H+-ATPase subunit B [E | 99.83 | |
| PRK14698 | 1017 | V-type ATP synthase subunit A; Provisional | 99.82 | |
| PTZ00185 | 574 | ATPase alpha subunit; Provisional | 99.81 | |
| TIGR03305 | 449 | alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit | 99.8 | |
| COG0056 | 504 | AtpA F0F1-type ATP synthase, alpha subunit [Energy | 99.78 | |
| KOG1351|consensus | 489 | 99.72 | ||
| COG1155 | 588 | NtpA Archaeal/vacuolar-type H+-ATPase subunit A [E | 99.7 | |
| KOG1352|consensus | 618 | 99.52 | ||
| COG0055 | 468 | AtpD F0F1-type ATP synthase, beta subunit [Energy | 99.48 | |
| PF02874 | 69 | ATP-synt_ab_N: ATP synthase alpha/beta family, bet | 99.32 | |
| KOG1353|consensus | 340 | 99.28 | ||
| KOG1350|consensus | 521 | 99.23 | ||
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 97.04 | |
| PF09378 | 91 | HAS-barrel: HAS barrel domain; InterPro: IPR018538 | 92.82 |
| >PRK09099 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
Probab=99.91 E-value=7.5e-24 Score=178.28 Aligned_cols=111 Identities=25% Similarity=0.322 Sum_probs=97.3
Q ss_pred hHHHHhcccCCCCceeeeEEEEEECCEEEEEcCCCCCcCcEEEEEeCCCce-EEEEEEEEeCCEEEEEEccCCCCcccCC
Q psy5598 12 NVLAVTRDYISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSY-RAGQVLEVSGSKAVVQVFEGTSGIDAKN 90 (128)
Q Consensus 12 ~~~~~~~~~~~~~~~~~G~V~~I~G~~i~v~g~~~~~iGe~~~i~~~~~~~-~~geVv~~~~~~v~l~~~~~~~Gi~~G~ 90 (128)
.+.++++. ..+.+.+|+|++|.|++++++|+. +++||+|.|...++.. ..|||++|+++.+.+|||+++.||+.|
T Consensus 11 ~~~~~~~~--~~~~~~~G~V~~v~g~~i~~~g~~-~~~ge~~~i~~~~g~~~~~~eVv~~~~~~~~l~~~~~t~gi~~g- 86 (441)
T PRK09099 11 ALERELAA--LPAVRRTGKVVEVIGTLLRVSGLD-VTLGELCELRQRDGTLLQRAEVVGFSRDVALLSPFGELGGLSRG- 86 (441)
T ss_pred HHHHHHhc--CCcceEeeEEEEEECCEEEEeccC-CCCCCEEEEecCCCCeeeEEEEEEEECCEEEEEEccCCcCCCCC-
Confidence 34444443 367778999999999999999985 9999999995434443 789999999999999999999999999
Q ss_pred cEEEEcCCeeeEeCCCCCccceecCCcccccCCCCC
Q psy5598 91 TVCEFTGDILRTPVSEDMLGRVFNGSGKPIDKDCCS 126 (128)
Q Consensus 91 ~~V~~tg~~~~Vpvg~~lLGRViD~lG~PlDg~~~~ 126 (128)
++|.++|++++||+|++|||||+|++|+|||+++++
T Consensus 87 ~~V~~tg~~~~v~vg~~lLGrV~d~~G~piD~~~~~ 122 (441)
T PRK09099 87 TRVIGLGRPLSVPVGPALLGRVIDGLGEPIDGGGPL 122 (441)
T ss_pred CEEEeCCCccEEEeccccccCEEcccCCccCCCCCC
Confidence 599999999999999999999999999999998764
|
|
| >COG1157 FliI Flagellar biosynthesis/type III secretory pathway ATPase [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK07196 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06936 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK08972 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08472 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK04196 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK07721 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK08927 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK09281 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >PRK05688 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK06002 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR03324 alt_F1F0_F1_al alternate F1F0 ATPase, F1 subunit alpha | Back alignment and domain information |
|---|
| >PRK05922 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >PRK13343 F0F1 ATP synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK07960 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02546 III_secr_ATP type III secretion apparatus H+-transporting two-sector ATPase | Back alignment and domain information |
|---|
| >TIGR01040 V-ATPase_V1_B V-type (H+)-ATPase V1, B subunit | Back alignment and domain information |
|---|
| >PRK06820 type III secretion system ATPase; Validated | Back alignment and domain information |
|---|
| >TIGR00962 atpA proton translocating ATP synthase, F1 alpha subunit | Back alignment and domain information |
|---|
| >PRK06315 type III secretion system ATPase; Provisional | Back alignment and domain information |
|---|
| >TIGR01041 ATP_syn_B_arch ATP synthase archaeal, B subunit | Back alignment and domain information |
|---|
| >PRK02118 V-type ATP synthase subunit B; Provisional | Back alignment and domain information |
|---|
| >TIGR03498 FliI_clade3 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR03496 FliI_clade1 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR03497 FliI_clade2 flagellar protein export ATPase FliI | Back alignment and domain information |
|---|
| >TIGR01026 fliI_yscN ATPase FliI/YscN family | Back alignment and domain information |
|---|
| >PRK07594 type III secretion system ATPase SsaN; Validated | Back alignment and domain information |
|---|
| >PRK06793 fliI flagellum-specific ATP synthase; Validated | Back alignment and domain information |
|---|
| >PRK12597 F0F1 ATP synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK07165 F0F1 ATP synthase subunit alpha; Validated | Back alignment and domain information |
|---|
| >CHL00059 atpA ATP synthase CF1 alpha subunit | Back alignment and domain information |
|---|
| >PRK09280 F0F1 ATP synthase subunit beta; Validated | Back alignment and domain information |
|---|
| >PRK08149 ATP synthase SpaL; Validated | Back alignment and domain information |
|---|
| >TIGR01043 ATP_syn_A_arch ATP synthase archaeal, A subunit | Back alignment and domain information |
|---|
| >PRK04192 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >TIGR01042 V-ATPase_V1_A V-type (H+)-ATPase V1, A subunit | Back alignment and domain information |
|---|
| >CHL00060 atpB ATP synthase CF1 beta subunit | Back alignment and domain information |
|---|
| >TIGR01039 atpD ATP synthase, F1 beta subunit | Back alignment and domain information |
|---|
| >COG1156 NtpB Archaeal/vacuolar-type H+-ATPase subunit B [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK14698 V-type ATP synthase subunit A; Provisional | Back alignment and domain information |
|---|
| >PTZ00185 ATPase alpha subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03305 alt_F1F0_F1_bet alternate F1F0 ATPase, F1 subunit beta | Back alignment and domain information |
|---|
| >COG0056 AtpA F0F1-type ATP synthase, alpha subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1351|consensus | Back alignment and domain information |
|---|
| >COG1155 NtpA Archaeal/vacuolar-type H+-ATPase subunit A [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG1352|consensus | Back alignment and domain information |
|---|
| >COG0055 AtpD F0F1-type ATP synthase, beta subunit [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF02874 ATP-synt_ab_N: ATP synthase alpha/beta family, beta-barrel domain This Pfam entry corresponds to chains a,b,c,d,e and f; InterPro: IPR004100 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane | Back alignment and domain information |
|---|
| >KOG1353|consensus | Back alignment and domain information |
|---|
| >KOG1350|consensus | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PF09378 HAS-barrel: HAS barrel domain; InterPro: IPR018538 The HAS barrel is named after HerA-ATP Synthase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 128 | ||||
| 3vr6_D | 465 | Crystal Structure Of Amp-pnp Bound Enterococcus Hir | 2e-22 | ||
| 3vr2_D | 465 | Crystal Structure Of Nucleotide-free A3b3 Complex F | 8e-21 | ||
| 2rkw_A | 469 | Intermediate Position Of Atp On Its Trail To The Bi | 1e-19 | ||
| 3tiv_A | 460 | Crystal Structure Of Subunit B Mutant N157a Of The | 2e-19 | ||
| 3ssa_A | 460 | Crystal Structure Of Subunit B Mutant N157t Of The | 2e-19 | ||
| 2c61_A | 469 | Crystal Structure Of The Non-Catalytic B Subunit Of | 2e-19 | ||
| 3tgw_A | 460 | Crystal Structure Of Subunit B Mutant H156a Of The | 2e-19 | ||
| 3a5c_D | 478 | Inter-Subunit Interaction And Quaternary Rearrangem | 2e-17 | ||
| 3gqb_B | 464 | Crystal Structure Of The A3b3 Complex From V-atpase | 3e-17 | ||
| 3se0_A | 588 | Structural Characterization Of The Subunit A Mutant | 3e-05 | ||
| 3sdz_A | 588 | Structural Characterization Of The Subunit A Mutant | 3e-05 | ||
| 1vdz_A | 588 | Crystal Structure Of A-Type Atpase Catalytic Subuni | 3e-05 | ||
| 3m4y_A | 588 | Structural Characterization Of The Subunit A Mutant | 3e-05 | ||
| 3qjy_A | 588 | Crystal Structure Of P-Loop G234a Mutant Of Subunit | 3e-05 | ||
| 3qia_A | 588 | Crystal Structure Of P-Loop G237a Mutant Of Subunit | 3e-05 | ||
| 3mfy_A | 588 | Structural Characterization Of The Subunit A Mutant | 3e-05 | ||
| 3i4l_A | 588 | Structural Characterization For The Nucleotide Bind | 3e-05 | ||
| 3nd8_A | 588 | Structural Characterization For The Nucleotide Bind | 3e-05 | ||
| 3qg1_A | 588 | Crystal Structure Of P-Loop G239a Mutant Of Subunit | 3e-05 | ||
| 3nd9_A | 588 | Structural Characterization For The Nucleotide Bind | 3e-05 | ||
| 3ikj_A | 588 | Structural Characterization For The Nucleotide Bind | 3e-05 |
| >pdb|3VR6|D Chain D, Crystal Structure Of Amp-pnp Bound Enterococcus Hirae V1-atpase [bv1] Length = 465 | Back alignment and structure |
|
| >pdb|3VR2|D Chain D, Crystal Structure Of Nucleotide-free A3b3 Complex From Enterococcus Hirae V-atpase [ea3b3] Length = 465 | Back alignment and structure |
| >pdb|2RKW|A Chain A, Intermediate Position Of Atp On Its Trail To The Binding Pocket Inside The Subunit B Mutant R416w Of The Energy Converter A1ao Atp Synthase Length = 469 | Back alignment and structure |
| >pdb|3TIV|A Chain A, Crystal Structure Of Subunit B Mutant N157a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3SSA|A Chain A, Crystal Structure Of Subunit B Mutant N157t Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|2C61|A Chain A, Crystal Structure Of The Non-Catalytic B Subunit Of A-Type Atpase From M. Mazei Go1 Length = 469 | Back alignment and structure |
| >pdb|3TGW|A Chain A, Crystal Structure Of Subunit B Mutant H156a Of The A1ao Atp Synthase Length = 460 | Back alignment and structure |
| >pdb|3A5C|D Chain D, Inter-Subunit Interaction And Quaternary Rearrangement Defined By The Central Stalk Of Prokaryotic V1-Atpase Length = 478 | Back alignment and structure |
| >pdb|3GQB|B Chain B, Crystal Structure Of The A3b3 Complex From V-atpase Length = 464 | Back alignment and structure |
| >pdb|3SE0|A Chain A, Structural Characterization Of The Subunit A Mutant F508w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3SDZ|A Chain A, Structural Characterization Of The Subunit A Mutant F427w Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|1VDZ|A Chain A, Crystal Structure Of A-Type Atpase Catalytic Subunit A From Pyrococcus Horikoshii Ot3 Length = 588 | Back alignment and structure |
| >pdb|3M4Y|A Chain A, Structural Characterization Of The Subunit A Mutant P235a Of The A-Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QJY|A Chain A, Crystal Structure Of P-Loop G234a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QIA|A Chain A, Crystal Structure Of P-Loop G237a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3MFY|A Chain A, Structural Characterization Of The Subunit A Mutant F236a Of The A-Atp Synthase From Pyrococcus Horikoshii Length = 588 | Back alignment and structure |
| >pdb|3I4L|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A With Amp-Pnp Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3ND8|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3QG1|A Chain A, Crystal Structure Of P-Loop G239a Mutant Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3ND9|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
| >pdb|3IKJ|A Chain A, Structural Characterization For The Nucleotide Binding Ability Of Subunit A Mutant S238a Of The A1ao Atp Synthase Length = 588 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 128 | |||
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 3e-43 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 1e-41 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 1e-10 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 4e-08 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 4e-07 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 3e-05 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 4e-05 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 4e-05 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 4e-05 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 5e-05 |
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Length = 464 | Back alignment and structure |
|---|
Score = 146 bits (370), Expect = 3e-43
Identities = 42/102 (41%), Positives = 60/102 (58%)
Query: 21 ISQPRITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVF 80
+ + Y ++ ++GPL+ ++ K Y IV ++ G R GQV+EVS AV+QVF
Sbjct: 1 MDLLKKEYTGITYISGPLLFVENAKDLAYGAIVDIKDGTGRVRGGQVIEVSEEYAVIQVF 60
Query: 81 EGTSGIDAKNTVCEFTGDILRTPVSEDMLGRVFNGSGKPIDK 122
E T+G+D T D+ R VS++MLGR FNG GKPID
Sbjct: 61 EETTGLDLATTSVSLVEDVARLGVSKEMLGRRFNGIGKPIDG 102
|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Length = 469 | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Length = 588 | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Length = 578 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Length = 438 | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Length = 513 | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Length = 507 | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Length = 502 | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Length = 510 | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Length = 515 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| 3gqb_B | 464 | V-type ATP synthase beta chain; A3B3, V-ATPase, AT | 99.91 | |
| 3vr4_D | 465 | V-type sodium ATPase subunit D; V-ATPase, rotary m | 99.91 | |
| 3oaa_A | 513 | ATP synthase subunit alpha; rossmann fold, hydrola | 99.91 | |
| 2qe7_A | 502 | ATP synthase subunit alpha; blockage of ATP hydrol | 99.9 | |
| 2c61_A | 469 | A-type ATP synthase non-catalytic subunit B; hydro | 99.9 | |
| 2ck3_A | 510 | ATP synthase subunit alpha\, mitochondrial; hydrol | 99.9 | |
| 1fx0_A | 507 | ATP synthase alpha chain; latent ATPase, thermal s | 99.9 | |
| 2r9v_A | 515 | ATP synthase subunit alpha; TM1612, structural gen | 99.9 | |
| 3vr4_A | 600 | V-type sodium ATPase catalytic subunit A; V-ATPase | 99.86 | |
| 3gqb_A | 578 | V-type ATP synthase alpha chain; A3B3, V-ATPase, A | 99.86 | |
| 1sky_E | 473 | F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp | 99.85 | |
| 2dpy_A | 438 | FLII, flagellum-specific ATP synthase; beta barrel | 99.85 | |
| 3mfy_A | 588 | V-type ATP synthase alpha chain; A-type ATP syntha | 99.85 | |
| 1fx0_B | 498 | ATP synthase beta chain; latent ATPase, thermal st | 99.83 | |
| 2ck3_D | 482 | ATP synthase subunit beta\, mitochondrial; hydrola | 99.82 |
| >3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* | Back alignment and structure |
|---|
Probab=99.91 E-value=2.8e-24 Score=180.51 Aligned_cols=101 Identities=43% Similarity=0.653 Sum_probs=94.5
Q ss_pred ceeeeEEEEEECCEEEEEcCCCCCcCcEEEEEeCCCceEEEEEEEEeCCEEEEEEccCCCCcc-cCCcEEEEcCCeeeEe
Q psy5598 25 RITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGID-AKNTVCEFTGDILRTP 103 (128)
Q Consensus 25 ~~~~G~V~~I~G~~i~v~g~~~~~iGe~~~i~~~~~~~~~geVv~~~~~~v~l~~~~~~~Gi~-~G~~~V~~tg~~~~Vp 103 (128)
.++||+|++|.|+++++.|++++++||+|+|..+++..+.|||++|+++.+.++||+++.||+ .| ++|++||++++||
T Consensus 5 ~~~~g~V~~v~g~~v~v~gl~~~~~ge~v~i~~~~g~~~~geVv~~~~~~~~~~~~~~~~gl~~~g-~~V~~tg~~~~vp 83 (464)
T 3gqb_B 5 KKEYTGITYISGPLLFVENAKDLAYGAIVDIKDGTGRVRGGQVIEVSEEYAVIQVFEETTGLDLAT-TSVSLVEDVARLG 83 (464)
T ss_dssp CCCBCCEEEEETTEEEEESCTTSCTTCEEEEECTTSCEEEEEEEEEESSEEEEEESSCCTTCCSSS-CEEEEEESSCEEE
T ss_pred cceeeEEEEEECCEEEEecCCCCCcCCEEEEEcCCCCEEEEEEEEEeCCeEEEEEecCccccccCC-CEEEECCCCcEEE
Confidence 356999999999999999998899999999986556568999999999999999999999999 89 5999999999999
Q ss_pred CCCCCccceecCCcccccCCCCC
Q psy5598 104 VSEDMLGRVFNGSGKPIDKDCCS 126 (128)
Q Consensus 104 vg~~lLGRViD~lG~PlDg~~~~ 126 (128)
||++|||||||++|+|||+++++
T Consensus 84 vg~~lLGRV~d~lG~PiD~~~~i 106 (464)
T 3gqb_B 84 VSKEMLGRRFNGIGKPIDGLPPI 106 (464)
T ss_dssp ECSTTTTEEEETTCCBCSSSCCC
T ss_pred eChHhcCCEeccCCcccCCCccc
Confidence 99999999999999999999875
|
| >3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* | Back alignment and structure |
|---|
| >3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A | Back alignment and structure |
|---|
| >2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B | Back alignment and structure |
|---|
| >2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* | Back alignment and structure |
|---|
| >2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... | Back alignment and structure |
|---|
| >1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* | Back alignment and structure |
|---|
| >2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* | Back alignment and structure |
|---|
| >3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C | Back alignment and structure |
|---|
| >1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 | Back alignment and structure |
|---|
| >2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A | Back alignment and structure |
|---|
| >1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* | Back alignment and structure |
|---|
| >2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 128 | ||||
| d1fx0a3 | 276 | c.37.1.11 (A:97-372) Central domain of alpha subun | 2e-06 | |
| d2jdid3 | 276 | c.37.1.11 (D:82-357) Central domain of beta subuni | 2e-06 | |
| d2jdia3 | 285 | c.37.1.11 (A:95-379) Central domain of alpha subun | 7e-06 |
| >d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Length = 276 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: RecA protein-like (ATPase-domain) domain: Central domain of alpha subunit of F1 ATP synthase species: Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]
Score = 43.0 bits (101), Expect = 2e-06
Identities = 13/19 (68%), Positives = 13/19 (68%)
Query: 103 PVSEDMLGRVFNGSGKPID 121
PVSE LGRV N KPID
Sbjct: 3 PVSEAYLGRVINALAKPID 21
|
| >d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 276 | Back information, alignment and structure |
|---|
| >d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Length = 285 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 128 | |||
| d1skyb2 | 75 | F1 ATP synthase alpha subunit, domain 1 {Bacillus | 99.17 | |
| d2jdia2 | 71 | F1 ATP synthase alpha subunit, domain 1 {Cow (Bos | 99.13 | |
| d1fx0a2 | 72 | F1 ATP synthase alpha subunit, domain 1 {Spinach ( | 99.04 | |
| d2jdid2 | 72 | F1 ATP synthase beta subunit, domain 1 {Rat (Rattu | 98.94 | |
| d1skye2 | 82 | F1 ATP synthase beta subunit, domain 1 {Bacillus s | 98.93 | |
| d1fx0b2 | 79 | F1 ATP synthase beta subunit, domain 1 {Spinach (S | 98.88 |
| >d1skyb2 b.49.1.1 (B:21-95) F1 ATP synthase alpha subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Domain of alpha and beta subunits of F1 ATP synthase-like superfamily: N-terminal domain of alpha and beta subunits of F1 ATP synthase family: N-terminal domain of alpha and beta subunits of F1 ATP synthase domain: F1 ATP synthase alpha subunit, domain 1 species: Bacillus sp., strain ps3 [TaxId: 1409]
Probab=99.17 E-value=1e-10 Score=74.66 Aligned_cols=69 Identities=17% Similarity=0.189 Sum_probs=63.9
Q ss_pred eeeeEEEEEECCEEEEEcCCCCCcCcEEEEEeCCCceEEEEEEEEeCCEEEEEEccCCCCcccCCcEEEEcCCe
Q psy5598 26 ITYKTVSGVNGPLVILDEVKFPKYAEIVQLRLNDGSYRAGQVLEVSGSKAVVQVFEGTSGIDAKNTVCEFTGDI 99 (128)
Q Consensus 26 ~~~G~V~~I~G~~i~v~g~~~~~iGe~~~i~~~~~~~~~geVv~~~~~~v~l~~~~~~~Gi~~G~~~V~~tg~~ 99 (128)
.+.|+|.+|.+++..+.|++++++||++++. ++ ..|.|.+++++.+.+..|+++..|+.|| +|+.||+.
T Consensus 6 ~e~G~V~~V~DGIA~v~GL~~a~~gElv~F~--~g--~~GlvlnLe~d~VgvVllg~~~~i~~G~-~V~rTg~v 74 (75)
T d1skyb2 6 SDVGTVIQVGDGIARAHGLDNVMSGEAVEFA--NA--VMGMALNLEENNVGIVILGPYTGIKEGD-EVRRTGRI 74 (75)
T ss_dssp GGEEEEEEEETTEEEEEECTTCCTTEEEEET--TS--CEEEEEEEETTEEEEEESSCCSSCCTTC-EEEEEEEE
T ss_pred EEeEEEEEEcCcEEEEECCcccccCCeEEeC--CC--CEEEEEeccCcEEEEEEECCCCcccCCC-EEEecccc
Confidence 4689999999999999999999999999995 34 7999999999999999999999999995 99999864
|
| >d2jdia2 b.49.1.1 (A:24-94) F1 ATP synthase alpha subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1fx0a2 b.49.1.1 (A:25-96) F1 ATP synthase alpha subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2jdid2 b.49.1.1 (D:10-81) F1 ATP synthase beta subunit, domain 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1skye2 b.49.1.1 (E:1-82) F1 ATP synthase beta subunit, domain 1 {Bacillus sp., strain ps3 [TaxId: 1409]} | Back information, alignment and structure |
|---|
| >d1fx0b2 b.49.1.1 (B:19-97) F1 ATP synthase beta subunit, domain 1 {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} | Back information, alignment and structure |
|---|