Psyllid ID: psy5909

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
ENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEFNIRVPEPSHPIGLPAP
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHcccccccccccccc
ccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc
ensgnsssdeQAVSDlrrkpsdtvdsdleidddkcsrggslspslspvdkkkhrrnrttftTYQLHELERAFekshypdvysreelamkvnlpevRVQAVGMLYYSVelqdiefnirvpepshpiglpap
ensgnsssdeqavsdlrrkpsdtvdsdleidddkcsrggslspslspvdkkkhrrnrttfttyqlheleraFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEFNirvpepshpiglpap
ENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRggslspslspVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEFNIRVPEPSHPIGLPAP
**********************************************************TFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEFNIRV************
**********************************************************TFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQ********************
***************************LEIDDDKCS*******************NRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEFNIRVPEPSHPIGLPAP
*******************************************************NRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEFNIR*************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ENSGNSSSDEQAVSDLRRKPSDTVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEFNIRVPEPSHPIGLPAP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
Q9W2Q1 873 Retinal homeobox protein yes N/A 0.484 0.072 0.736 2e-24
Q9PVX0 317 Retinal homeobox protein yes N/A 0.469 0.192 0.868 7e-24
Q9PVY0 228 Retinal homeobox protein no N/A 0.376 0.214 1.0 6e-23
O42356 330 Retinal homeobox protein yes N/A 0.384 0.151 0.98 6e-23
Q9I9D5 334 Retinal homeobox protein N/A N/A 0.384 0.149 0.98 6e-23
O42567 325 Retinal homeobox protein N/A N/A 0.376 0.150 1.0 7e-23
O42357 327 Retinal homeobox protein no N/A 0.384 0.152 0.98 8e-23
O42201 322 Retinal homeobox protein N/A N/A 0.384 0.155 0.98 9e-23
O42358 292 Retinal homeobox protein no N/A 0.461 0.205 0.838 1e-22
Q9JLT7 342 Retinal homeobox protein yes N/A 0.376 0.143 0.979 1e-22
>sp|Q9W2Q1|RX_DROME Retinal homeobox protein Rx OS=Drosophila melanogaster GN=Rx PE=2 SV=2 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 56/76 (73%), Positives = 57/76 (75%), Gaps = 13/76 (17%)

Query: 23  TVDSDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYS 82
           T  SD E  DD C+             KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYS
Sbjct: 511 TSGSDDEGQDDNCA-------------KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYS 557

Query: 83  REELAMKVNLPEVRVQ 98
           REELAMKVNLPEVRVQ
Sbjct: 558 REELAMKVNLPEVRVQ 573
Appears to function in brain development.
Drosophila melanogaster (taxid: 7227)
>sp|Q9PVX0|RX2_CHICK Retinal homeobox protein Rx2 OS=Gallus gallus GN=RX2 PE=2 SV=1 Back     alignment and function description
>sp|Q9PVY0|RX1_CHICK Retinal homeobox protein Rx1 OS=Gallus gallus GN=RX1 PE=2 SV=1 Back     alignment and function description
>sp|O42356|RX1_DANRE Retinal homeobox protein Rx1 OS=Danio rerio GN=rx1 PE=2 SV=2 Back     alignment and function description
>sp|Q9I9D5|RX1_ASTFA Retinal homeobox protein Rx1 OS=Astyanax fasciatus GN=rx1 PE=2 SV=1 Back     alignment and function description
>sp|O42567|RXB_XENLA Retinal homeobox protein Rx-B OS=Xenopus laevis GN=rax-b PE=2 SV=2 Back     alignment and function description
>sp|O42357|RX2_DANRE Retinal homeobox protein Rx2 OS=Danio rerio GN=rx2 PE=2 SV=1 Back     alignment and function description
>sp|O42201|RXA_XENLA Retinal homeobox protein Rx-A OS=Xenopus laevis GN=rax-a PE=2 SV=2 Back     alignment and function description
>sp|O42358|RX3_DANRE Retinal homeobox protein Rx3 OS=Danio rerio GN=rx3 PE=2 SV=1 Back     alignment and function description
>sp|Q9JLT7|RX_RAT Retinal homeobox protein Rx OS=Rattus norvegicus GN=Rax PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
312384105 671 hypothetical protein AND_02561 [Anophele 0.476 0.092 0.746 3e-23
194753694 925 GF12207 [Drosophila ananassae] gi|190620 0.484 0.068 0.736 9e-23
195486714 906 GE12148 [Drosophila yakuba] gi|194177723 0.484 0.069 0.736 1e-22
328697098 290 PREDICTED: retinal homeobox protein Rx-l 0.430 0.193 0.928 1e-22
194881725 898 GG22067 [Drosophila erecta] gi|190658159 0.484 0.070 0.736 1e-22
2950355 902 homebox protein DRx [Drosophila melanoga 0.484 0.069 0.736 1e-22
195346236 895 GM15784 [Drosophila sechellia] gi|194135 0.484 0.070 0.736 1e-22
28573580 873 retinal homeobox [Drosophila melanogaste 0.484 0.072 0.736 1e-22
170062890 441 retinal homeobox protein [Culex quinquef 0.461 0.136 0.753 2e-22
158292555 898 AGAP005096-PA [Anopheles gambiae str. PE 0.461 0.066 0.767 2e-22
>gi|312384105|gb|EFR28914.1| hypothetical protein AND_02561 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  112 bits (281), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 56/75 (74%), Positives = 58/75 (77%), Gaps = 13/75 (17%)

Query: 26  SDLEIDDDKCSRGGSLSPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREE 85
           SD E  DD CS             KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREE
Sbjct: 566 SDDEAGDDSCS-------------KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREE 612

Query: 86  LAMKVNLPEVRVQAV 100
           LAMKVNLPEVRVQ++
Sbjct: 613 LAMKVNLPEVRVQSI 627

Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|194753694|ref|XP_001959145.1| GF12207 [Drosophila ananassae] gi|190620443|gb|EDV35967.1| GF12207 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195486714|ref|XP_002091622.1| GE12148 [Drosophila yakuba] gi|194177723|gb|EDW91334.1| GE12148 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|328697098|ref|XP_001944012.2| PREDICTED: retinal homeobox protein Rx-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|194881725|ref|XP_001974972.1| GG22067 [Drosophila erecta] gi|190658159|gb|EDV55372.1| GG22067 [Drosophila erecta] Back     alignment and taxonomy information
>gi|2950355|emb|CAA11241.1| homebox protein DRx [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195346236|ref|XP_002039672.1| GM15784 [Drosophila sechellia] gi|194135021|gb|EDW56537.1| GM15784 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|28573580|ref|NP_726006.2| retinal homeobox [Drosophila melanogaster] gi|17380504|sp|Q9W2Q1.2|RX_DROME RecName: Full=Retinal homeobox protein Rx; Short=DRx; Short=DRx1 gi|21392130|gb|AAM48419.1| RE39020p [Drosophila melanogaster] gi|28380638|gb|AAF46639.3| retinal homeobox [Drosophila melanogaster] gi|220960168|gb|ACL92620.1| Rx-PA [synthetic construct] Back     alignment and taxonomy information
>gi|170062890|ref|XP_001866865.1| retinal homeobox protein [Culex quinquefasciatus] gi|167880713|gb|EDS44096.1| retinal homeobox protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158292555|ref|XP_313972.3| AGAP005096-PA [Anopheles gambiae str. PEST] gi|157017047|gb|EAA09363.3| AGAP005096-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
ZFIN|ZDB-GENE-990415-237 327 rx2 "retinal homeobox gene 2" 0.376 0.149 1.0 4.9e-24
UNIPROTKB|E2QW59 331 RAX "Uncharacterized protein" 0.376 0.148 0.979 4.3e-23
UNIPROTKB|F1NH36 262 Gga.55791 "Uncharacterized pro 0.376 0.187 1.0 4.3e-22
UNIPROTKB|Q9PVX0 317 RX2 "Retinal homeobox protein 0.376 0.154 1.0 4.3e-22
UNIPROTKB|Q9PVY0 228 RX1 "Retinal homeobox protein 0.376 0.214 1.0 4.3e-22
ZFIN|ZDB-GENE-990415-236 330 rx1 "retinal homeobox gene 1" 0.376 0.148 1.0 4.3e-22
FB|FBgn0020617 873 Rx "Retinal Homeobox" [Drosoph 0.615 0.091 0.634 6.8e-22
ZFIN|ZDB-GENE-990415-238 292 rx3 "retinal homeobox gene 3" 0.376 0.167 0.959 2.4e-21
UNIPROTKB|E1BHB8 351 LOC615339 "Uncharacterized pro 0.376 0.139 0.979 3e-21
UNIPROTKB|Q9Y2V3 346 RAX "Retinal homeobox protein 0.376 0.141 0.979 3e-21
ZFIN|ZDB-GENE-990415-237 rx2 "retinal homeobox gene 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 257 (95.5 bits), Expect = 4.9e-24, Sum P(2) = 4.9e-24
 Identities = 49/49 (100%), Positives = 49/49 (100%)

Query:    50 KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 98
             KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ
Sbjct:   132 KKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 180
GO:0003677 "DNA binding" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0060219 "camera-type eye photoreceptor cell differentiation" evidence=IGI
GO:0007275 "multicellular organismal development" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
UNIPROTKB|E2QW59 RAX "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NH36 Gga.55791 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PVX0 RX2 "Retinal homeobox protein Rx2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PVY0 RX1 "Retinal homeobox protein Rx1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-236 rx1 "retinal homeobox gene 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0020617 Rx "Retinal Homeobox" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-990415-238 rx3 "retinal homeobox gene 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BHB8 LOC615339 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y2V3 RAX "Retinal homeobox protein Rx" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9W2Q1RX_DROMENo assigned EC number0.73680.48460.0721yesN/A
Q9PVX0RX2_CHICKNo assigned EC number0.86880.46920.1924yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
pfam0004657 pfam00046, Homeobox, Homeobox domain 8e-19
smart0038957 smart00389, HOX, Homeodomain 8e-15
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-14
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 4e-05
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information 
 Score = 73.7 bits (182), Expect = 8e-19
 Identities = 26/45 (57%), Positives = 31/45 (68%)

Query: 54 RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 98
          RR RTTFT  QL ELE+ FEK+ YP    REELA K+ L E +V+
Sbjct: 1  RRKRTTFTPEQLEELEKEFEKNRYPSAEEREELAKKLGLTERQVK 45

Length = 57
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG0484|consensus125 99.87
KOG0489|consensus261 99.87
KOG0488|consensus309 99.86
KOG0842|consensus307 99.85
KOG0850|consensus245 99.85
KOG0487|consensus308 99.85
KOG0494|consensus 332 99.82
KOG0848|consensus317 99.82
KOG2251|consensus 228 99.81
KOG0485|consensus268 99.81
KOG0492|consensus246 99.8
KOG0843|consensus197 99.79
KOG0844|consensus 408 99.74
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.73
KOG0491|consensus194 99.71
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.68
KOG0493|consensus342 99.68
KOG0486|consensus 351 99.64
COG5576156 Homeodomain-containing transcription factor [Trans 99.64
KOG3802|consensus398 99.63
KOG4577|consensus 383 99.61
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.6
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.58
KOG0483|consensus198 99.55
KOG0847|consensus288 99.51
KOG0490|consensus235 99.51
KOG0849|consensus 354 99.36
KOG1168|consensus385 99.26
KOG0775|consensus304 98.61
KOG2252|consensus558 98.59
KOG0490|consensus235 98.46
KOG0774|consensus334 98.44
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.41
KOG1146|consensus 1406 98.23
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 97.08
KOG3623|consensus 1007 96.86
KOG0773|consensus342 95.65
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 94.09
KOG1146|consensus 1406 82.22
>KOG0484|consensus Back     alignment and domain information 
Probab=99.87  E-value=2e-23  Score=134.81  Aligned_cols=65  Identities=48%  Similarity=0.691  Sum_probs=61.1

Q ss_pred             ccCCCCCCCCCCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHhCCCCCccceechhhhhHHhhhhh
Q psy5909          49 DKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIE  113 (130)
Q Consensus        49 ~~~~~rr~Rt~~t~~q~~~L~~~F~~~~~p~~~~r~~La~~l~l~~~~VqvWFqNrR~k~~~~~~  113 (130)
                      -.+++||.||.||..||.+||+.|...+||++..|++||.++.|++.+|||||||||+|.||..+
T Consensus        13 ekrKQRRIRTTFTS~QLkELErvF~ETHYPDIYTREEiA~kidLTEARVQVWFQNRRAKfRKQEr   77 (125)
T KOG0484|consen   13 EKRKQRRIRTTFTSAQLKELERVFAETHYPDIYTREEIALKIDLTEARVQVWFQNRRAKFRKQER   77 (125)
T ss_pred             HHHHhhhhhhhhhHHHHHHHHHHHHhhcCCcchhHHHHHHhhhhhHHHHHHHHHhhHHHHHHHHH
Confidence            46778999999999999999999999999999999999999999999999999999999887653

>KOG0489|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 9e-16
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 4e-15
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 5e-14
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 2e-13
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 2e-13
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 5e-12
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 1e-11
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 6e-11
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 5e-09
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 3e-08
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 1e-06
2dmt_A80 Solution Structure Of The Homeobox Domain Of Homeob 4e-04
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 7e-04
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure 
Iteration: 1

 Score = 78.6 bits (192), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 34/50 (68%), Positives = 43/50 (86%)
Query: 49 DKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 98
          +K K RRNRTTFT+YQL ELE+ F+K+HYPDVY+RE+LAM+ +L E RVQ
Sbjct: 5  NKGKKRRNRTTFTSYQLEELEKVFQKTHYPDVYAREQLAMRTDLTEARVQ 54
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|2DMT|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Barh-Like 1 Length = 80 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 1e-30
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-30
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 1e-30
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 9e-30
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-29
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 2e-28
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-28
3a02_A60 Homeobox protein aristaless; homeodomain, developm 2e-27
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 1e-26
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 3e-25
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 1e-23
1uhs_A72 HOP, homeodomain only protein; structural genomics 4e-21
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 6e-21
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 4e-19
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 2e-18
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 8e-16
1lfb_A99 Liver transcription factor (LFB1); transcription r 1e-15
3d1n_I151 POU domain, class 6, transcription factor 1; prote 1e-15
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 2e-15
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 8e-15
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 1e-14
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 3e-14
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 6e-14
2xsd_C164 POU domain, class 3, transcription factor 1; trans 4e-13
1e3o_C160 Octamer-binding transcription factor 1; transcript 2e-12
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-11
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 3e-11
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 2e-10
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 2e-10
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 3e-10
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 4e-10
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 5e-10
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 6e-10
3a01_A93 Homeodomain-containing protein; homeodomain, prote 1e-09
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 2e-09
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 2e-09
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 4e-09
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-08
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-08
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 6e-08
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 1e-07
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-07
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 4e-07
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-07
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 8e-07
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 2e-06
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 3e-06
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 3e-06
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 7e-06
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 7e-06
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 1e-05
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 1e-05
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 2e-05
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 3e-04
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
 Score =  103 bits (259), Expect = 1e-30
 Identities = 26/50 (52%), Positives = 37/50 (74%)

Query: 49 DKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 98
               +RNRT+FT  Q+  LE+ FE++HYPDV++RE LA K++LPE R+Q
Sbjct: 3  SGSSGQRNRTSFTQEQIEALEKEFERTHYPDVFARERLAAKIDLPEARIQ 52
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.89
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.89
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.88
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.88
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.88
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.88
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.88
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.88
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.87
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.87
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.87
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.87
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.87
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.87
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.87
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.87
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.86
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.86
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.86
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.86
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.86
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.86
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.86
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.86
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.86
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.85
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.85
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.85
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.85
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.85
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.85
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.84
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.84
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.84
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.84
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.84
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.84
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.84
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.84
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.84
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.84
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.83
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.83
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.83
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.83
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.83
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.83
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.82
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.82
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.82
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.81
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.8
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.8
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.8
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.8
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.8
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.79
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.79
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.79
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.79
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.79
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.79
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.78
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.78
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.78
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.77
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.77
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.77
2e19_A64 Transcription factor 8; homeobox domain, structura 99.76
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.76
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.74
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.67
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.65
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.61
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.59
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.49
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.48
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 99.05
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 95.81
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
Probab=99.89  E-value=8.5e-24  Score=133.27  Aligned_cols=67  Identities=21%  Similarity=0.162  Sum_probs=61.6

Q ss_pred             CccCCCCCCCCCCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHhCCCCCccceechhhhhHHhhhhhc
Q psy5909          48 VDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQDIEF  114 (130)
Q Consensus        48 ~~~~~~rr~Rt~~t~~q~~~L~~~F~~~~~p~~~~r~~La~~l~l~~~~VqvWFqNrR~k~~~~~~~  114 (130)
                      ....+.++.||.|+..|+.+|+..|..++||+..++..||..|||++.+|+|||||||+|+|+..+.
T Consensus        17 ~~~~~~rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~La~~l~l~~~qV~vWFqNRR~k~kk~~k~   83 (84)
T 2kt0_A           17 KVPVKKQKTRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKN   83 (84)
T ss_dssp             CCCSCSCCCSSCCCHHHHHHHHHHHHHSSSCCHHHHHHHHHHTTCCHHHHHHHHHHHHHTTTSCCCC
T ss_pred             CCCCCCCCCCCCCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHcCCCHHHHHHHHHHHHHHHHHHhhc
Confidence            3455678899999999999999999999999999999999999999999999999999999887653
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 3e-18
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 3e-17
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 1e-15
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 3e-15
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 3e-15
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 6e-15
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 7e-15
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 7e-15
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-14
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 3e-14
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 4e-14
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 7e-14
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 1e-13
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-13
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 2e-13
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 9e-13
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 1e-12
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 4e-12
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 5e-12
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 2e-11
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 2e-11
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-10
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 6e-10
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 1e-09
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 3e-09
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 8e-09
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-08
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 3e-08
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 4e-08
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 8e-08
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 4e-05
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 2e-04
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 71.4 bits (175), Expect = 3e-18
 Identities = 17/57 (29%), Positives = 31/57 (54%)

Query: 42 SPSLSPVDKKKHRRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQ 98
          +P+ + +  +  R+ R  +T +Q  ELE+ F  + Y     R E+A  +NL E +V+
Sbjct: 2  NPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVK 58
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.9
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.9
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.89
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.89
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.89
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.88
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.88
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.88
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.88
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.87
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.87
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.87
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.87
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.86
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.85
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.84
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.84
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.84
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.84
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.83
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.83
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.82
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.82
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.79
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.78
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.77
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.73
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.72
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.69
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.66
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.64
d1hlva166 DNA-binding domain of centromere binding protein B 87.19
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-b13
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.90  E-value=7.9e-25  Score=127.50  Aligned_cols=57  Identities=21%  Similarity=0.278  Sum_probs=54.8

Q ss_pred             CCCCCCCCHHHHHHHHHHHHhhCCCCHHHHHHHHHHhCCCCCccceechhhhhHHhh
Q psy5909          54 RRNRTTFTTYQLHELERAFEKSHYPDVYSREELAMKVNLPEVRVQAVGMLYYSVELQ  110 (130)
Q Consensus        54 rr~Rt~~t~~q~~~L~~~F~~~~~p~~~~r~~La~~l~l~~~~VqvWFqNrR~k~~~  110 (130)
                      |+.|+.||..|+.+|+..|..++||+...+.+||..|||++.+|+|||||||+|+||
T Consensus         2 rr~Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~qV~vWFqNrR~k~kk   58 (58)
T d2craa1           2 RKKRIPYSKGQLRELEREYAANKFITKDKRRKISAATSLSERQITIWFQNRRVKEKK   58 (58)
T ss_dssp             CCSCCCSCHHHHHHHHHHHHHCSSCCHHHHHHHHHHTCCCHHHHHHHHHHHHHTTTS
T ss_pred             CCCCCCCCHHHHHHHHHHHhhcCCCCHHHHHHHHHHcCCCHHHeeecccchhhhccC
Confidence            677899999999999999999999999999999999999999999999999999865
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure