Psyllid ID: psy6113


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MINTGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHIDLKTGSGSSGRGKPSSTVDATLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGALKSKL
ccccccccccEEEEEccccHHHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHccEEEEEcccccccccccccccHHHHHHHHHHHccccHHHHHHcHHHHHHHHHHHHHccccccEEEEcccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHcHHHHHHHccccccHHcccccHHHHHHHHHHHHccccccccccEEEEHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHccc
ccccHHccccEEEEcccccHHHHHHHHHHHHcccEEEEEccccHHHHccHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHcccEEEEcHccHHHHHHHHHHHHHHHccccEEEEccccccccccHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccEEcccHHHHHHHHccccccccccHHHHHHHHHHHHccHHcccccEEEEEcccEEEccccccHHcccccccccccEEEEcccccccEccccccccccEEEEEEHHHHHHHHcccccHHHHHHccccEEEEcHHHHHHHHccHHHHHccc
mintgklsgLTIFITGASRGIGKAIALKAAKDGANIVIAAktaephpklpgtIYSAAKEVedaggnclpcivDIRDEHAVQSAVNAAVDKfggidilvnnasaisltdtantplkkydLMNQINARGTYLVKASQGLEIQSAVNAAVDKfggidilvnnasaisltdtantplkkydLMNQINARGTYLVSQkclpylkksnhahilnispplnlnpfwfkNHVAYTISKYGMSMCALGMaeefkgdniavnalwprTAIYTAAIEMLtggsadakatsrkpeiMADAAYYIlssnppsltgqfliddEVLKAQHIdleqysyvpngaaegswhidlktgsgssgrgkpsstvdATLTMTEKNFIALFegklkptsafmtgklKISGNLQKAMKLEKLMGALKSKL
mintgklsgLTIFITGASRGIGKAIALKAAKDGANIVIAaktaephpklPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNIspplnlnpfWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHIDLKtgsgssgrgkpssTVDATLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGALKSKL
MINTGKLSGLTIFITGASRgigkaialkaakdgaNIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHIDLKTgsgssgrgkpssTVDATLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGALKSKL
******LSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGG************IMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHIDL*******************LTMTEKNFIALFEGKLKPTSAFMTGKLKI*********************
***TGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEM************RKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHID*******************TLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGALK***
MINTGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGG********RKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHIDLKT*************VDATLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGALKSKL
***TGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHIDLKTGSGSSGRGKPSSTVDATLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGAL*S**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINTGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHIDLEQYSYVPNGAAEGSWHIDLKTGSGSSGRGKPSSTVDATLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGALKSKL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query406 2.2.26 [Sep-21-2011]
A4FUZ6418 Hydroxysteroid dehydrogen yes N/A 0.640 0.622 0.537 6e-82
Q2TPA8 490 Hydroxysteroid dehydrogen yes N/A 0.640 0.530 0.515 1e-79
Q66KC4417 Hydroxysteroid dehydrogen yes N/A 0.453 0.441 0.671 4e-67
Q6PAY8417 Hydroxysteroid dehydrogen N/A N/A 0.453 0.441 0.656 3e-65
Q4V8F9 524 Hydroxysteroid dehydrogen yes N/A 0.453 0.351 0.634 3e-64
Q6P5L8415 Hydroxysteroid dehydrogen yes N/A 0.453 0.443 0.656 1e-62
Q6YN16418 Hydroxysteroid dehydrogen yes N/A 0.5 0.485 0.576 1e-61
Q5RA68418 Hydroxysteroid dehydrogen yes N/A 0.5 0.485 0.572 3e-61
Q73SC8275 Uncharacterized NAD-depen N/A N/A 0.5 0.738 0.258 2e-12
Q96LJ7313 Dehydrogenase/reductase S no N/A 0.305 0.396 0.331 6e-12
>sp|A4FUZ6|HSDL2_BOVIN Hydroxysteroid dehydrogenase-like protein 2 OS=Bos taurus GN=HSDL2 PE=2 SV=1 Back     alignment and function desciption
 Score =  305 bits (780), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 174/324 (53%), Positives = 205/324 (63%), Gaps = 64/324 (19%)

Query: 3   NTGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVED 62
           NTGKL+G T+FITGASRGIGKAIALKAAKDGANIVIAAKTA+ HPKLPGTIY+AA+E++ 
Sbjct: 4   NTGKLAGCTVFITGASRGIGKAIALKAAKDGANIVIAAKTAQAHPKLPGTIYTAAEEIKA 63

Query: 63  AGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQ 122
           AGG  LPCIVD+RDE  + SAV  AV+KFGGIDILVNNASAISLT+T  TP KK DLM  
Sbjct: 64  AGGKALPCIVDVRDEEQISSAVEKAVEKFGGIDILVNNASAISLTNTLETPTKKVDLMMN 123

Query: 123 INARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQI 182
           +N RGTY                                   LT  A  P          
Sbjct: 124 VNTRGTY-----------------------------------LTSKACIP---------- 138

Query: 183 NARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAE 242
                YL   K    L   N +  LN++P       WFK H AYTI+KYGMSMC LGMAE
Sbjct: 139 -----YLKKSKVAHIL---NLSPPLNLNP------LWFKQHCAYTIAKYGMSMCVLGMAE 184

Query: 243 EFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTG 302
           EFKG+ IAVNALWPRTAI+TAA++ML G   +++   RK +IMADAAY I    P S TG
Sbjct: 185 EFKGE-IAVNALWPRTAIHTAAMDMLGGSGVESQC--RKVDIMADAAYCIF-KKPKSFTG 240

Query: 303 QFLIDDEVLKAQHI-DLEQYSYVP 325
            F+ID+ +LK + I + + Y+  P
Sbjct: 241 NFIIDENILKEEGIKNFDVYAITP 264




Has apparently no steroid dehydrogenase activity.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q2TPA8|HSDL2_MOUSE Hydroxysteroid dehydrogenase-like protein 2 OS=Mus musculus GN=Hsdl2 PE=2 SV=1 Back     alignment and function description
>sp|Q66KC4|HSDL2_XENTR Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus tropicalis GN=hsdl2 PE=2 SV=1 Back     alignment and function description
>sp|Q6PAY8|HSDL2_XENLA Hydroxysteroid dehydrogenase-like protein 2 OS=Xenopus laevis GN=hsdl2 PE=2 SV=1 Back     alignment and function description
>sp|Q4V8F9|HSDL2_RAT Hydroxysteroid dehydrogenase-like protein 2 OS=Rattus norvegicus GN=Hsdl2 PE=2 SV=1 Back     alignment and function description
>sp|Q6P5L8|HSDL2_DANRE Hydroxysteroid dehydrogenase-like protein 2 OS=Danio rerio GN=hsdl2 PE=2 SV=1 Back     alignment and function description
>sp|Q6YN16|HSDL2_HUMAN Hydroxysteroid dehydrogenase-like protein 2 OS=Homo sapiens GN=HSDL2 PE=1 SV=1 Back     alignment and function description
>sp|Q5RA68|HSDL2_PONAB Hydroxysteroid dehydrogenase-like protein 2 OS=Pongo abelii GN=HSDL2 PE=2 SV=1 Back     alignment and function description
>sp|Q73SC8|Y4146_MYCPA Uncharacterized NAD-dependent oxidoreductase MAP_4146 OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=MAP_4146 PE=1 SV=1 Back     alignment and function description
>sp|Q96LJ7|DHRS1_HUMAN Dehydrogenase/reductase SDR family member 1 OS=Homo sapiens GN=DHRS1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
157128822415 short-chain dehydrogenase [Aedes aegypti 0.849 0.831 0.521 1e-116
157128824415 short-chain dehydrogenase [Aedes aegypti 0.849 0.831 0.518 1e-116
170048091414 glucose 1-dehydrogenase 2 [Culex quinque 0.842 0.826 0.481 3e-98
391336370406 PREDICTED: hydroxysteroid dehydrogenase- 0.852 0.852 0.452 3e-97
405963114431 Hydroxysteroid dehydrogenase-like protei 0.837 0.788 0.460 9e-93
58375839418 Anopheles gambiae str. PEST AGAP012513-P 0.655 0.636 0.548 3e-91
195503710413 GE23752 [Drosophila yakuba] gi|194184867 0.657 0.646 0.565 3e-91
324515893411 Hydroxysteroid dehydrogenase-like protei 0.849 0.839 0.423 2e-90
320164357440 SCP2 sterol transfer family protein [Cap 0.645 0.595 0.573 4e-90
324506424409 Hydroxysteroid dehydrogenase-like protei 0.842 0.836 0.422 7e-89
>gi|157128822|ref|XP_001655210.1| short-chain dehydrogenase [Aedes aegypti] gi|94468978|gb|ABF18338.1| dehydrogenase [Aedes aegypti] gi|403182484|gb|EJY57419.1| AAEL002416-PB [Aedes aegypti] Back     alignment and taxonomy information
 Score =  426 bits (1095), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 248/476 (52%), Positives = 289/476 (60%), Gaps = 131/476 (27%)

Query: 1   MINTGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEV 60
           MINTGKL+G TIFITGASRGIGKAIALKAA+DGANIV+AAKTAEPHPKLPGTI++AA E+
Sbjct: 1   MINTGKLAGRTIFITGASRGIGKAIALKAAQDGANIVVAAKTAEPHPKLPGTIFTAAAEI 60

Query: 61  EDAGGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLM 120
           E AGG  LPC+                      +D+   NA                   
Sbjct: 61  EAAGGKALPCV----------------------VDVRDENA------------------- 79

Query: 121 NQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMN 180
                             +++AV  AV+KFGGIDILVNNASAISLT T  T +K+YDLM+
Sbjct: 80  ------------------VRTAVKNAVEKFGGIDILVNNASAISLTPTEQTDMKRYDLMH 121

Query: 181 QINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGM 240
            IN RGT+LVS++C+PYLKKSNHAHILNISPPLN++  WF NHVAYT++KYGMSMC LGM
Sbjct: 122 NINTRGTFLVSKECIPYLKKSNHAHILNISPPLNMSAHWFSNHVAYTMAKYGMSMCVLGM 181

Query: 241 AEEFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSL 300
           AEEFK DN+AVNALWPRTAIYTAA+EMLTG   ++   SRKPEIM+DAAY IL   P + 
Sbjct: 182 AEEFKKDNVAVNALWPRTAIYTAAMEMLTG--KESNQFSRKPEIMSDAAYAILCKEPKNC 239

Query: 301 TGQFLIDDEVLKAQHI-DLEQYSYVPNG--------------------AAEGSWHIDLKT 339
           TG FLIDDEVL+A  I D++QY+ +P                      AAEGS    LK 
Sbjct: 240 TGNFLIDDEVLQAAGITDMKQYACIPENADKLMPDFFLDVAPEKLVEFAAEGSHAASLKK 299

Query: 340 GSGSSG-------------------------------------------------RGKPS 350
            +  +G                                                 +GK  
Sbjct: 300 AAAPAGKIEGLFQKIESLLSDEIVKKTGAVFEFNVKGEEAGLWFADLKNGTGKVGKGKSP 359

Query: 351 STVDATLTMTEKNFIALFEGKLKPTSAFMTGKLKISGNLQKAMKLEKLMGALKSKL 406
            T DATLTM  K+F  +F GKLKP SAFMTGKLKISG+LQKAMKLEKLMG LKSKL
Sbjct: 360 VTADATLTMDSKHFFDMFSGKLKPASAFMTGKLKISGDLQKAMKLEKLMGGLKSKL 415




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157128824|ref|XP_001655211.1| short-chain dehydrogenase [Aedes aegypti] gi|108882166|gb|EAT46391.1| AAEL002416-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170048091|ref|XP_001851531.1| glucose 1-dehydrogenase 2 [Culex quinquefasciatus] gi|167870283|gb|EDS33666.1| glucose 1-dehydrogenase 2 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|391336370|ref|XP_003742554.1| PREDICTED: hydroxysteroid dehydrogenase-like protein 2-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|405963114|gb|EKC28714.1| Hydroxysteroid dehydrogenase-like protein 2 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|58375839|ref|XP_307644.2| Anopheles gambiae str. PEST AGAP012513-PA [Anopheles gambiae str. PEST] gi|55246524|gb|EAA03441.3| AGAP012513-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|195503710|ref|XP_002098766.1| GE23752 [Drosophila yakuba] gi|194184867|gb|EDW98478.1| GE23752 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|324515893|gb|ADY46348.1| Hydroxysteroid dehydrogenase-like protein 2 [Ascaris suum] Back     alignment and taxonomy information
>gi|320164357|gb|EFW41256.1| SCP2 sterol transfer family protein [Capsaspora owczarzaki ATCC 30864] Back     alignment and taxonomy information
>gi|324506424|gb|ADY42744.1| Hydroxysteroid dehydrogenase-like protein 2 [Ascaris suum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
FB|FBgn0039537412 CG5590 [Drosophila melanogaste 0.450 0.444 0.688 2.7e-86
UNIPROTKB|A4FUZ6418 HSDL2 "Hydroxysteroid dehydrog 0.453 0.440 0.661 4.1e-79
UNIPROTKB|F1MF48418 HSDL2 "Hydroxysteroid dehydrog 0.453 0.440 0.661 4.1e-79
RGD|1305387 524 Hsdl2 "hydroxysteroid dehydrog 0.453 0.351 0.634 2.5e-77
UNIPROTKB|Q4V8F9 524 Hsdl2 "Hydroxysteroid dehydrog 0.453 0.351 0.634 2.5e-77
MGI|MGI:1919729 490 Hsdl2 "hydroxysteroid dehydrog 0.504 0.418 0.593 1.1e-76
UNIPROTKB|F1Q3R2418 HSDL2 "Uncharacterized protein 0.453 0.440 0.634 1.1e-76
UNIPROTKB|F1LRD0 518 Hsdl2 "Hydroxysteroid dehydrog 0.453 0.355 0.634 4.6e-76
UNIPROTKB|F1SNA8418 HSDL2 "Uncharacterized protein 0.453 0.440 0.640 4.6e-76
ZFIN|ZDB-GENE-030131-1066415 hsdl2 "hydroxysteroid dehydrog 0.453 0.443 0.656 1.6e-75
FB|FBgn0039537 CG5590 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 655 (235.6 bits), Expect = 2.7e-86, Sum P(2) = 2.7e-86
 Identities = 128/186 (68%), Positives = 154/186 (82%)

Query:   138 EIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPY 197
             +++SAV AAV KFGGIDI++NNASAISLT+T +T +K+YDLM+ IN RGT+LVS+ CLPY
Sbjct:    79 QVRSAVEAAVAKFGGIDIVINNASAISLTNTPDTDMKRYDLMHNINTRGTFLVSKVCLPY 138

Query:   198 LKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPR 257
             LKKSNHAHILNISPPL++ P WF  HVAYT++KYGMSMC LGMA EFK + I+VNALWPR
Sbjct:   139 LKKSNHAHILNISPPLSMKPKWFGPHVAYTMAKYGMSMCVLGMAAEFKDEGISVNALWPR 198

Query:   258 TAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHI- 316
             TAI+TAAIEMLTG   D+   SRKPEIMADAAY IL+  P   TGQF +DDEVL++  I 
Sbjct:   199 TAIHTAAIEMLTG--PDSAKWSRKPEIMADAAYAILTREPRQSTGQFFVDDEVLESAGIT 256

Query:   317 DLEQYS 322
             DL +Y+
Sbjct:   257 DLTEYA 262


GO:0016616 "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0032934 "sterol binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0005875 "microtubule associated complex" evidence=IDA
UNIPROTKB|A4FUZ6 HSDL2 "Hydroxysteroid dehydrogenase-like protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1MF48 HSDL2 "Hydroxysteroid dehydrogenase-like protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1305387 Hsdl2 "hydroxysteroid dehydrogenase like 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q4V8F9 Hsdl2 "Hydroxysteroid dehydrogenase-like protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1919729 Hsdl2 "hydroxysteroid dehydrogenase like 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3R2 HSDL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRD0 Hsdl2 "Hydroxysteroid dehydrogenase-like protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SNA8 HSDL2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-1066 hsdl2 "hydroxysteroid dehydrogenase like 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4V8F9HSDL2_RAT1, ., -, ., -, ., -0.63490.45320.3511yesN/A
Q5RA68HSDL2_PONAB1, ., -, ., -, ., -0.57210.50.4856yesN/A
Q6P5L8HSDL2_DANRE1, ., -, ., -, ., -0.65600.45320.4433yesN/A
A4FUZ6HSDL2_BOVIN1, ., -, ., -, ., -0.53700.64030.6220yesN/A
Q2TPA8HSDL2_MOUSE1, ., -, ., -, ., -0.51540.64030.5306yesN/A
Q6YN16HSDL2_HUMAN1, ., -, ., -, ., -0.57690.50.4856yesN/A
Q66KC4HSDL2_XENTR1, ., -, ., -, ., -0.67190.45320.4412yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Pro 1e-106
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 1e-100
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 9e-80
PRK08278273 PRK08278, PRK08278, short chain dehydrogenase; Pro 2e-78
cd09762243 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydro 8e-78
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-31
cd05233234 cd05233, SDR_c, classical (c) SDRs 2e-27
cd05233234 cd05233, SDR_c, classical (c) SDRs 1e-26
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-26
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-23
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 7e-23
cd09763265 cd09763, DHRS1-like_SDR_c, human dehydrogenase/red 9e-23
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-22
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 2e-21
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 2e-21
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 3e-21
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-21
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 4e-21
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 6e-21
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 8e-21
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-20
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 3e-20
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 4e-20
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 5e-20
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 5e-20
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 7e-20
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 1e-19
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 2e-19
PRK07109334 PRK07109, PRK07109, short chain dehydrogenase; Pro 5e-19
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 6e-19
pfam02036100 pfam02036, SCP2, SCP-2 sterol transfer family 1e-18
PRK07677252 PRK07677, PRK07677, short chain dehydrogenase; Pro 1e-18
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 1e-18
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 3e-18
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 3e-18
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 4e-18
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 5e-18
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 5e-18
PRK07201657 PRK07201, PRK07201, short chain dehydrogenase; Pro 2e-17
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 2e-17
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 5e-17
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 5e-17
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 6e-17
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 6e-17
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 1e-16
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 1e-16
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 2e-16
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 2e-16
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 2e-16
cd05360233 cd05360, SDR_c3, classical (c) SDR, subgroup 3 3e-16
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 4e-16
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 6e-16
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 6e-16
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-15
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 1e-15
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 1e-15
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-15
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 2e-15
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 2e-15
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-15
PRK08643256 PRK08643, PRK08643, acetoin reductase; Validated 3e-15
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 4e-15
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 5e-15
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 6e-15
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 7e-15
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 8e-15
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 8e-15
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 9e-15
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 1e-14
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 1e-14
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 1e-14
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 1e-14
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 2e-14
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 2e-14
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 3e-14
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 3e-14
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 3e-14
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 5e-14
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 5e-14
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 5e-14
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Pro 5e-14
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 6e-14
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 6e-14
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 7e-14
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 7e-14
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 9e-14
PRK07806248 PRK07806, PRK07806, short chain dehydrogenase; Pro 9e-14
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 1e-13
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 1e-13
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 1e-13
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 2e-13
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 2e-13
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 2e-13
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 3e-13
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 3e-13
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 3e-13
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 4e-13
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 6e-13
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 6e-13
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 8e-13
PRK07791286 PRK07791, PRK07791, short chain dehydrogenase; Pro 9e-13
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 1e-12
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 1e-12
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 1e-12
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 2e-12
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 2e-12
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 4e-12
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 4e-12
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Pro 4e-12
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 5e-12
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-12
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 6e-12
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 6e-12
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 9e-12
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 1e-11
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 1e-11
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-11
PRK06198260 PRK06198, PRK06198, short chain dehydrogenase; Pro 1e-11
PRK05866293 PRK05866, PRK05866, short chain dehydrogenase; Pro 1e-11
PRK06949258 PRK06949, PRK06949, short chain dehydrogenase; Pro 2e-11
PRK07856252 PRK07856, PRK07856, short chain dehydrogenase; Pro 2e-11
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 2e-11
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-11
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 3e-11
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-11
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 3e-11
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 3e-11
PRK07523255 PRK07523, PRK07523, gluconate 5-dehydrogenase; Pro 4e-11
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 4e-11
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 4e-11
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 5e-11
cd05357234 cd05357, PR_SDR_c, pteridine reductase (PR), class 6e-11
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 6e-11
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 6e-11
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 7e-11
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 8e-11
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 9e-11
PRK06125259 PRK06125, PRK06125, short chain dehydrogenase; Pro 9e-11
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-10
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-10
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 1e-10
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 1e-10
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 1e-10
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 1e-10
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 1e-10
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 1e-10
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 1e-10
cd05367241 cd05367, SPR-like_SDR_c, sepiapterin reductase (SP 1e-10
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 2e-10
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 2e-10
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 2e-10
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 3e-10
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 3e-10
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 3e-10
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 4e-10
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 4e-10
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 4e-10
PRK06139330 PRK06139, PRK06139, short chain dehydrogenase; Pro 4e-10
cd08940258 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydroge 5e-10
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 5e-10
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 5e-10
COG3255134 COG3255, COG3255, Putative sterol carrier protein 7e-10
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 7e-10
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 9e-10
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 1e-09
PRK08628258 PRK08628, PRK08628, short chain dehydrogenase; Pro 1e-09
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 1e-09
TIGR03206250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxy 1e-09
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 1e-09
cd05356239 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxyst 2e-09
PRK08261450 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-09
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 2e-09
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 3e-09
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 3e-09
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 3e-09
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 3e-09
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 3e-09
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 3e-09
PRK06523260 PRK06523, PRK06523, short chain dehydrogenase; Pro 3e-09
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 4e-09
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 4e-09
PRK07024257 PRK07024, PRK07024, short chain dehydrogenase; Pro 4e-09
PRK08277278 PRK08277, PRK08277, D-mannonate oxidoreductase; Pr 5e-09
PRK07792306 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) 5e-09
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 6e-09
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 6e-09
cd08935271 cd08935, mannonate_red_SDR_c, putative D-mannonate 6e-09
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 7e-09
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 7e-09
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 8e-09
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 1e-08
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 1e-08
PRK09135249 PRK09135, PRK09135, pteridine reductase; Provision 1e-08
PRK12747252 PRK12747, PRK12747, short chain dehydrogenase; Pro 1e-08
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 2e-08
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 2e-08
cd05359242 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_c 2e-08
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 2e-08
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 2e-08
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 2e-08
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 3e-08
PRK09134258 PRK09134, PRK09134, short chain dehydrogenase; Pro 3e-08
cd05332257 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxyste 4e-08
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 4e-08
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 4e-08
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 4e-08
cd08934243 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase 5e-08
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 5e-08
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 6e-08
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 6e-08
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 6e-08
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 7e-08
PRK08220252 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehy 7e-08
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 7e-08
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 8e-08
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 8e-08
PRK08063250 PRK08063, PRK08063, enoyl-(acyl carrier protein) r 9e-08
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 9e-08
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 9e-08
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 9e-08
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 1e-07
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 1e-07
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 1e-07
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 2e-07
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 2e-07
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 2e-07
PRK07577234 PRK07577, PRK07577, short chain dehydrogenase; Pro 2e-07
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 2e-07
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 3e-07
cd09761242 cd09761, A3DFK9-like_SDR_c, Clostridium thermocell 3e-07
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 3e-07
PRK10538248 PRK10538, PRK10538, malonic semialdehyde reductase 4e-07
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 5e-07
PRK12744257 PRK12744, PRK12744, short chain dehydrogenase; Pro 7e-07
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 9e-07
PRK07069251 PRK07069, PRK07069, short chain dehydrogenase; Val 9e-07
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 1e-06
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 1e-06
cd08937256 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa 1e-06
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 1e-06
PRK09186256 PRK09186, PRK09186, flagellin modification protein 1e-06
PRK07832272 PRK07832, PRK07832, short chain dehydrogenase; Pro 1e-06
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 2e-06
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 2e-06
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 2e-06
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 2e-06
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 2e-06
PRK08303305 PRK08303, PRK08303, short chain dehydrogenase; Pro 2e-06
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 2e-06
cd08930250 cd08930, SDR_c8, classical (c) SDR, subgroup 8 2e-06
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 2e-06
PRK08219227 PRK08219, PRK08219, short chain dehydrogenase; Pro 2e-06
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 2e-06
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 3e-06
PRK08642253 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) 4e-06
cd08953436 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 4e-06
PRK12824245 PRK12824, PRK12824, acetoacetyl-CoA reductase; Pro 4e-06
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 4e-06
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 5e-06
PRK09291257 PRK09291, PRK09291, short chain dehydrogenase; Pro 5e-06
cd05346249 cd05346, SDR_c5, classical (c) SDR, subgroup 5 6e-06
TIGR01831239 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-prote 6e-06
PRK06077252 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-06
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 7e-06
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 8e-06
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 8e-06
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 9e-06
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 9e-06
PRK06720169 PRK06720, PRK06720, hypothetical protein; Provisio 9e-06
PRK12748256 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-prote 1e-05
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 1e-05
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 1e-05
PRK06181263 PRK06181, PRK06181, short chain dehydrogenase; Pro 2e-05
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 2e-05
PRK06180277 PRK06180, PRK06180, short chain dehydrogenase; Pro 2e-05
PRK08265261 PRK08265, PRK08265, short chain dehydrogenase; Pro 2e-05
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 2e-05
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 2e-05
PRK06924251 PRK06924, PRK06924, short chain dehydrogenase; Pro 2e-05
PRK09730247 PRK09730, PRK09730, putative NAD(P)-binding oxidor 2e-05
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote 2e-05
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 2e-05
PRK07775274 PRK07775, PRK07775, short chain dehydrogenase; Pro 2e-05
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 3e-05
PRK07576264 PRK07576, PRK07576, short chain dehydrogenase; Pro 3e-05
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 3e-05
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 3e-05
PRK05875276 PRK05875, PRK05875, short chain dehydrogenase; Pro 3e-05
cd05334221 cd05334, DHPR_SDR_c_like, dihydropteridine reducta 3e-05
PRK08340259 PRK08340, PRK08340, glucose-1-dehydrogenase; Provi 3e-05
PRK09186256 PRK09186, PRK09186, flagellin modification protein 4e-05
PRK08263275 PRK08263, PRK08263, short chain dehydrogenase; Pro 5e-05
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 9e-05
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 1e-04
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 1e-04
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 1e-04
cd09806258 cd09806, type1_17beta-HSD-like_SDR_c, human estrog 1e-04
PRK05693274 PRK05693, PRK05693, short chain dehydrogenase; Pro 1e-04
smart00822180 smart00822, PKS_KR, This enzymatic domain is part 1e-04
cd08945258 cd08945, PKR_SDR_c, Polyketide ketoreductase, clas 2e-04
PRK08251248 PRK08251, PRK08251, short chain dehydrogenase; Pro 2e-04
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 2e-04
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 2e-04
cd09808255 cd09808, DHRS-12_like_SDR_c-like, human dehydrogen 2e-04
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 3e-04
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 3e-04
PRK08703239 PRK08703, PRK08703, short chain dehydrogenase; Pro 3e-04
cd05361242 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol de 3e-04
PRK08416260 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydro 3e-04
cd09807274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 3e-04
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 5e-04
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 6e-04
PRK07041230 PRK07041, PRK07041, short chain dehydrogenase; Pro 6e-04
TIGR03325262 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3- 7e-04
PRK06182273 PRK06182, PRK06182, short chain dehydrogenase; Val 9e-04
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 0.001
PRK12823260 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1 0.001
cd05350239 cd05350, SDR_c6, classical (c) SDR, subgroup 6 0.001
PRK12742237 PRK12742, PRK12742, oxidoreductase; Provisional 0.001
PRK06482276 PRK06482, PRK06482, short chain dehydrogenase; Pro 0.001
PRK06483236 PRK06483, PRK06483, dihydromonapterin reductase; P 0.001
pfam08659181 pfam08659, KR, KR domain 0.001
PRK07814263 PRK07814, PRK07814, short chain dehydrogenase; Pro 0.002
PRK05717255 PRK05717, PRK05717, oxidoreductase; Validated 0.002
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 0.002
PRK12936245 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-prote 0.002
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 0.003
TIGR01829242 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reducta 0.003
PRK06701290 PRK06701, PRK06701, short chain dehydrogenase; Pro 0.004
PRK06179270 PRK06179, PRK06179, short chain dehydrogenase; Pro 0.004
cd05373238 cd05373, SDR_c10, classical (c) SDR, subgroup 10 0.004
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 0.004
PRK05786238 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.004
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
 Score =  315 bits (809), Expect = e-106
 Identities = 115/191 (60%), Positives = 141/191 (73%), Gaps = 2/191 (1%)

Query: 139 IQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYL 198
           + +AV  AV++FGGIDI VNNASAI+LT T +TP+K++DLM QIN RGT+LVSQ CLP+L
Sbjct: 77  VAAAVAKAVERFGGIDICVNNASAINLTGTEDTPMKRFDLMQQINVRGTFLVSQACLPHL 136

Query: 199 KKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPRT 258
           KKS + HIL +SPPLNL+P WF  H AYT++KYGMS+C LG+AEEF+ D IAVNALWPRT
Sbjct: 137 KKSENPHILTLSPPLNLDPKWFAPHTAYTMAKYGMSLCTLGLAEEFRDDGIAVNALWPRT 196

Query: 259 AIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHI-D 317
            I TAA+  L GG    +  SR PEIMADAAY ILS      TG FLID+EVL+   + D
Sbjct: 197 TIATAAVRNLLGGDEAMRR-SRTPEIMADAAYEILSRPAREFTGNFLIDEEVLREAGVTD 255

Query: 318 LEQYSYVPNGA 328
             +Y+  P   
Sbjct: 256 FSRYAVDPGAP 266


Length = 273

>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181349 PRK08278, PRK08278, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187663 cd09762, HSDL2_SDR_c, human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187664 cd09763, DHRS1-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235935 PRK07109, PRK07109, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|216855 pfam02036, SCP2, SCP-2 sterol transfer family Back     alignment and domain information
>gnl|CDD|181077 PRK07677, PRK07677, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|235962 PRK07201, PRK07201, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187618 cd05360, SDR_c3, classical (c) SDR, subgroup 3 Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181126 PRK07806, PRK07806, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236099 PRK07791, PRK07791, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180462 PRK06198, PRK06198, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235631 PRK05866, PRK05866, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180773 PRK06949, PRK06949, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236116 PRK07856, PRK07856, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236040 PRK07523, PRK07523, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187615 cd05357, PR_SDR_c, pteridine reductase (PR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235703 PRK06125, PRK06125, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187625 cd05367, SPR-like_SDR_c, sepiapterin reductase (SPR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235713 PRK06139, PRK06139, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187644 cd08940, HBDH_SDR_c, d-3-hydroxybutyrate dehydrogenase (HBDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|225794 COG3255, COG3255, Putative sterol carrier protein [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181508 PRK08628, PRK08628, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|132250 TIGR03206, benzo_BadH, 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187614 cd05356, 17beta-HSD1_like_SDR_c, 17-beta-hydroxysteroid dehydrogenases (17beta-HSDs) types -1, -3, and -12, -like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236207 PRK08261, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180604 PRK06523, PRK06523, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235910 PRK07024, PRK07024, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236216 PRK08277, PRK08277, D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181120 PRK07792, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187640 cd08935, mannonate_red_SDR_c, putative D-mannonate oxidoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181668 PRK09135, PRK09135, pteridine reductase; Provisional Back     alignment and domain information
>gnl|CDD|183719 PRK12747, PRK12747, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187617 cd05359, ChcA_like_SDR_c, 1-cyclohexenylcarbonyl_coenzyme A_reductase (ChcA)_like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236389 PRK09134, PRK09134, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187593 cd05332, 11beta-HSD1_like_SDR_c, 11beta-hydroxysteroid dehydrogenase type 1 (11beta-HSD1)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187639 cd08934, CAD_SDR_c, clavulanic acid dehydrogenase (CAD), classical (c) SDR Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236190 PRK08220, PRK08220, 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236145 PRK08063, PRK08063, enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|181044 PRK07577, PRK07577, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|187662 cd09761, A3DFK9-like_SDR_c, Clostridium thermocellum A3DFK9-like, a putative carbohydrate or polyalcohol metabolizing SDR, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|182531 PRK10538, PRK10538, malonic semialdehyde reductase; Provisional Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183716 PRK12744, PRK12744, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180822 PRK07069, PRK07069, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|187642 cd08937, DHB_DH-like_SDR_c, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase (DHB DH)-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|181139 PRK07832, PRK07832, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|236229 PRK08303, PRK08303, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187635 cd08930, SDR_c8, classical (c) SDR, subgroup 8 Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|181298 PRK08219, PRK08219, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181517 PRK08642, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187656 cd08953, KR_2_SDR_x, ketoreductase (KR), subgroup 2, complex (x) SDRs Back     alignment and domain information
>gnl|CDD|183773 PRK12824, PRK12824, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181762 PRK09291, PRK09291, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187604 cd05346, SDR_c5, classical (c) SDR, subgroup 5 Back     alignment and domain information
>gnl|CDD|130890 TIGR01831, fabG_rel, 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>gnl|CDD|235693 PRK06077, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|180669 PRK06720, PRK06720, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|237189 PRK12748, PRK12748, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235726 PRK06181, PRK06181, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180446 PRK06180, PRK06180, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236209 PRK08265, PRK08265, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180753 PRK06924, PRK06924, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|182051 PRK09730, PRK09730, putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|181113 PRK07775, PRK07775, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236056 PRK07576, PRK07576, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180300 PRK05875, PRK05875, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187595 cd05334, DHPR_SDR_c_like, dihydropteridine reductase (DHPR), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|169390 PRK08340, PRK08340, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236399 PRK09186, PRK09186, flagellin modification protein A; Provisional Back     alignment and domain information
>gnl|CDD|181334 PRK08263, PRK08263, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|187666 cd09806, type1_17beta-HSD-like_SDR_c, human estrogenic 17beta-hydroxysteroid dehydrogenase type 1 (type 1 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|168186 PRK05693, PRK05693, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|214833 smart00822, PKS_KR, This enzymatic domain is part of bacterial polyketide synthases Back     alignment and domain information
>gnl|CDD|187649 cd08945, PKR_SDR_c, Polyketide ketoreductase, classical (c) SDR Back     alignment and domain information
>gnl|CDD|181324 PRK08251, PRK08251, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187668 cd09808, DHRS-12_like_SDR_c-like, human dehydrogenase/reductase SDR family member (DHRS)-12/FLJ13639-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|169556 PRK08703, PRK08703, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187619 cd05361, haloalcohol_DH_SDR_c-like, haloalcohol dehalogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181417 PRK08416, PRK08416, 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235914 PRK07041, PRK07041, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|132368 TIGR03325, BphB_TodD, cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>gnl|CDD|180448 PRK06182, PRK06182, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|183772 PRK12823, benD, 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187608 cd05350, SDR_c6, classical (c) SDR, subgroup 6 Back     alignment and domain information
>gnl|CDD|183714 PRK12742, PRK12742, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235813 PRK06482, PRK06482, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180586 PRK06483, PRK06483, dihydromonapterin reductase; Provisional Back     alignment and domain information
>gnl|CDD|219957 pfam08659, KR, KR domain Back     alignment and domain information
>gnl|CDD|181131 PRK07814, PRK07814, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168204 PRK05717, PRK05717, oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|171820 PRK12936, PRK12936, 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188169 TIGR01829, AcAcCoA_reduct, acetoacetyl-CoA reductase Back     alignment and domain information
>gnl|CDD|235853 PRK06701, PRK06701, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235725 PRK06179, PRK06179, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187631 cd05373, SDR_c10, classical (c) SDR, subgroup 10 Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235608 PRK05786, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 406
KOG1200|consensus256 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08278273 short chain dehydrogenase; Provisional 100.0
KOG0725|consensus270 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PLN02730303 enoyl-[acyl-carrier-protein] reductase 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 100.0
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08085254 gluconate 5-dehydrogenase; Provisional 100.0
PRK08277278 D-mannonate oxidoreductase; Provisional 100.0
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 100.0
PRK08265261 short chain dehydrogenase; Provisional 100.0
PRK06398258 aldose dehydrogenase; Validated 100.0
KOG1205|consensus282 100.0
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK12747252 short chain dehydrogenase; Provisional 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07985294 oxidoreductase; Provisional 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 100.0
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07035252 short chain dehydrogenase; Provisional 100.0
PRK06172253 short chain dehydrogenase; Provisional 100.0
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07523255 gluconate 5-dehydrogenase; Provisional 100.0
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 100.0
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 100.0
PRK07097265 gluconate 5-dehydrogenase; Provisional 100.0
KOG1201|consensus300 100.0
PRK06128300 oxidoreductase; Provisional 100.0
PRK07856252 short chain dehydrogenase; Provisional 100.0
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 100.0
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 100.0
PRK06125259 short chain dehydrogenase; Provisional 100.0
PLN02253280 xanthoxin dehydrogenase 100.0
PRK07831262 short chain dehydrogenase; Provisional 100.0
PRK07677252 short chain dehydrogenase; Provisional 100.0
PRK08643256 acetoin reductase; Validated 100.0
PRK06523260 short chain dehydrogenase; Provisional 100.0
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 100.0
PRK08226263 short chain dehydrogenase; Provisional 100.0
PRK08936261 glucose-1-dehydrogenase; Provisional 100.0
PRK08862227 short chain dehydrogenase; Provisional 100.0
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07576264 short chain dehydrogenase; Provisional 100.0
PRK06483236 dihydromonapterin reductase; Provisional 100.0
PRK09242257 tropinone reductase; Provisional 100.0
PRK06940275 short chain dehydrogenase; Provisional 100.0
PRK06484520 short chain dehydrogenase; Validated 100.0
PRK06124256 gluconate 5-dehydrogenase; Provisional 100.0
PRK07067257 sorbitol dehydrogenase; Provisional 100.0
PRK06841255 short chain dehydrogenase; Provisional 100.0
PRK05872296 short chain dehydrogenase; Provisional 100.0
KOG1207|consensus245 100.0
PRK12743256 oxidoreductase; Provisional 100.0
PRK06139330 short chain dehydrogenase; Provisional 100.0
PRK05717255 oxidoreductase; Validated 100.0
PRK12938246 acetyacetyl-CoA reductase; Provisional 100.0
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 100.0
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 100.0
PRK06949258 short chain dehydrogenase; Provisional 100.0
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 100.0
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08628258 short chain dehydrogenase; Provisional 100.0
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07890258 short chain dehydrogenase; Provisional 100.0
PRK05599246 hypothetical protein; Provisional 100.0
PRK05876275 short chain dehydrogenase; Provisional 100.0
PRK06500249 short chain dehydrogenase; Provisional 100.0
PRK06484 520 short chain dehydrogenase; Validated 100.0
PRK05884223 short chain dehydrogenase; Provisional 100.0
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 100.0
PRK07814263 short chain dehydrogenase; Provisional 100.0
PRK12744257 short chain dehydrogenase; Provisional 100.0
PRK09186256 flagellin modification protein A; Provisional 100.0
PRK06701290 short chain dehydrogenase; Provisional 100.0
TIGR02415254 23BDH acetoin reductases. One member of this famil 100.0
PRK12939250 short chain dehydrogenase; Provisional 100.0
PRK07109334 short chain dehydrogenase; Provisional 100.0
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 100.0
PRK12742237 oxidoreductase; Provisional 100.0
PRK12937245 short chain dehydrogenase; Provisional 100.0
PRK08703239 short chain dehydrogenase; Provisional 100.0
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 100.0
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 100.0
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK06138252 short chain dehydrogenase; Provisional 100.0
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK06198260 short chain dehydrogenase; Provisional 100.0
PLN00015308 protochlorophyllide reductase 100.0
PRK08213259 gluconate 5-dehydrogenase; Provisional 100.0
PRK06947248 glucose-1-dehydrogenase; Provisional 100.0
PRK06057255 short chain dehydrogenase; Provisional 100.0
PRK12935247 acetoacetyl-CoA reductase; Provisional 100.0
PRK07825273 short chain dehydrogenase; Provisional 100.0
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 100.0
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 100.0
PRK12824245 acetoacetyl-CoA reductase; Provisional 100.0
PRK06123248 short chain dehydrogenase; Provisional 100.0
PRK07069251 short chain dehydrogenase; Validated 100.0
PRK09134258 short chain dehydrogenase; Provisional 100.0
PRK07454241 short chain dehydrogenase; Provisional 100.0
PRK07774250 short chain dehydrogenase; Provisional 100.0
PRK06182273 short chain dehydrogenase; Validated 100.0
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 100.0
PRK06196315 oxidoreductase; Provisional 100.0
PRK05875276 short chain dehydrogenase; Provisional 100.0
PRK05866293 short chain dehydrogenase; Provisional 100.0
KOG4169|consensus261 100.0
PLN02780320 ketoreductase/ oxidoreductase 100.0
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 100.0
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK05855582 short chain dehydrogenase; Validated 100.0
PRK05854313 short chain dehydrogenase; Provisional 100.0
PRK12827249 short chain dehydrogenase; Provisional 100.0
PRK09009235 C factor cell-cell signaling protein; Provisional 100.0
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 100.0
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 100.0
PRK07577234 short chain dehydrogenase; Provisional 100.0
PRK06194287 hypothetical protein; Provisional 100.0
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 100.0
PRK07832272 short chain dehydrogenase; Provisional 100.0
PRK07074257 short chain dehydrogenase; Provisional 100.0
PRK12746254 short chain dehydrogenase; Provisional 100.0
PRK07024257 short chain dehydrogenase; Provisional 100.0
KOG1199|consensus260 100.0
PRK05993277 short chain dehydrogenase; Provisional 100.0
PRK07904253 short chain dehydrogenase; Provisional 100.0
PRK10538248 malonic semialdehyde reductase; Provisional 99.98
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.98
PRK06197306 short chain dehydrogenase; Provisional 99.98
PRK09072263 short chain dehydrogenase; Provisional 99.98
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.98
PRK06179270 short chain dehydrogenase; Provisional 99.98
PRK07060245 short chain dehydrogenase; Provisional 99.98
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
PRK06180277 short chain dehydrogenase; Provisional 99.98
PRK06924251 short chain dehydrogenase; Provisional 99.98
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.98
COG1028251 FabG Dehydrogenases with different specificities ( 99.98
KOG1208|consensus314 99.98
PRK05650270 short chain dehydrogenase; Provisional 99.98
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK12828239 short chain dehydrogenase; Provisional 99.97
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.97
PRK08263275 short chain dehydrogenase; Provisional 99.97
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.97
PRK08267260 short chain dehydrogenase; Provisional 99.97
PRK07806248 short chain dehydrogenase; Provisional 99.97
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK06914280 short chain dehydrogenase; Provisional 99.97
PRK08324681 short chain dehydrogenase; Validated 99.97
PRK08251248 short chain dehydrogenase; Provisional 99.97
PRK07775274 short chain dehydrogenase; Provisional 99.97
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.97
PRK07578199 short chain dehydrogenase; Provisional 99.97
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.97
PRK12829264 short chain dehydrogenase; Provisional 99.97
KOG1611|consensus249 99.97
PRK06181263 short chain dehydrogenase; Provisional 99.97
PRK05693274 short chain dehydrogenase; Provisional 99.97
PRK07201657 short chain dehydrogenase; Provisional 99.97
PRK07041230 short chain dehydrogenase; Provisional 99.97
PRK07326237 short chain dehydrogenase; Provisional 99.97
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.97
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK07102243 short chain dehydrogenase; Provisional 99.97
PRK07023243 short chain dehydrogenase; Provisional 99.97
PRK09135249 pteridine reductase; Provisional 99.96
PRK06482276 short chain dehydrogenase; Provisional 99.96
KOG1209|consensus289 99.96
PRK06101240 short chain dehydrogenase; Provisional 99.96
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.96
KOG1014|consensus312 99.96
KOG1610|consensus322 99.96
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.96
PRK08264238 short chain dehydrogenase; Validated 99.95
PRK12367245 short chain dehydrogenase; Provisional 99.95
PRK08177225 short chain dehydrogenase; Provisional 99.95
PRK08017256 oxidoreductase; Provisional 99.95
PRK09291257 short chain dehydrogenase; Provisional 99.95
KOG1210|consensus331 99.95
KOG1204|consensus253 99.94
KOG4170|consensus113 99.93
PRK06953222 short chain dehydrogenase; Provisional 99.93
PRK08219227 short chain dehydrogenase; Provisional 99.93
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.92
KOG1478|consensus341 99.91
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.89
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.89
PLN03209 576 translocon at the inner envelope of chloroplast su 99.85
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.84
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.84
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.81
PRK06720169 hypothetical protein; Provisional 99.81
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.78
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.76
PLN02653340 GDP-mannose 4,6-dehydratase 99.75
PLN02583297 cinnamoyl-CoA reductase 99.71
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.69
PLN00198338 anthocyanidin reductase; Provisional 99.68
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.65
PLN02650351 dihydroflavonol-4-reductase 99.65
PLN02572442 UDP-sulfoquinovose synthase 99.64
PLN02214342 cinnamoyl-CoA reductase 99.64
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.64
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.64
PLN02240352 UDP-glucose 4-epimerase 99.63
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.61
PLN02896353 cinnamyl-alcohol dehydrogenase 99.59
KOG1502|consensus327 99.59
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.58
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.57
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.56
PF02036102 SCP2: SCP-2 sterol transfer family; InterPro: IPR0 99.54
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.52
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.52
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.5
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.5
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.49
PLN02686367 cinnamoyl-CoA reductase 99.49
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 99.48
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.44
PLN02427386 UDP-apiose/xylose synthase 99.43
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.42
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 99.36
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.36
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 99.34
COG3255134 Putative sterol carrier protein [Lipid metabolism] 99.34
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.34
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 99.33
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 99.32
PLN02695370 GDP-D-mannose-3',5'-epimerase 99.31
CHL00194317 ycf39 Ycf39; Provisional 99.29
PLN02260 668 probable rhamnose biosynthetic enzyme 99.28
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.26
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 99.24
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.23
KOG4022|consensus236 99.21
PLN02206442 UDP-glucuronate decarboxylase 99.21
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 99.2
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 99.2
PF08643299 DUF1776: Fungal family of unknown function (DUF177 99.18
KOG1371|consensus343 99.15
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 99.14
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 99.11
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.1
PLN02166436 dTDP-glucose 4,6-dehydratase 99.09
PRK05865 854 hypothetical protein; Provisional 99.07
PRK07201 657 short chain dehydrogenase; Provisional 99.03
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.0
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 99.0
PLN02778298 3,5-epimerase/4-reductase 98.97
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 98.96
PLN02996 491 fatty acyl-CoA reductase 98.96
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.92
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 98.9
PRK08309177 short chain dehydrogenase; Provisional 98.85
KOG1430|consensus361 98.78
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 98.74
TIGR034431389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.72
COG3320382 Putative dehydrogenase domain of multifunctional n 98.71
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.71
PLN02503 605 fatty acyl-CoA reductase 2 98.64
PLN00016378 RNA-binding protein; Provisional 98.63
PLN02260668 probable rhamnose biosynthetic enzyme 98.62
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 98.55
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 98.49
PRK12548289 shikimate 5-dehydrogenase; Provisional 98.48
PRK06732229 phosphopantothenate--cysteine ligase; Validated 98.38
PRK12320 699 hypothetical protein; Provisional 98.31
COG4982 866 3-oxoacyl-[acyl-carrier protein] 98.31
KOG1202|consensus 2376 98.26
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 98.25
PF14864125 Alkyl_sulf_C: Alkyl sulfatase C-terminal; PDB: 2CG 98.24
KOG2865|consensus391 98.1
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 98.09
KOG1429|consensus350 98.05
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 97.99
COG3154168 Putative lipid carrier protein [Lipid metabolism] 97.88
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.84
KOG2733|consensus423 97.79
KOG0747|consensus331 97.78
PRK09620229 hypothetical protein; Provisional 97.75
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 97.7
KOG1221|consensus 467 97.7
KOG1431|consensus315 97.64
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 97.53
KOG1372|consensus376 97.53
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 97.52
PF04127185 DFP: DNA / pantothenate metabolism flavoprotein; I 97.46
PLN00106323 malate dehydrogenase 97.43
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 97.36
KOG1203|consensus411 97.31
PTZ00325321 malate dehydrogenase; Provisional 97.3
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 97.28
COG2910211 Putative NADH-flavin reductase [General function p 97.15
PRK14982340 acyl-ACP reductase; Provisional 97.07
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 96.97
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 96.92
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 96.91
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 96.86
KOG4039|consensus238 96.84
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 96.79
PRK13982475 bifunctional SbtC-like/phosphopantothenoylcysteine 96.7
KOG2774|consensus366 96.56
PRK06849389 hypothetical protein; Provisional 96.54
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 96.53
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 96.45
cd00704323 MDH Malate dehydrogenase. Malate dehydrogenase (MD 96.43
COG3007398 Uncharacterized paraquat-inducible protein B [Func 96.39
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 96.35
TIGR01758324 MDH_euk_cyt malate dehydrogenase, NAD-dependent. T 96.35
PRK05086312 malate dehydrogenase; Provisional 96.31
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 96.31
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 96.27
PRK12549284 shikimate 5-dehydrogenase; Reviewed 96.26
PF1224278 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2 96.26
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 96.25
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 96.17
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 96.09
KOG1198|consensus347 96.01
COG2015655 Alkyl sulfatase and related hydrolases [Secondary 95.96
PRK15116268 sulfur acceptor protein CsdL; Provisional 95.96
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.87
PLN02520529 bifunctional 3-dehydroquinate dehydratase/shikimat 95.87
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 95.86
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 95.81
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 95.79
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 95.77
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 95.72
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 95.69
cd01338322 MDH_choloroplast_like Chloroplast-like malate dehy 95.65
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 95.6
PRK13940414 glutamyl-tRNA reductase; Provisional 95.59
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 95.58
TIGR00715256 precor6x_red precorrin-6x reductase. This enzyme w 95.49
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 95.48
PRK14027283 quinate/shikimate dehydrogenase; Provisional 95.44
PRK08306296 dipicolinate synthase subunit A; Reviewed 95.43
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 95.42
COG3268382 Uncharacterized conserved protein [Function unknow 95.4
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 95.39
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 95.37
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 95.35
PRK09880343 L-idonate 5-dehydrogenase; Provisional 95.29
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 95.26
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 95.19
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 95.15
PRK06718202 precorrin-2 dehydrogenase; Reviewed 95.08
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 95.0
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 94.98
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 94.95
PRK12749288 quinate/shikimate dehydrogenase; Reviewed 94.88
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 94.83
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 94.82
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 94.69
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 94.65
COG0569225 TrkA K+ transport systems, NAD-binding component [ 94.53
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 94.5
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 94.49
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 94.48
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 94.36
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 94.31
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 94.29
PLN02740381 Alcohol dehydrogenase-like 94.25
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 94.15
COG2130340 Putative NADP-dependent oxidoreductases [General f 94.12
PRK14968188 putative methyltransferase; Provisional 94.07
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 94.07
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 94.04
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 94.02
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 94.01
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 93.98
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 93.94
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 93.94
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 93.89
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 93.86
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 93.83
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 93.8
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 93.8
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.8
PTZ00354334 alcohol dehydrogenase; Provisional 93.79
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 93.79
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 93.77
KOG1205|consensus282 93.7
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 93.69
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 93.68
PRK06719157 precorrin-2 dehydrogenase; Validated 93.65
cd01483143 E1_enzyme_family Superfamily of activating enzymes 93.65
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 93.62
PRK08328231 hypothetical protein; Provisional 93.59
PRK05442326 malate dehydrogenase; Provisional 93.54
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 93.53
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 93.53
COG0373414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 93.42
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 93.42
PRK08762376 molybdopterin biosynthesis protein MoeB; Validated 93.33
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 93.3
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 93.28
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 93.27
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 93.26
PRK04148134 hypothetical protein; Provisional 93.24
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 93.15
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 93.13
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 93.12
PTZ00117319 malate dehydrogenase; Provisional 93.02
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 92.96
COG0300265 DltE Short-chain dehydrogenases of various substra 92.92
TIGR01772312 MDH_euk_gproteo malate dehydrogenase, NAD-dependen 92.9
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 92.9
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 92.88
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 92.88
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 92.84
PLN02827378 Alcohol dehydrogenase-like 92.81
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 92.81
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 92.8
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 92.79
COG3165204 Uncharacterized protein conserved in bacteria [Fun 92.79
PRK09496453 trkA potassium transporter peripheral membrane com 92.73
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 92.72
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mito 92.71
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 92.68
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 92.67
PRK08223287 hypothetical protein; Validated 92.62
PLN02178375 cinnamyl-alcohol dehydrogenase 92.61
PLN00203519 glutamyl-tRNA reductase 92.61
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 92.6
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 92.54
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 92.52
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 92.51
PLN02586360 probable cinnamyl alcohol dehydrogenase 92.46
KOG1201|consensus300 92.4
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 92.38
PRK12480330 D-lactate dehydrogenase; Provisional 92.29
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 92.21
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1 92.19
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 92.18
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 92.17
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 92.15
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 92.14
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 92.11
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 92.1
cd01485198 E1-1_like Ubiquitin activating enzyme (E1), repeat 92.05
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 92.04
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 91.96
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 91.95
PLN028191042 lysine-ketoglutarate reductase/saccharopine dehydr 91.86
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 91.85
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 91.82
cd00650263 LDH_MDH_like NAD-dependent, lactate dehydrogenase- 91.79
cd01492197 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit 91.66
PRK06153393 hypothetical protein; Provisional 91.66
KOG0024|consensus354 91.58
PTZ00082321 L-lactate dehydrogenase; Provisional 91.48
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 91.44
KOG1196|consensus343 91.44
PRK05600370 thiamine biosynthesis protein ThiF; Validated 91.44
TIGR01759323 MalateDH-SF1 malate dehydrogenase. This model repr 91.41
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 91.35
KOG1208|consensus314 91.33
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 91.33
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 91.2
PRK05479330 ketol-acid reductoisomerase; Provisional 91.14
PLN03139386 formate dehydrogenase; Provisional 91.1
PTZ00075476 Adenosylhomocysteinase; Provisional 91.01
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.89
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 90.83
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 90.82
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.82
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 90.82
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 90.71
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 90.68
cd08252336 AL_MDR Arginate lyase and other MDR family members 90.65
>KOG1200|consensus Back     alignment and domain information
Probab=100.00  E-value=3e-47  Score=325.92  Aligned_cols=236  Identities=23%  Similarity=0.286  Sum_probs=207.8

Q ss_pred             cccCCcEEEEecCCchHHHHHHHHHHHcCCeEEEEecCCCCCCCCcccHHHHHHHHHHcCCeeeeeeecCCChHHHHHHH
Q psy6113           5 GKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAV   84 (406)
Q Consensus         5 ~~l~gk~alVTGas~GIG~aia~~La~~Ga~Vvl~~r~~~~~~~~~~~i~~~~~~~~~~g~~~~~~~~Dl~~~~~v~~~~   84 (406)
                      .++..|+++||||++|||+++++.|+++|++|++++++....       ++++..+..+ +....+.||+++.++++..+
T Consensus        10 ~r~~sk~~~vtGg~sGIGrAia~~la~~Garv~v~dl~~~~A-------~ata~~L~g~-~~h~aF~~DVS~a~~v~~~l   81 (256)
T KOG1200|consen   10 QRLMSKVAAVTGGSSGIGRAIAQLLAKKGARVAVADLDSAAA-------EATAGDLGGY-GDHSAFSCDVSKAHDVQNTL   81 (256)
T ss_pred             HHHhcceeEEecCCchHHHHHHHHHHhcCcEEEEeecchhhH-------HHHHhhcCCC-CccceeeeccCcHHHHHHHH
Confidence            367899999999999999999999999999999999987742       2344445444 35678899999999999999


Q ss_pred             HHHHHhcCCccEEEecccccccCCCCCCChhhhhhhhhhccccceEEeccchhhHHHHHHHHHhhcCCcceEeccccccc
Q psy6113          85 NAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAIS  164 (406)
Q Consensus        85 ~~i~~~~g~iD~linnAG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~id~li~~ag~~~  164 (406)
                      ++..+.+|++++|||||||..+....                                                      
T Consensus        82 ~e~~k~~g~psvlVncAGItrD~~Ll------------------------------------------------------  107 (256)
T KOG1200|consen   82 EEMEKSLGTPSVLVNCAGITRDGLLL------------------------------------------------------  107 (256)
T ss_pred             HHHHHhcCCCcEEEEcCcccccccee------------------------------------------------------
Confidence            99999999999999999998776554                                                      


Q ss_pred             cCCCCCCchhhHHHHHhhhhhHHHHHHHhhhHHh--HhcCCCeEEEeCCCCCCCCCccCCchhhhHhhHHHHHHHHHHHH
Q psy6113         165 LTDTANTPLKKYDLMNQINARGTYLVSQKCLPYL--KKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAE  242 (406)
Q Consensus       165 ~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~p~m--~~~~~g~Iv~vsS~~~~~~~~~~~~~~Y~asKaal~~l~~~la~  242 (406)
                           .+..++|+.++.+|+.|.|+++|++.+.|  .++++++|||+||+.+..++  .++..|++||+++.+|+|+.|+
T Consensus       108 -----rmkq~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGkiGN--~GQtnYAAsK~GvIgftktaAr  180 (256)
T KOG1200|consen  108 -----RMKQEQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGN--FGQTNYAASKGGVIGFTKTAAR  180 (256)
T ss_pred             -----eccHHHHHHHHHhhchhhHHHHHHHHHHHHHhcCCCceEEeehhhhccccc--ccchhhhhhcCceeeeeHHHHH
Confidence                 89999999999999999999999999984  44455699999999999985  6899999999999999999999


Q ss_pred             hhcCCCeEEEEecchhhhhHHHHHHhcCCC------cccccccCChhhHHHHHHHhhcCCCCCccceEE-EehhH
Q psy6113         243 EFKGDNIAVNALWPRTAIYTAAIEMLTGGS------ADAKATSRKPEIMADAAYYILSSNPPSLTGQFL-IDDEV  310 (406)
Q Consensus       243 e~~~~gI~vn~v~PG~~~~t~~~~~~~~~~------~~~~~~~~~pe~vA~~v~~L~s~~~~~~tG~~i-~d~g~  310 (406)
                      |++.+|||||+|+||+ +.|+|.+.+++..      .-|..|.++|||||+.++||+|+.++|+||+.+ ++||.
T Consensus       181 Ela~knIrvN~VlPGF-I~tpMT~~mp~~v~~ki~~~iPmgr~G~~EevA~~V~fLAS~~ssYiTG~t~evtGGl  254 (256)
T KOG1200|consen  181 ELARKNIRVNVVLPGF-IATPMTEAMPPKVLDKILGMIPMGRLGEAEEVANLVLFLASDASSYITGTTLEVTGGL  254 (256)
T ss_pred             HHhhcCceEeEecccc-ccChhhhhcCHHHHHHHHccCCccccCCHHHHHHHHHHHhccccccccceeEEEeccc
Confidence            9999999999999996 7888888776543      237788999999999999999999999999999 77664



>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>KOG1204|consensus Back     alignment and domain information
>KOG4170|consensus Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>KOG1478|consensus Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PF02036 SCP2: SCP-2 sterol transfer family; InterPro: IPR003033 This domain is involved in binding sterols, and is found in proteins such as SCP2 Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>COG3255 Putative sterol carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>KOG1371|consensus Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1430|consensus Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PF14864 Alkyl_sulf_C: Alkyl sulfatase C-terminal; PDB: 2CG2_A 2CG3_A 2CFU_A 2CFZ_A 2YHE_C Back     alignment and domain information
>KOG2865|consensus Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>KOG1429|consensus Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG3154 Putative lipid carrier protein [Lipid metabolism] Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG2733|consensus Back     alignment and domain information
>KOG0747|consensus Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1221|consensus Back     alignment and domain information
>KOG1431|consensus Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>KOG1372|consensus Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PF04127 DFP: DNA / pantothenate metabolism flavoprotein; InterPro: IPR007085 This entry represents the C-terminal domain found in DNA/pantothenate metabolism flavoproteins, which affects synthesis of DNA and pantothenate metabolism Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>KOG4039|consensus Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK13982 bifunctional SbtC-like/phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Provisional Back     alignment and domain information
>KOG2774|consensus Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd00704 MDH Malate dehydrogenase Back     alignment and domain information
>COG3007 Uncharacterized paraquat-inducible protein B [Function unknown] Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK05086 malate dehydrogenase; Provisional Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PF12242 Eno-Rase_NADH_b: NAD(P)H binding domain of trans-2-enoyl-CoA reductase; PDB: 3ZU5_A 3ZU3_A 3ZU4_A 3ZU2_A 3S8M_A Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05442 malate dehydrogenase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>COG3165 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK09496 trkA potassium transporter peripheral membrane component; Reviewed Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK08223 hypothetical protein; Validated Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd00757 ThiF_MoeB_HesA_family ThiF_MoeB_HesA Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>cd01485 E1-1_like Ubiquitin activating enzyme (E1), repeat 1-like Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family Back     alignment and domain information
>cd01492 Aos1_SUMO Ubiquitin activating enzyme (E1) subunit Aos1 Back     alignment and domain information
>PRK06153 hypothetical protein; Provisional Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>PRK05600 thiamine biosynthesis protein ThiF; Validated Back     alignment and domain information
>TIGR01759 MalateDH-SF1 malate dehydrogenase Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK05479 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
3kvo_A346 Crystal Structure Of The Catalytic Domain Of Human 2e-62
3e03_A274 Crystal Structure Of A Putative Dehydrogenase From 1e-50
3sc4_A285 Crystal Structure Of A Short Chain Dehydrogenase (A 8e-48
3oml_A 613 Structure Of Full-Length Peroxisomal Multifunctiona 5e-11
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 6e-11
3gvc_A277 Crystal Structure Of Probable Short-Chain Dehydroge 1e-10
3tfo_A264 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Car 8e-10
3tfo_A264 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Car 1e-05
1wmb_A260 Crystal Structure Of Nad Dependent D-3-Hydroxybutyl 2e-09
2ztm_A260 T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase L 4e-09
1qnd_A123 Sterol Carrier Protein-2, Nmr, 20 Structures Length 6e-09
2c0l_B122 Tpr Domain Of Human Pex5p In Complex With Human Msc 6e-09
2ztu_A260 T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase C 6e-09
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 2e-08
3v2h_A281 The Crystal Structure Of D-Beta-Hydroxybutyrate Deh 2e-08
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 3e-08
3ak4_A263 Crystal Structure Of Nadh-Dependent Quinuclidinone 3e-08
1c44_A123 Sterol Carrier Protein 2 (Scp2) From Rabbit Length 4e-08
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 5e-08
3u5t_A267 The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Pr 5e-06
4dqx_A277 Crystal Structure Of A Short Chain Dehydrogenase Fr 7e-08
2yz7_A260 X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase F 8e-08
3r1i_A276 Crystal Structure Of A Short-Chain Type Dehydrogena 2e-07
1zbq_A327 Crystal Structure Of Human 17-beta-hydroxysteroid D 2e-07
2et6_A604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 2e-07
3cxr_A291 Crystal Structure Of Gluconate 5-Dehydrogase From S 1e-06
1gz6_A319 (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat 1e-06
3v2g_A271 Crystal Structure Of A DehydrogenaseREDUCTASE FROM 1e-06
4fc6_A277 Studies On Dcr Shed New Light On Peroxisomal Beta-O 2e-06
4fc6_A277 Studies On Dcr Shed New Light On Peroxisomal Beta-O 7e-04
3vtz_A269 Structure Of Thermoplasma Volcanium Aldohexose Dehy 2e-06
2ehd_A234 Crystal Structure Analysis Of Oxidoreductase Length 2e-06
3un1_A260 Crystal Structure Of An Oxidoreductase From Sinorhi 2e-06
3nug_A247 Crystal Structure Of Wild Type Tetrameric Pyridoxal 3e-06
2ph3_A245 Crystal Structure Of 3-oxoacyl-[acyl Carrier Protei 3e-06
3oic_A258 Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl 4e-06
3qlj_A322 Crystal Structure Of A Short Chain Dehydrogenase Fr 4e-06
2q2q_A255 Structure Of D-3-Hydroxybutyrate Dehydrogenase From 5e-06
2pnf_A248 Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl- 5e-06
1ikt_A120 Liganded Sterol Carrier Protein Type 2 (Scp-2) Like 5e-06
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 6e-06
2qq5_A260 Crystal Structure Of Human Sdr Family Member 1 Leng 6e-06
2qq5_A260 Crystal Structure Of Human Sdr Family Member 1 Leng 2e-04
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 6e-06
1ipe_A259 Tropinone Reductase-Ii Complexed With Nadph Length 8e-06
1nff_A260 Crystal Structure Of Rv2002 Gene Product From Mycob 9e-06
2ae2_A260 Tropinone Reductase-Ii Complexed With Nadp+ And Pse 9e-06
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 1e-05
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 2e-05
1edo_A244 The X-Ray Structure Of Beta-Keto Acyl Carrier Prote 2e-05
3aus_A269 Crystal Structure Of Bacillus Megaterium Glucose De 2e-05
3rkr_A262 Crystal Structure Of A Metagenomic Short-Chain Oxid 2e-05
3ay7_A269 Crystal Structure Of Bacillus Megaterium Glucose De 2e-05
1iy8_A267 Crystal Structure Of Levodione Reductase Length = 2 2e-05
3ay6_A269 Crystal Structure Of Bacillus Megaterium Glucose De 2e-05
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 2e-05
2hq1_A247 Crystal Structure Of Orf 1438 A Putative GlucoseRIB 3e-05
1ybv_A283 Structure Of Trihydroxynaphthalene Reductase In Com 2e-05
1nfr_A260 Rv2002 Gene Product From Mycobacterium Tuberculosis 2e-05
3ndr_A247 Crystal Structure Of Tetrameric Pyridoxal 4-Dehydro 2e-05
1doh_A283 Structure Of Trihydroxynaphthalene Reductase In Com 2e-05
2bd0_A244 Chlorobium Tepidum Sepiapterin Reductase Complexed 3e-05
3uf0_A273 Crystal Structure Of A Putative Nad(P) Dependent Gl 3e-05
2a4k_A263 3-Oxoacyl-[acyl Carrier Protein] Reductase From The 4e-05
3tzq_B271 Crystal Structure Of A Short-Chain Type Dehydrogena 4e-05
2ew8_A249 Crystal Structure Of The (s)-specific 1-phenylethan 4e-05
3uwr_A286 Crystal Structure Of Carveol Dehydrogenase From Myc 6e-05
3sx2_A278 Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Ca 6e-05
3n74_A261 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 6e-05
4da9_A280 Crystal Structure Of Putative Short-Chain Dehydroge 6e-05
3gaf_A256 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid De 7e-05
3icc_A255 Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Car 7e-05
3pk0_A262 Crystal Structure Of Short-Chain DehydrogenaseREDUC 7e-05
4dml_A269 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Syn 7e-05
3tox_A280 Crystal Structure Of A Short Chain Dehydrogenase In 8e-05
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 8e-05
3tsc_A277 Crystal Structure Of Short Chain Dehydrogenase Map_ 1e-04
1g6k_A261 Crystal Structure Of Glucose Dehydrogenase Mutant E 1e-04
4hp8_A247 Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 1e-04
2d1y_A256 Crystal Structure Of Tt0321 From Thermus Thermophil 1e-04
1k2w_A256 Crystal Structure Of Sorbitol Dehydrogenase From R. 1e-04
2b4q_A276 Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex 1e-04
2jap_A247 Clavulanic Acid Dehydrogenase: Structural And Bioch 1e-04
1gee_A261 Crystal Structure Of Glucose Dehydrogenase Mutant Q 1e-04
1rwb_A261 Cooperative Effect Of Two Surface Amino Acid Mutati 1e-04
1gco_A261 Crystal Structure Of Glucose Dehydrogenase Complexe 1e-04
1yde_A270 Crystal Structure Of Human Retinal Short-Chain Dehy 2e-04
1ja9_A274 Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalen 2e-04
1yxm_A303 Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa 2e-04
3s55_A281 Crystal Structure Of A Putative Short-Chain Dehydro 3e-04
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 3e-04
3asu_A248 Crystal Structure Of Serine Dehydrogenase From Esch 4e-04
1cyd_A244 Carbonyl Reductase Complexed With Nadph And 2-Propa 4e-04
3tzk_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 4e-04
3rih_A293 Crystal Structure Of A Putative Short Chain Dehydro 4e-04
1geg_A256 Cryatal Structure Analysis Of Meso-2,3-Butanediol D 4e-04
1spx_A278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 5e-04
1xhl_A297 Crystal Structure Of Putative Tropinone Reductase-I 5e-04
3rsh_A251 Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reduc 5e-04
3tzh_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 5e-04
3u09_A251 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 5e-04
1ae1_A273 Tropinone Reductase-I Complex With Nadp Length = 27 6e-04
3t7c_A299 Crystal Structure Of Carveol Dehydrogenase From Myc 7e-04
2zk7_A257 Structure Of A C-Terminal Deletion Mutant Of Thermo 7e-04
2dtd_A264 Structure Of Thermoplasma Acidophilum Aldohexose De 7e-04
4e3z_A272 Crystal Structure Of A Oxidoreductase From Rhizobiu 9e-04
>pdb|3KVO|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Hydroxysteroid Dehydrogenase Like 2 (Hsdl2) Length = 346 Back     alignment and structure

Iteration: 1

Score = 236 bits (601), Expect = 2e-62, Method: Compositional matrix adjust. Identities = 119/200 (59%), Positives = 149/200 (74%), Gaps = 5/200 (2%) Query: 138 EIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPY 197 +I +AV A+ KFGGIDILVNNASAISLT+T +TP K+ DLM +N RGTYL S+ C+PY Sbjct: 115 QISAAVEKAIKKFGGIDILVNNASAISLTNTLDTPTKRLDLMMNVNTRGTYLASKACIPY 174 Query: 198 LKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFKGDNIAVNALWPR 257 LKKS AHILNISPPLNLNP WFK H AYTI+KYGMSM LGMAEEFKG+ IAVNALWP+ Sbjct: 175 LKKSKVAHILNISPPLNLNPVWFKQHCAYTIAKYGMSMYVLGMAEEFKGE-IAVNALWPK 233 Query: 258 TAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQFLIDDEVLKAQHID 317 TAI+TAA++ML G +++ RK +I+ADAAY I P S TG F+ID+ +LK + I+ Sbjct: 234 TAIHTAAMDMLGGPGIESQC--RKVDIIADAAYSIF-QKPKSFTGNFVIDENILKEEGIE 290 Query: 318 -LEQYSYVPNGAAEGSWHID 336 + Y+ P + + +D Sbjct: 291 NFDVYAIKPGHPLQPDFFLD 310
>pdb|3E03|A Chain A, Crystal Structure Of A Putative Dehydrogenase From Xanthomonas Campestris Length = 274 Back     alignment and structure
>pdb|3SC4|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase (A0qtm2 Homolog) Mycobacterium Thermoresistibile Length = 285 Back     alignment and structure
>pdb|3OML|A Chain A, Structure Of Full-Length Peroxisomal Multifunctional Enzyme Type 2 From Drosophila Melanogaster Length = 613 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|3GVC|A Chain A, Crystal Structure Of Probable Short-Chain Dehydrogenase- Reductase From Mycobacterium Tuberculosis Length = 277 Back     alignment and structure
>pdb|3TFO|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Carrier-Protein) Reductase From Sinorhizobium Meliloti Length = 264 Back     alignment and structure
>pdb|3TFO|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl-Carrier-Protein) Reductase From Sinorhizobium Meliloti Length = 264 Back     alignment and structure
>pdb|1WMB|A Chain A, Crystal Structure Of Nad Dependent D-3-Hydroxybutylate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|2ZTM|A Chain A, T190s Mutant Of D-3-Hydroxybutyrate Dehydrogenase Length = 260 Back     alignment and structure
>pdb|1QND|A Chain A, Sterol Carrier Protein-2, Nmr, 20 Structures Length = 123 Back     alignment and structure
>pdb|2C0L|B Chain B, Tpr Domain Of Human Pex5p In Complex With Human Mscp2 Length = 122 Back     alignment and structure
>pdb|2ZTU|A Chain A, T190a Mutant Of D-3-Hydroxybutyrate Dehydrogenase Complexed With Nad+ Length = 260 Back     alignment and structure
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|3V2H|A Chain A, The Crystal Structure Of D-Beta-Hydroxybutyrate Dehydrogenase From Sinorhizobium Meliloti Length = 281 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|3AK4|A Chain A, Crystal Structure Of Nadh-Dependent Quinuclidinone Reductase From Agrobacterium Tumefaciens Length = 263 Back     alignment and structure
>pdb|1C44|A Chain A, Sterol Carrier Protein 2 (Scp2) From Rabbit Length = 123 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|3U5T|A Chain A, The Crystal Structure Of 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Sinorhizobium Meliloti Length = 267 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|2YZ7|A Chain A, X-Ray Analyses Of 3-Hydroxybutyrate Dehydrogenase From Alcaligenes Faecalis Length = 260 Back     alignment and structure
>pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 Back     alignment and structure
>pdb|1ZBQ|A Chain A, Crystal Structure Of Human 17-beta-hydroxysteroid Dehydrogenase Type 4 In Complex With Nad Length = 327 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|3CXR|A Chain A, Crystal Structure Of Gluconate 5-Dehydrogase From Streptococcus Suis Type 2 Length = 291 Back     alignment and structure
>pdb|1GZ6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Fragment Of Rat Peroxisomal Multifunctional Enzyme Type 2 Length = 319 Back     alignment and structure
>pdb|3V2G|A Chain A, Crystal Structure Of A DehydrogenaseREDUCTASE FROM SINORHIZOBIUM Meliloti 1021 Length = 271 Back     alignment and structure
>pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 Back     alignment and structure
>pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 Back     alignment and structure
>pdb|3VTZ|A Chain A, Structure Of Thermoplasma Volcanium Aldohexose Dehydrogenase Length = 269 Back     alignment and structure
>pdb|2EHD|A Chain A, Crystal Structure Analysis Of Oxidoreductase Length = 234 Back     alignment and structure
>pdb|3UN1|A Chain A, Crystal Structure Of An Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 260 Back     alignment and structure
>pdb|3NUG|A Chain A, Crystal Structure Of Wild Type Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|2PH3|A Chain A, Crystal Structure Of 3-oxoacyl-[acyl Carrier Protein] Reductase Ttha0415 From Thermus Thermophilus Length = 245 Back     alignment and structure
>pdb|3OIC|A Chain A, Crystal Structure Of Enoyl-Acp Reductases Iii (Fabl) From B. Subtilis (Apo Form) Length = 258 Back     alignment and structure
>pdb|3QLJ|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Mycobacterium Avium Length = 322 Back     alignment and structure
>pdb|2Q2Q|A Chain A, Structure Of D-3-Hydroxybutyrate Dehydrogenase From Pseudomonas Putida Length = 255 Back     alignment and structure
>pdb|2PNF|A Chain A, Structure Of Aquifex Aeolicus Fabg 3-oxoacyl-(acyl-carrier Protein) Reductase Length = 248 Back     alignment and structure
>pdb|1IKT|A Chain A, Liganded Sterol Carrier Protein Type 2 (Scp-2) Like Domain Of Human Multifunctional Enzyme Type 2 (Mfe-2) Length = 120 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure
>pdb|2QQ5|A Chain A, Crystal Structure Of Human Sdr Family Member 1 Length = 260 Back     alignment and structure
>pdb|2QQ5|A Chain A, Crystal Structure Of Human Sdr Family Member 1 Length = 260 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|1IPE|A Chain A, Tropinone Reductase-Ii Complexed With Nadph Length = 259 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|2AE2|A Chain A, Tropinone Reductase-Ii Complexed With Nadp+ And Pseudotropine Length = 260 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|1EDO|A Chain A, The X-Ray Structure Of Beta-Keto Acyl Carrier Protein Reductase From Brassica Napus Complexed With Nadp+ Length = 244 Back     alignment and structure
>pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 Back     alignment and structure
>pdb|3RKR|A Chain A, Crystal Structure Of A Metagenomic Short-Chain Oxidoreductase (Sdr) In Complex With Nadp Length = 262 Back     alignment and structure
>pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|2HQ1|A Chain A, Crystal Structure Of Orf 1438 A Putative GlucoseRIBITOL Dehydrogenase From Clostridium Thermocellum Length = 247 Back     alignment and structure
>pdb|1YBV|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And An Active Site Inhibitor Length = 283 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|3NDR|A Chain A, Crystal Structure Of Tetrameric Pyridoxal 4-Dehydrogenase From Mesorhizobium Loti Length = 247 Back     alignment and structure
>pdb|1DOH|A Chain A, Structure Of Trihydroxynaphthalene Reductase In Complex With Nadph And 4-nitro-inden-1-one Length = 283 Back     alignment and structure
>pdb|2BD0|A Chain A, Chlorobium Tepidum Sepiapterin Reductase Complexed With Nadp And Sepiapterin Length = 244 Back     alignment and structure
>pdb|3UF0|A Chain A, Crystal Structure Of A Putative Nad(P) Dependent Gluconate 5- Dehydrogenase From Beutenbergia Cavernae(Efi Target Efi-502044) With Bound Nadp (Low Occupancy) Length = 273 Back     alignment and structure
>pdb|2A4K|A Chain A, 3-Oxoacyl-[acyl Carrier Protein] Reductase From Thermus Thermophilus Tt0137 Length = 263 Back     alignment and structure
>pdb|3TZQ|B Chain B, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 271 Back     alignment and structure
>pdb|2EW8|A Chain A, Crystal Structure Of The (s)-specific 1-phenylethanol Dehydrogenase Of The Denitrifying Bacterium Strain Ebn1 Length = 249 Back     alignment and structure
>pdb|3UWR|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Strain 104 Length = 286 Back     alignment and structure
>pdb|3SX2|A Chain A, Crystal Structure Of A Putative 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase From Mycobacterium Paratuberculosis In Complex With Nad Length = 278 Back     alignment and structure
>pdb|3N74|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reduc Brucella Melitensis Length = 261 Back     alignment and structure
>pdb|4DA9|A Chain A, Crystal Structure Of Putative Short-Chain DehydrogenaseREDUCTASE FROM Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid Dehydrogenase From Brucella Melitensis Length = 256 Back     alignment and structure
>pdb|3ICC|A Chain A, Crystal Structure Of A Putative 3-Oxoacyl-(Acyl Carrier Protein) Reductase From Bacillus Anthracis At 1.87 A Resolution Length = 255 Back     alignment and structure
>pdb|3PK0|A Chain A, Crystal Structure Of Short-Chain DehydrogenaseREDUCTASE SDR FROM Mycobacterium Smegmatis Length = 262 Back     alignment and structure
>pdb|4DML|A Chain A, 3-Oxoacyl-[acyl-Carrier-Protein] Reductase From Synechococcus Elongatus Pcc 7942 Length = 269 Back     alignment and structure
>pdb|3TOX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase In Complex With Nad(P) From Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 Back     alignment and structure
>pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|4HP8|A Chain A, Crystal Structure Of A Putative 2-Deoxy-D-Gluconate 3-Dehydrogenase From Agrobacterium Tumefaciens (Target Efi-506435) With Bound Nadp Length = 247 Back     alignment and structure
>pdb|2D1Y|A Chain A, Crystal Structure Of Tt0321 From Thermus Thermophilus Hb8 Length = 256 Back     alignment and structure
>pdb|1K2W|A Chain A, Crystal Structure Of Sorbitol Dehydrogenase From R. Sphaeroides Length = 256 Back     alignment and structure
>pdb|2B4Q|A Chain A, Pseudomonas Aeruginosa RhlgNADP ACTIVE-Site Complex Length = 276 Back     alignment and structure
>pdb|2JAP|A Chain A, Clavulanic Acid Dehydrogenase: Structural And Biochemical Analysis Of The Final Step In The Biosynthesis Of The Beta- Lactamase Inhibitor Clavulanic Acid Length = 247 Back     alignment and structure
>pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 Back     alignment and structure
>pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 Back     alignment and structure
>pdb|1JA9|A Chain A, Crystal Structure Of 1,3,6,8-Tetrahydroxynaphthalene Reductase In Complex With Nadph And Pyroquilon Length = 274 Back     alignment and structure
>pdb|1YXM|A Chain A, Crystal Structure Of Peroxisomal Trans 2-Enoyl Coa Reductase Length = 303 Back     alignment and structure
>pdb|3S55|A Chain A, Crystal Structure Of A Putative Short-Chain DehydrogenaseREDUCTASE From Mycobacterium Abscessus Bound To Nad Length = 281 Back     alignment and structure
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure
>pdb|3ASU|A Chain A, Crystal Structure Of Serine Dehydrogenase From Escherichia Coli Length = 248 Back     alignment and structure
>pdb|1CYD|A Chain A, Carbonyl Reductase Complexed With Nadph And 2-Propanol Length = 244 Back     alignment and structure
>pdb|3TZK|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3RIH|A Chain A, Crystal Structure Of A Putative Short Chain Dehydrogenase Or Reductase From Mycobacterium Abscessus Length = 293 Back     alignment and structure
>pdb|1GEG|A Chain A, Cryatal Structure Analysis Of Meso-2,3-Butanediol Dehydrogenase Length = 256 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|3RSH|A Chain A, Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein)reductase (Fabg) From Vibrio Cholerae O1 Complexed With Nadp+ (Space Group P62) Length = 251 Back     alignment and structure
>pdb|3TZH|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(F187a) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|3U09|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reductase (Fabg)(G92d) From Vibrio Cholerae Length = 251 Back     alignment and structure
>pdb|1AE1|A Chain A, Tropinone Reductase-I Complex With Nadp Length = 273 Back     alignment and structure
>pdb|3T7C|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nad Length = 299 Back     alignment and structure
>pdb|2ZK7|A Chain A, Structure Of A C-Terminal Deletion Mutant Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (Aldt) Length = 257 Back     alignment and structure
>pdb|2DTD|A Chain A, Structure Of Thermoplasma Acidophilum Aldohexose Dehydrogenase (aldt) In Ligand-free Form Length = 264 Back     alignment and structure
>pdb|4E3Z|A Chain A, Crystal Structure Of A Oxidoreductase From Rhizobium Etli Cfn 42 Length = 272 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
3e03_A274 Short chain dehydrogenase; structural genomics, PS 1e-87
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 3e-82
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 3e-79
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 8e-63
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 3e-38
3tsc_A277 Putative oxidoreductase; structural genomics, seat 2e-31
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 1e-30
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 2e-12
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 4e-30
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 1e-15
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 6e-30
3imf_A257 Short chain dehydrogenase; structural genomics, in 7e-30
3imf_A257 Short chain dehydrogenase; structural genomics, in 2e-14
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 2e-29
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 3e-29
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 4e-29
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 6e-29
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-28
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 1e-28
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 2e-28
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 3e-28
4dqx_A277 Probable oxidoreductase protein; structural genomi 4e-28
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 7e-28
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 2e-20
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 7e-28
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 7e-28
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 9e-28
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 1e-27
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 2e-13
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 1e-27
1xkq_A280 Short-chain reductase family member (5D234); parra 2e-27
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 2e-27
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 3e-27
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 1e-17
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 4e-27
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 5e-27
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 5e-27
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 6e-27
1xhl_A297 Short-chain dehydrogenase/reductase family member 6e-27
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 7e-27
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 7e-27
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 5e-15
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-26
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-13
3tox_A280 Short chain dehydrogenase; structural genomics, PS 2e-26
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 2e-26
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 2e-14
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 2e-26
3edm_A259 Short chain dehydrogenase; structural genomics, ox 3e-26
3edm_A259 Short chain dehydrogenase; structural genomics, ox 2e-12
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 3e-26
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 3e-13
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 3e-26
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 3e-26
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 3e-26
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 4e-26
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 4e-26
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 5e-17
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 5e-26
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 1e-07
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 6e-26
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 6e-26
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 4e-12
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 7e-26
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 8e-26
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 6e-16
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 8e-26
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 8e-26
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 6e-12
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 8e-26
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 2e-11
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 9e-26
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 9e-26
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 5e-17
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 9e-26
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 1e-25
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 1e-25
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 1e-15
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 1e-25
3gem_A260 Short chain dehydrogenase; structural genomics, AP 2e-25
3gem_A260 Short chain dehydrogenase; structural genomics, AP 2e-21
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 2e-25
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 2e-25
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 2e-25
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 3e-11
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 2e-25
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 2e-08
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 3e-25
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 3e-16
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 3e-25
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 7e-17
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 3e-25
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 3e-25
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 1e-14
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 3e-25
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 1e-16
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 3e-25
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 3e-25
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 3e-25
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 4e-13
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 4e-25
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 8e-14
1nff_A260 Putative oxidoreductase RV2002; directed evolution 4e-25
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 4e-25
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 6e-14
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 5e-25
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 6e-25
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 6e-25
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 6e-18
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 7e-25
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 4e-16
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 7e-25
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 2e-13
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 9e-25
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 6e-18
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 9e-25
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 9e-25
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 1e-24
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 1e-24
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 6e-21
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 2e-24
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 2e-24
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 3e-17
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 2e-24
1spx_A278 Short-chain reductase family member (5L265); paral 2e-24
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 2e-24
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 4e-11
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 2e-24
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 2e-17
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 2e-24
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 2e-14
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 3e-24
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 2e-15
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 3e-24
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 4e-17
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 4e-24
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 2e-17
3cxt_A291 Dehydrogenase with different specificities; rossma 4e-24
3cxt_A291 Dehydrogenase with different specificities; rossma 2e-13
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 4e-24
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 6e-24
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 8e-24
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 9e-24
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 8e-14
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 9e-24
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 1e-20
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 1e-23
1pz4_A116 Sterol carrier protein 2; alpha and beta, lipid bi 1e-23
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 1e-23
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 2e-09
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 1e-23
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 2e-04
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 1e-23
3tjr_A301 Short chain dehydrogenase; structural genomics, se 2e-23
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 2e-23
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 5e-15
2qzt_A111 Sterol carrier protein 2-like 2; mosquito, fatty a 2e-23
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 3e-23
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 5e-06
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 3e-23
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 8e-05
3rih_A293 Short chain dehydrogenase or reductase; structural 3e-23
3rih_A293 Short chain dehydrogenase or reductase; structural 7e-10
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 4e-23
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 8e-05
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 4e-23
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 5e-15
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 4e-23
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 1e-17
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 4e-23
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 3e-11
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 5e-23
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 1e-16
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 5e-23
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 4e-08
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 7e-23
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 2e-07
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 7e-23
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 2e-04
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 8e-23
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 1e-04
4eso_A255 Putative oxidoreductase; NADP, structural genomics 8e-23
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 8e-23
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 2e-04
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 9e-23
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 6e-13
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 1e-22
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 6e-16
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 1e-22
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 2e-04
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 1e-22
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 1e-04
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 1e-22
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 1e-05
1ikt_A120 Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, 1e-22
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 2e-22
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 2e-12
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 2e-22
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-04
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 2e-22
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 3e-22
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 7e-10
1xq1_A266 Putative tropinone reducatse; structural genomics, 3e-22
1xq1_A266 Putative tropinone reducatse; structural genomics, 2e-14
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 4e-22
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 5e-22
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 5e-22
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 6e-13
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 6e-22
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 9e-10
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 6e-22
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 7e-22
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 7e-07
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 7e-22
1c44_A123 Protein (sterol carrier protein 2); non specific l 7e-22
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 8e-22
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 3e-11
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 1e-21
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 8e-18
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 1e-21
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 2e-05
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 1e-21
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 1e-10
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 1e-21
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 2e-21
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 3e-21
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 3e-21
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 2e-11
4e4y_A244 Short chain dehydrogenase family protein; structur 4e-21
4e4y_A244 Short chain dehydrogenase family protein; structur 3e-15
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 6e-21
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 7e-21
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 4e-19
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 8e-21
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 5e-11
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 9e-21
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 9e-06
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 9e-21
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 9e-21
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 1e-20
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 7e-16
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 1e-20
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 1e-10
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 2e-20
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 3e-04
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 2e-20
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 2e-04
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 2e-20
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 6e-05
3cnu_A116 Predicted coding region AF_1534; structural GE MCS 2e-20
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 5e-20
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 4e-12
3qlj_A322 Short chain dehydrogenase; structural genomics, se 6e-20
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 7e-20
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 1e-14
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 9e-20
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 2e-19
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 2e-19
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 7e-14
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 2e-19
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 2e-14
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 2e-19
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 4e-16
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 3e-19
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 6e-19
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 8e-19
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 9e-19
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 1e-18
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 6e-15
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 1e-18
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 1e-13
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 2e-18
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 2e-04
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 2e-18
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 7e-04
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 4e-18
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 2e-04
1ooe_A236 Dihydropteridine reductase; structural genomics, P 1e-17
1ooe_A236 Dihydropteridine reductase; structural genomics, P 4e-15
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 3e-17
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 4e-15
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 4e-14
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-13
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 4e-17
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 8e-12
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 3e-16
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 4e-04
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 3e-16
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 5e-16
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 1e-15
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 2e-15
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 2e-08
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 3e-15
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 5e-15
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 3e-15
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 7e-06
3bkr_A126 Sterol carrier protein-2 like-3; mosquito, fatty a 7e-15
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 6e-11
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 3e-08
2cfu_A658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 5e-07
2yhe_A668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 1e-06
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 1e-04
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 5e-04
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
 Score =  266 bits (682), Expect = 1e-87
 Identities = 124/330 (37%), Positives = 168/330 (50%), Gaps = 77/330 (23%)

Query: 4   TGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDA 63
           +  LSG T+FITGASRGI           G  I + A                A++    
Sbjct: 1   SLTLSGKTLFITGASRGI-----------GLAIALRA----------------ARD---- 29

Query: 64  GGNCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQI 123
                                        G ++ +    A S       P   +     +
Sbjct: 30  -----------------------------GANVAIA---AKSAVANPKLPGTIHSAAAAV 57

Query: 124 NARGTYLVKA-------SQGLEIQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKY 176
           NA G    +         +  ++++AV A VD FGGIDILVNNASAI L  T +TP+K++
Sbjct: 58  NAAG---GQGLALKCDIREEDQVRAAVAATVDTFGGIDILVNNASAIWLRGTLDTPMKRF 114

Query: 177 DLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMC 236
           DLM Q+NARG+++ +Q CLP+L ++ + HIL ++PP +LNP W+  H  YT++K GMS+ 
Sbjct: 115 DLMQQVNARGSFVCAQACLPHLLQAPNPHILTLAPPPSLNPAWWGAHTGYTLAKMGMSLV 174

Query: 237 ALGMAEEFKGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSN 296
            LG+A EF    +A+NALWPRT I T AI ML G  A A    R+PEIMADAA+ +L+  
Sbjct: 175 TLGLAAEFGPQGVAINALWPRTVIATDAINMLPGVDAAA---CRRPEIMADAAHAVLTRE 231

Query: 297 PPSLTGQFLIDDEVLKAQHI-DLEQYSYVP 325
                GQFLIDDEVL    I DL  Y+  P
Sbjct: 232 AAGFHGQFLIDDEVLAQAGITDLSGYAVDP 261


>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>1pz4_A Sterol carrier protein 2; alpha and beta, lipid binding protein; HET: PLM; 1.35A {Aedes aegypti} SCOP: d.106.1.1 PDB: 2ksh_A 2ksi_A* Length = 116 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>2qzt_A Sterol carrier protein 2-like 2; mosquito, fatty acid, palmitic acid, cholesterol, lipid transport; HET: PLM; 1.70A {Aedes aegypti} PDB: 3bdq_A* Length = 111 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Length = 247 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Length = 248 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Length = 246 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Length = 269 Back     alignment and structure
>1ikt_A Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, protein-triton X-100 complex, hydrophobic tunnel; HET: OXN; 1.75A {Homo sapiens} SCOP: d.106.1.1 Length = 120 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} PDB: 3sj7_A* Length = 246 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Length = 324 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>1c44_A Protein (sterol carrier protein 2); non specific lipid transfer protein, fatty acid binding, fatty acyl COA binding, lipid binding protein; 1.80A {Oryctolagus cuniculus} SCOP: d.106.1.1 PDB: 1qnd_A 2c0l_B Length = 123 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Length = 244 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Length = 281 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Length = 269 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} Length = 256 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Length = 245 Back     alignment and structure
>3cnu_A Predicted coding region AF_1534; structural GE MCSG, PSI-2, protein structure initiative, midwest center F structural genomics; 1.90A {Archaeoglobus fulgidus dsm 4304} PDB: 3bn8_A* Length = 116 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3q6i_A* 3m1l_A Length = 454 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Length = 249 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>3bkr_A Sterol carrier protein-2 like-3; mosquito, fatty acid, palmitic acid, cholesterol, lipid binding protein; HET: PLM; 1.40A {Aedes aegypti} PDB: 3bks_A* Length = 126 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Length = 287 Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Length = 658 Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Length = 668 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Length = 422 Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Length = 405 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
4e4y_A244 Short chain dehydrogenase family protein; structur 100.0
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 100.0
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 100.0
1xq1_A266 Putative tropinone reducatse; structural genomics, 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 100.0
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 100.0
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 100.0
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 100.0
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 100.0
3tjr_A301 Short chain dehydrogenase; structural genomics, se 100.0
1ooe_A236 Dihydropteridine reductase; structural genomics, P 100.0
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 100.0
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 100.0
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 100.0
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 100.0
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 100.0
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 100.0
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 100.0
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 100.0
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 100.0
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 100.0
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 100.0
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 100.0
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 100.0
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 100.0
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 100.0
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 100.0
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 100.0
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 100.0
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 100.0
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 100.0
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 100.0
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 100.0
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 100.0
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 100.0
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 100.0
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 100.0
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 100.0
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 100.0
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 100.0
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 100.0
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 100.0
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 100.0
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 100.0
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 100.0
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 100.0
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 100.0
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 100.0
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 100.0
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 100.0
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 100.0
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.98
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.97
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.97
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.97
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.97
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.96
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.95
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.95
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.95
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.93
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.92
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.91
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.91
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.9
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.89
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.88
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.87
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.87
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.86
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.86
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.86
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.86
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.86
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.85
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.85
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.85
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.84
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.84
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.84
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.83
1xq6_A253 Unknown protein; structural genomics, protein stru 99.83
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.83
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.82
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.82
3nzo_A399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.81
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.81
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.81
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.8
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.8
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.8
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.8
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.79
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.79
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.79
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.79
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.79
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.79
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.79
1gy8_A397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.79
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.79
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.78
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.78
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.78
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.78
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.78
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.78
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.77
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.77
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.77
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.77
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.77
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.76
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.75
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.75
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.74
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.74
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.74
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.73
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.73
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.73
1ikt_A120 Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, 99.73
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.72
2cx7_A130 Sterol carrier protein 2; sterol transfer, SCP-2, 99.72
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.72
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.71
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.7
1c44_A123 Protein (sterol carrier protein 2); non specific l 99.7
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.69
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.69
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.69
3bkr_A126 Sterol carrier protein-2 like-3; mosquito, fatty a 99.68
1pz4_A116 Sterol carrier protein 2; alpha and beta, lipid bi 99.68
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.67
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.67
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.65
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.65
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.65
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.64
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.63
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.63
2qzt_A111 Sterol carrier protein 2-like 2; mosquito, fatty a 99.62
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.62
2wm3_A299 NMRA-like family domain containing protein 1; unkn 99.61
3cnu_A116 Predicted coding region AF_1534; structural GE MCS 99.61
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.61
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.6
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 99.56
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 99.52
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 99.45
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.44
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 99.43
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 99.42
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 99.41
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 99.4
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 99.38
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.38
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 99.35
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 99.29
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 99.18
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 99.09
2yhe_A668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 98.52
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 98.92
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 98.89
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.82
2cfu_A658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 98.74
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 98.72
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 98.51
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 98.47
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 98.42
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 98.39
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 98.34
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 98.32
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 98.32
1ff9_A450 Saccharopine reductase; lysine biosynthesis, alpha 98.23
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 98.23
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 98.19
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 98.06
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 98.06
2axq_A467 Saccharopine dehydrogenase; rossmann fold variant, 98.02
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 98.02
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 98.0
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 97.98
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 97.98
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 97.95
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 97.94
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 97.93
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 97.92
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 97.91
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 97.89
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 97.81
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 97.73
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 97.7
3gms_A340 Putative NADPH:quinone reductase; structural genom 97.69
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 97.63
4eye_A342 Probable oxidoreductase; structural genomics, niai 97.6
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 97.55
3krt_A456 Crotonyl COA reductase; structural genomics, prote 97.54
1p9o_A313 Phosphopantothenoylcysteine synthetase; ligase; 2. 97.51
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 97.5
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 97.5
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 97.49
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 97.4
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 97.4
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 97.38
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 97.37
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 97.36
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 97.32
3fbg_A346 Putative arginate lyase; structural genomics, unkn 97.25
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 97.2
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 97.15
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 97.13
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 97.12
1smk_A326 Malate dehydrogenase, glyoxysomal; tricarboxylic c 97.11
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 97.11
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 97.03
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.01
1id1_A153 Putative potassium channel protein; RCK domain, E. 97.0
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 96.98
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 96.93
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 96.91
1lss_A140 TRK system potassium uptake protein TRKA homolog; 96.91
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 96.87
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 96.81
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 96.76
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 96.7
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 96.69
1hye_A313 L-lactate/malate dehydrogenase; nucleotide binding 96.68
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 96.67
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.66
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 96.62
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 96.61
1o6z_A303 MDH, malate dehydrogenase; halophilic, ION-binding 96.61
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 96.6
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 96.6
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 96.57
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 96.55
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 96.54
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 96.53
3c85_A183 Putative glutathione-regulated potassium-efflux S 96.52
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 96.51
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 96.47
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 96.43
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 96.43
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 96.42
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 96.38
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 96.37
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 96.37
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 96.35
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 96.33
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 96.29
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 96.24
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 96.24
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 96.18
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 96.14
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 96.13
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 96.11
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 96.09
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 96.09
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 96.02
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 96.02
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 96.02
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 95.92
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 95.91
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 95.9
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 95.86
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 95.83
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 95.75
1gpj_A404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 95.74
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 95.72
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 95.64
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 95.61
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 95.57
3tl2_A315 Malate dehydrogenase; center for structural genomi 95.56
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 95.52
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 95.51
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 95.51
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 95.45
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 95.41
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 95.39
3vku_A326 L-LDH, L-lactate dehydrogenase; rossmann fold, NAD 95.38
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 95.38
3p2o_A285 Bifunctional protein fold; structural genomics, ce 95.29
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 95.25
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 95.24
4gsl_A615 Ubiquitin-like modifier-activating enzyme ATG7; ub 95.19
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 95.17
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 95.12
1mld_A314 Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D 95.07
5mdh_A333 Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH 94.64
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 94.61
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 94.56
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 94.56
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 94.49
3vh1_A598 Ubiquitin-like modifier-activating enzyme ATG7; au 94.41
3orq_A377 N5-carboxyaminoimidazole ribonucleotide synthetas; 94.4
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 94.4
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 94.39
3l07_A285 Bifunctional protein fold; structural genomics, ID 94.31
3qha_A296 Putative oxidoreductase; seattle structural genomi 94.23
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 94.07
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 94.05
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 94.0
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 93.93
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 93.85
4aj2_A331 L-lactate dehydrogenase A chain; oxidoreductase-in 93.79
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 93.62
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 93.58
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 93.55
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 93.49
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 93.49
3h5n_A353 MCCB protein; ubiquitin-activating enzyme, microci 93.39
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 93.37
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 93.21
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 93.16
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 93.12
3q2o_A389 Phosphoribosylaminoimidazole carboxylase, ATPase; 93.11
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 93.06
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 93.04
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 93.02
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 92.88
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 92.78
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 92.76
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 92.74
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 92.73
4h7p_A345 Malate dehydrogenase; ssgcid, structural G seattle 92.68
2rir_A300 Dipicolinate synthase, A chain; structural genomic 92.52
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 92.5
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 92.49
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 92.48
3tsc_A277 Putative oxidoreductase; structural genomics, seat 92.47
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 92.4
1y8q_A346 Ubiquitin-like 1 activating enzyme E1A; SUMO, hete 92.37
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 92.35
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 92.34
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 92.31
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 92.18
2hk9_A275 Shikimate dehydrogenase; shikimate pathway, drug d 92.17
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
Probab=100.00  E-value=4.5e-56  Score=414.05  Aligned_cols=243  Identities=24%  Similarity=0.304  Sum_probs=216.5

Q ss_pred             CCCCcccCCcEEEEecCCchHHHHHHHHHHHcCCeEEEEecCCCCCCCCcccHHHHHHHHHHcCCeeeeeeecCCChHHH
Q psy6113           1 MINTGKLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAV   80 (406)
Q Consensus         1 ~~~~~~l~gk~alVTGas~GIG~aia~~La~~Ga~Vvl~~r~~~~~~~~~~~i~~~~~~~~~~g~~~~~~~~Dl~~~~~v   80 (406)
                      |+++.+|+||++|||||++|||+++|++|+++|++|++++|+.++       ++++.+++.+.+.++.++.+|++|++++
T Consensus         1 Ms~~f~L~gKvalVTGas~GIG~aia~~la~~Ga~Vvi~~~~~~~-------~~~~~~~l~~~g~~~~~~~~Dv~~~~~v   73 (255)
T 4g81_D            1 MTALFDLTGKTALVTGSARGLGFAYAEGLAAAGARVILNDIRATL-------LAESVDTLTRKGYDAHGVAFDVTDELAI   73 (255)
T ss_dssp             --CTTCCTTCEEEETTCSSHHHHHHHHHHHHTTCEEEECCSCHHH-------HHHHHHHHHHTTCCEEECCCCTTCHHHH
T ss_pred             CCCCcCCCCCEEEEeCCCcHHHHHHHHHHHHCCCEEEEEECCHHH-------HHHHHHHHHhcCCcEEEEEeeCCCHHHH
Confidence            788889999999999999999999999999999999999998764       4567888888899999999999999999


Q ss_pred             HHHHHHHHHhcCCccEEEecccccccCCCCCCChhhhhhhhhhccccceEEeccchhhHHHHHHHHHhhcCCcceEeccc
Q psy6113          81 QSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNA  160 (406)
Q Consensus        81 ~~~~~~i~~~~g~iD~linnAG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~id~li~~a  160 (406)
                      +++++++.++||+||+||||||+....++.                                                  
T Consensus        74 ~~~~~~~~~~~G~iDiLVNNAG~~~~~~~~--------------------------------------------------  103 (255)
T 4g81_D           74 EAAFSKLDAEGIHVDILINNAGIQYRKPMV--------------------------------------------------  103 (255)
T ss_dssp             HHHHHHHHHTTCCCCEEEECCCCCCCCCGG--------------------------------------------------
T ss_pred             HHHHHHHHHHCCCCcEEEECCCCCCCCChh--------------------------------------------------
Confidence            999999999999999999999987654433                                                  


Q ss_pred             cccccCCCCCCchhhHHHHHhhhhhHHHHHHHhhhHHhHhc-CCCeEEEeCCCCCCCCCccCCchhhhHhhHHHHHHHHH
Q psy6113         161 SAISLTDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKS-NHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALG  239 (406)
Q Consensus       161 g~~~~~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~p~m~~~-~~g~Iv~vsS~~~~~~~~~~~~~~Y~asKaal~~l~~~  239 (406)
                               +++.++|++++++|+.|+|+++|+++|+|.++ ++|+|||+||..+..+  .++..+|++||+|+.+|||+
T Consensus       104 ---------~~~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~~G~IVnisS~~~~~~--~~~~~~Y~asKaal~~ltr~  172 (255)
T 4g81_D          104 ---------ELELENWQKVIDTNLTSAFLVSRSAAKRMIARNSGGKIINIGSLTSQAA--RPTVAPYTAAKGGIKMLTCS  172 (255)
T ss_dssp             ---------GCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCCEEEEEECCGGGTSB--CTTCHHHHHHHHHHHHHHHH
T ss_pred             ---------hCCHHHHHHHHHHHhHHHHHHHHHHHHHHHHccCCCEEEEEeehhhcCC--CCCchhHHHHHHHHHHHHHH
Confidence                     89999999999999999999999999999765 6799999999999987  58899999999999999999


Q ss_pred             HHHhhcCCCeEEEEecchhhhhHHHHHHhcCCC--------cccccccCChhhHHHHHHHhhcCCCCCccceEE-EehhH
Q psy6113         240 MAEEFKGDNIAVNALWPRTAIYTAAIEMLTGGS--------ADAKATSRKPEIMADAAYYILSSNPPSLTGQFL-IDDEV  310 (406)
Q Consensus       240 la~e~~~~gI~vn~v~PG~~~~t~~~~~~~~~~--------~~~~~~~~~pe~vA~~v~~L~s~~~~~~tG~~i-~d~g~  310 (406)
                      ||.||+++|||||+|+||+ +.|++.+.....+        ..|..|+.+|||||++++||+|+.++|+||+.+ +|||+
T Consensus       173 lA~ela~~gIrVN~V~PG~-i~T~~~~~~~~~~~~~~~~~~~~Pl~R~g~pediA~~v~fL~S~~a~~iTG~~i~VDGG~  251 (255)
T 4g81_D          173 MAAEWAQFNIQTNAIGPGY-ILTDMNTALIEDKQFDSWVKSSTPSQRWGRPEELIGTAIFLSSKASDYINGQIIYVDGGW  251 (255)
T ss_dssp             HHHHHGGGTEEEEEEEECS-BCCGGGHHHHTCHHHHHHHHHHSTTCSCBCGGGGHHHHHHHHSGGGTTCCSCEEEESTTG
T ss_pred             HHHHhcccCeEEEEEeeCC-CCCchhhcccCCHHHHHHHHhCCCCCCCcCHHHHHHHHHHHhCchhCCCcCCEEEECCCe
Confidence            9999999999999999996 6666555443321        236678899999999999999999999999999 88887


Q ss_pred             HH
Q psy6113         311 LK  312 (406)
Q Consensus       311 ~~  312 (406)
                      +.
T Consensus       252 ~A  253 (255)
T 4g81_D          252 LA  253 (255)
T ss_dssp             GG
T ss_pred             Ee
Confidence            63



>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1ikt_A Estradiol 17 beta-dehydrogenase 4; ALFA-beta fold, protein-triton X-100 complex, hydrophobic tunnel; HET: OXN; 1.75A {Homo sapiens} SCOP: d.106.1.1 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2cx7_A Sterol carrier protein 2; sterol transfer, SCP-2, RSGI, structural genomics, NPPSFA; 1.75A {Thermus thermophilus} PDB: 1wfr_A Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>1c44_A Protein (sterol carrier protein 2); non specific lipid transfer protein, fatty acid binding, fatty acyl COA binding, lipid binding protein; 1.80A {Oryctolagus cuniculus} SCOP: d.106.1.1 PDB: 1qnd_A 2c0l_B Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>3bkr_A Sterol carrier protein-2 like-3; mosquito, fatty acid, palmitic acid, cholesterol, lipid binding protein; HET: PLM; 1.40A {Aedes aegypti} PDB: 3bks_A* Back     alignment and structure
>1pz4_A Sterol carrier protein 2; alpha and beta, lipid binding protein; HET: PLM; 1.35A {Aedes aegypti} SCOP: d.106.1.1 PDB: 2ksh_A 2ksi_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>2qzt_A Sterol carrier protein 2-like 2; mosquito, fatty acid, palmitic acid, cholesterol, lipid transport; HET: PLM; 1.70A {Aedes aegypti} PDB: 3bdq_A* Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3cnu_A Predicted coding region AF_1534; structural GE MCSG, PSI-2, protein structure initiative, midwest center F structural genomics; 1.90A {Archaeoglobus fulgidus dsm 4304} PDB: 3bn8_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1p9o_A Phosphopantothenoylcysteine synthetase; ligase; 2.30A {Homo sapiens} SCOP: c.72.3.1 Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4gsl_A Ubiquitin-like modifier-activating enzyme ATG7; ubiquitin-like protein activation enzyme, ubiquitin-like Pro transfer enzyme, protein transport; 2.70A {Saccharomyces cerevisiae} PDB: 3vh2_A 4gsk_A 3vh1_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Back     alignment and structure
>5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3vh1_A Ubiquitin-like modifier-activating enzyme ATG7; autophagy, zinc binding, metal binding protein; 3.00A {Saccharomyces cerevisiae} PDB: 3vh2_A Back     alignment and structure
>3orq_A N5-carboxyaminoimidazole ribonucleotide synthetas; ATP-grAsp superfamily, ligase,biosynthetic protein; HET: MSE ADP; 2.23A {Staphylococcus aureus subsp} PDB: 3orr_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>3h5n_A MCCB protein; ubiquitin-activating enzyme, microcin, protein structure, MCCC7, peptide antibiotics, N-P bond formation, transferase; HET: ATP; 1.90A {Escherichia coli} PDB: 3h5r_A 3h9g_A 3h9j_A* 3h9q_A 3h5a_A Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3q2o_A Phosphoribosylaminoimidazole carboxylase, ATPase; carboxylates, ATP binding, lyase; 1.96A {Bacillus anthracis} PDB: 3qff_A* 3r5h_A* Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1y8q_A Ubiquitin-like 1 activating enzyme E1A; SUMO, heterodimer, UBL, ligase; HET: ATP; 2.25A {Homo sapiens} PDB: 1y8r_A* 3kyc_A* 3kyd_A* Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 406
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 8e-34
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 4e-31
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 2e-30
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 2e-29
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 3e-27
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 4e-24
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 1e-26
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 3e-26
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-25
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 2e-25
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 3e-25
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 3e-25
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 1e-24
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 2e-24
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 2e-24
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 1e-23
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 4e-23
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-16
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 5e-23
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 1e-11
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 6e-23
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 6e-14
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 7e-23
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 7e-23
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 8e-23
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 9e-23
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 1e-22
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 1e-22
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 2e-17
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 1e-22
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 3e-22
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 5e-12
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 4e-22
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 4e-22
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 5e-16
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 7e-22
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-12
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 7e-22
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 9e-22
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 9e-22
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 1e-21
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 1e-21
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 2e-21
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-21
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 7e-21
d1c44a_123 d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Ra 8e-21
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 2e-20
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 2e-20
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 2e-16
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-20
d1ikta_115 d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (H 1e-19
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 2e-19
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 4e-19
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 5e-19
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 7e-18
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 4e-17
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 2e-11
d1e7wa_284 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 5e-17
d1pz4a_113 d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Ye 5e-17
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 8e-17
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 9e-14
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 2e-16
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 4e-13
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 4e-16
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 2e-13
d2cfua1126 d.106.1.3 (A:530-655) Alkylsulfatase SdsA1 {Pseudo 1e-15
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 9e-15
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 2e-11
d1wfra_143 d.106.1.1 (A:) Hypothetical protein TT1886 (TTHA04 2e-14
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 7e-14
d1ulua_256 c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermoph 3e-10
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 8e-14
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-07
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-13
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-11
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 3e-13
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 9e-12
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-13
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 4e-13
d2pd4a1274 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacte 3e-12
d1d7oa_297 c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (B 3e-12
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-11
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 5e-11
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 7e-06
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 7e-11
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 4e-09
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 1e-10
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 6e-10
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 4e-07
d2h7ma1268 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacteri 2e-09
d1uh5a_329 c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite 1e-08
d2fr1a1259 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI 7e-08
d1jaya_212 c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase 2e-07
d1luaa1191 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopter 0.001
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  125 bits (316), Expect = 8e-34
 Identities = 58/304 (19%), Positives = 109/304 (35%), Gaps = 70/304 (23%)

Query: 6   KLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGG 65
           +  G  + +TGA  G+G+A AL  A+ GA +V                            
Sbjct: 4   RFDGRVVLVTGAGGGLGRAYALAFAERGALVV---------------------------- 35

Query: 66  NCLPCIVDIRDEHAVQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINA 125
                + D+  +       ++A DK                            ++ +I  
Sbjct: 36  -----VNDLGGDFKGVGKGSSAADK----------------------------VVEEIRR 62

Query: 126 RGTYLVKASQGLE-IQSAVNAAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINA 184
           RG   V     +E  +  V  A+D FG ID++VNNA  +     +    + +D++ +++ 
Sbjct: 63  RGGKAVANYDSVEAGEKLVKTALDTFGRIDVVVNNAGILRDRSFSRISDEDWDIIQRVHL 122

Query: 185 RGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEF 244
           RG++ V++    ++KK N+  I+  +    +   +      Y+ +K G+   A  +  E 
Sbjct: 123 RGSFQVTRAAWDHMKKQNYGRIIMTASASGIYGNF--GQANYSAAKLGLLGLANTLVIEG 180

Query: 245 KGDNIAVNALWPRTAIYTAAIEMLTGGSADAKATSRKPEIMADAAYYILSSNPPSLTGQF 304
           + +NI  N + P      A   M      +    + KPE +A    + L        G  
Sbjct: 181 RKNNIHCNTIAP-----NAGSRMTETVMPEDLVEALKPEYVAPLVLW-LCHESCEENGGL 234

Query: 305 LIDD 308
               
Sbjct: 235 FEVG 238


>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1c44a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 123 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1ikta_ d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 115 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Length = 284 Back     information, alignment and structure
>d1pz4a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} Length = 113 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d2cfua1 d.106.1.3 (A:530-655) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Length = 126 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1wfra_ d.106.1.1 (A:) Hypothetical protein TT1886 (TTHA0401) {Thermus thermophilus [TaxId: 274]} Length = 143 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Length = 256 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Length = 274 Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 297 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Length = 268 Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 329 Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Length = 259 Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 212 Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Length = 191 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 100.0
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 100.0
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 100.0
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 100.0
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 100.0
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 100.0
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 100.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 100.0
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 100.0
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 100.0
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 100.0
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.97
d1c44a_123 Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolag 99.82
d1ikta_115 SCP2-like domain of MFE-2 {Human (Homo sapiens) [T 99.82
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.75
d1pz4a_113 Sterol carrier protein 2 (SCP2) {Yellow fever mosq 99.62
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.6
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 99.55
d1wfra_143 Hypothetical protein TT1886 (TTHA0401) {Thermus th 99.54
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.51
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.5
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.48
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.43
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 99.39
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.39
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 99.39
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.38
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 99.38
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.37
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 99.37
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 99.36
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 99.34
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 99.31
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 99.3
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 99.28
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 99.28
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 99.26
d2cfua1126 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 99.23
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.21
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.19
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.12
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 99.05
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 98.95
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 98.84
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 98.83
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 98.8
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 98.79
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 98.65
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 98.4
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 97.65
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 97.64
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 97.55
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 97.5
d1u7za_223 Coenzyme A biosynthesis bifunctional protein CoaBC 97.49
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 97.42
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 97.41
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 97.37
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 97.33
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 97.27
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 97.26
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 97.22
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.12
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 97.05
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 96.88
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 96.88
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 96.85
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.83
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.75
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 96.7
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 96.57
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 96.55
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 96.41
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 96.36
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 96.33
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 96.3
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.28
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.26
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 96.25
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.24
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 96.15
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 96.14
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 96.02
d1p9oa_290 Phosphopantothenoylcysteine synthetase {Human (Hom 96.0
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 95.97
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.96
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.94
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 95.89
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 95.86
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 95.84
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 95.83
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 95.79
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 95.7
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 95.56
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 95.55
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 95.52
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 95.38
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 95.38
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 95.36
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 95.35
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 95.34
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 95.27
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 95.26
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 95.16
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 95.12
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 95.07
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 95.05
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 95.01
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 94.99
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.95
d2hv2a1111 Hypothetical protein EF1021 {Enterococcus faecalis 94.92
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 94.91
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 94.9
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 94.89
d7mdha1175 Malate dehydrogenase {Sorghum (Sorghum vulgare), c 94.87
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 94.84
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 94.71
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 94.67
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 94.48
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 94.45
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 94.28
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 94.24
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 94.15
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 94.03
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 94.01
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 93.9
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 93.78
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 93.78
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 93.77
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 93.75
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 93.67
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 93.58
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 93.55
d1id1a_153 Rck domain from putative potassium channel Kch {Es 93.54
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 93.45
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 93.39
d2ozga1105 Putative acetyltransferase Ava4977 {Anabaena varia 93.33
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 93.31
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 93.31
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 93.3
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.28
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 93.23
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 93.19
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 93.15
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 93.15
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 93.11
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 93.08
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 93.06
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.92
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 92.92
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 92.9
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 92.81
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 92.77
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.59
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 92.59
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 92.53
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 92.53
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 92.53
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 92.52
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 92.41
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 92.35
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 92.32
d1y7ta1154 Malate dehydrogenase {Thermus thermophilus [TaxId: 92.31
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 92.14
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.05
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 91.97
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 91.92
d2i00a1106 Putative acetyltransferase EF2353 {Enterococcus fa 91.88
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 91.79
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 91.76
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 91.65
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 91.46
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 91.3
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 91.17
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 90.95
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 90.93
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 90.92
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.91
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 90.83
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 90.81
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 90.73
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 90.64
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 90.58
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.55
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 90.48
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 90.22
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 90.16
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 90.02
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 89.99
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 89.99
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 89.98
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 89.91
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 89.63
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 89.6
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 89.56
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 89.12
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 89.11
d1yovb1426 UBA3 {Human (Homo sapiens) [TaxId: 9606]} 89.04
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 88.95
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 88.71
d2fy8a1129 Potassium channel-related protein MthK {Archaeon M 88.66
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 88.56
d5mdha1154 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 88.3
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 87.78
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 87.71
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 87.5
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 87.43
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 87.35
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 87.33
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 87.1
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.67
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 86.17
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 85.98
d2fr1a2209 Erythromycin synthase, eryAI, 1st ketoreductase mo 85.54
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 85.54
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 85.53
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 84.75
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 84.73
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 84.41
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 84.39
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 84.38
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 84.37
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 84.26
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 84.11
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 83.97
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 83.97
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 83.77
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 83.77
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 83.73
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 83.65
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 83.6
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 83.58
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 83.56
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 83.39
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 83.2
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 83.11
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 82.77
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 82.75
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 82.71
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 82.18
d1yova1 529 Amyloid beta precursor protein-binding protein 1, 81.8
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 81.19
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 80.93
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 80.85
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 80.81
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 80.31
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 80.27
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 80.27
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 80.22
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 80.19
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: (s)-1-phenylethanol dehydrogenase
species: Azoarcus sp. ebn1 [TaxId: 76114]
Probab=100.00  E-value=2.8e-53  Score=393.05  Aligned_cols=235  Identities=26%  Similarity=0.370  Sum_probs=204.5

Q ss_pred             ccCCcEEEEecCCchHHHHHHHHHHHcCCeEEEEecCCCCCCCCcccHHHHHHHHHHcCCeeeeeeecCCChHHHHHHHH
Q psy6113           6 KLSGLTIFITGASRGIGKAIALKAAKDGANIVIAAKTAEPHPKLPGTIYSAAKEVEDAGGNCLPCIVDIRDEHAVQSAVN   85 (406)
Q Consensus         6 ~l~gk~alVTGas~GIG~aia~~La~~Ga~Vvl~~r~~~~~~~~~~~i~~~~~~~~~~g~~~~~~~~Dl~~~~~v~~~~~   85 (406)
                      +|+||++|||||++|||+++|++|+++|++|++++|+.++         .....++..+.++.++.+|++|+++++++++
T Consensus         2 rL~gKvalVTGas~GIG~aia~~la~~Ga~V~~~~~~~~~---------~~~~~~~~~g~~~~~~~~Dvs~~~~v~~~~~   72 (247)
T d2ew8a1           2 RLKDKLAVITGGANGIGRAIAERFAVEGADIAIADLVPAP---------EAEAAIRNLGRRVLTVKCDVSQPGDVEAFGK   72 (247)
T ss_dssp             TTTTCEEEEETTTSHHHHHHHHHHHHTTCEEEEEESSCCH---------HHHHHHHHTTCCEEEEECCTTCHHHHHHHHH
T ss_pred             CCCCCEEEEeCCCCHHHHHHHHHHHHCCCEEEEEECCchH---------HHHHHHHHcCCcEEEEEeeCCCHHHHHHHHH
Confidence            6999999999999999999999999999999999998652         3455677788999999999999999999999


Q ss_pred             HHHHhcCCccEEEecccccccCCCCCCChhhhhhhhhhccccceEEeccchhhHHHHHHHHHhhcCCcceEecccccccc
Q psy6113          86 AAVDKFGGIDILVNNASAISLTDTANTPLKKYDLMNQINARGTYLVKASQGLEIQSAVNAAVDKFGGIDILVNNASAISL  165 (406)
Q Consensus        86 ~i~~~~g~iD~linnAG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~g~id~li~~ag~~~~  165 (406)
                      ++.++||+||+||||||+....++                                                        
T Consensus        73 ~~~~~~G~iDilVnnAG~~~~~~~--------------------------------------------------------   96 (247)
T d2ew8a1          73 QVISTFGRCDILVNNAGIYPLIPF--------------------------------------------------------   96 (247)
T ss_dssp             HHHHHHSCCCEEEECCCCCCCCCG--------------------------------------------------------
T ss_pred             HHHHHcCCCCEEEECCCCCCCCCh--------------------------------------------------------
Confidence            999999999999999998755443                                                        


Q ss_pred             CCCCCCchhhHHHHHhhhhhHHHHHHHhhhHHhHhcCCCeEEEeCCCCCCCCCccCCchhhhHhhHHHHHHHHHHHHhhc
Q psy6113         166 TDTANTPLKKYDLMNQINARGTYLVSQKCLPYLKKSNHAHILNISPPLNLNPFWFKNHVAYTISKYGMSMCALGMAEEFK  245 (406)
Q Consensus       166 ~~~~~~~~~~~~~~~~vN~~g~~~l~~~~~p~m~~~~~g~Iv~vsS~~~~~~~~~~~~~~Y~asKaal~~l~~~la~e~~  245 (406)
                         .+++.++|++++++|+.++|+++|+++|+|++++.|+||++||..+..+  .+++.+|++||+|+.+|+|+||.|++
T Consensus        97 ---~~~~~e~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~Iv~isS~~~~~~--~~~~~~Y~asKaal~~ltk~lA~ela  171 (247)
T d2ew8a1          97 ---DELTFEQWKKTFEINVDSGFLMAKAFVPGMKRNGWGRIINLTSTTYWLK--IEAYTHYISTKAANIGFTRALASDLG  171 (247)
T ss_dssp             ---GGCCHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCEEEEEECCGGGGSC--CSSCHHHHHHHHHHHHHHHHHHHHHG
T ss_pred             ---HhCCHHHhhhhheeehhhhhHHHHHHHhHHHhcCCCCccccccchhccc--CcccccchhhhccHHHHHHHHHHHhc
Confidence               3899999999999999999999999999999999999999999999877  47899999999999999999999999


Q ss_pred             CCCeEEEEecchhhhhHHHHHHhcCC--------CcccccccCChhhHHHHHHHhhcCCCCCccceEE-EehhHH
Q psy6113         246 GDNIAVNALWPRTAIYTAAIEMLTGG--------SADAKATSRKPEIMADAAYYILSSNPPSLTGQFL-IDDEVL  311 (406)
Q Consensus       246 ~~gI~vn~v~PG~~~~t~~~~~~~~~--------~~~~~~~~~~pe~vA~~v~~L~s~~~~~~tG~~i-~d~g~~  311 (406)
                      ++|||||+|+||+ +.|++.+.....        ...+.+|+.+|||||++++||+|+.++|+||+.| +|||++
T Consensus       172 ~~gIrVN~I~PG~-i~T~~~~~~~~~~~~~~~~~~~~~l~r~~~pedvA~~v~fL~S~~s~~itG~~i~vDGG~~  245 (247)
T d2ew8a1         172 KDGITVNAIAPSL-VRTATTEASALSAMFDVLPNMLQAIPRLQVPLDLTGAAAFLASDDASFITGQTLAVDGGMV  245 (247)
T ss_dssp             GGTEEEEEEEECC-C------------------CTTSSSCSCCCTHHHHHHHHHHTSGGGTTCCSCEEEESSSCC
T ss_pred             ccCeEEEEEeeCC-CCCccccccccchhHHHHHHHhccCCCCCCHHHHHHHHHHHhCchhcCCcCCeEEECCCEe
Confidence            9999999999996 677665443221        1125667889999999999999999999999999 788764



>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1c44a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1ikta_ d.106.1.1 (A:) SCP2-like domain of MFE-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1pz4a_ d.106.1.1 (A:) Sterol carrier protein 2 (SCP2) {Yellow fever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfra_ d.106.1.1 (A:) Hypothetical protein TT1886 (TTHA0401) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cfua1 d.106.1.3 (A:530-655) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u7za_ c.72.3.1 (A:) Coenzyme A biosynthesis bifunctional protein CoaBC, phosphopantothenoylcysteine synthase domain (CoaB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1p9oa_ c.72.3.1 (A:) Phosphopantothenoylcysteine synthetase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hv2a1 d.106.1.4 (A:287-397) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ozga1 d.106.1.4 (A:291-395) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2i00a1 d.106.1.4 (A:301-406) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yovb1 c.111.1.2 (B:12-437) UBA3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2fy8a1 c.2.1.9 (A:116-244) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fr1a2 c.2.1.2 (A:1448-1656) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yova1 c.111.1.2 (A:6-534) Amyloid beta precursor protein-binding protein 1, APPBP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure